PaperBLAST

PaperBLAST Hits for WP_003220489.1 glycosyltransferase (Bacillus spizizenii) (392 a.a., MKKHHISMIN...)

Show query sequence

>WP_003220489.1 glycosyltransferase (Bacillus spizizenii)
MKKHHISMINIPAYGHVNPTLALVEKLCEKGHRVTYATTEEFAPAVQQAGGEALIYHTSL
NIDPKQIREMMEKNDATLSLLKESLSILPQLEELYKDDQPDLIIYDFVALAGKLFADKLN
VPVIKLCSSYAQNESFQLGNEDMLKKIKEAEAEFKAYLEQEQLPAVSFEQLAVPEALNIV
FMPKSFQIQHETFDDRFCFVGPSLGKRTEQESLLIDKGDRPLMLISLGTAFNAWPEFYKM
CIDAFRDSSWQVIMSVGKSIDPESLDDTPANFTIRQSVPQLEVLAKADLFISHGGMNSTM
EAMNAGVPLVVIPQMYEQELTAKRVDELGLGVYLQREEVTVSKLQEAVQAVSGDQELLSR
VKSMQKDVKEAGGAERAAAEIEAFMKKSAVPQ

Running BLASTp...

Found 251 similar proteins in the literature:

WP_003220489 glycosyltransferase from Bacillus spizizenii
100% identity, 100% coverage

• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...GTs, BsUGT398 and BsUGT489, from B. subtilis ATCC 6633 (GenBank Protein accession nos. WP_003225398 and WP_003220489, respectively) [ 4 ]. To classify which genes were responsible for the biotransformation of GAA, GT genes were first annotated from the GA A07 genome. The 40 identified GT genes...”
• Uridine Diphosphate-Dependent Glycosyltransferases from Bacillus subtilis ATCC 6633 Catalyze the 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2018
  • “...), were identified as putative gene candidates. The results revealed BsUGT489 (GenBank Protein Accession No. WP_003220489) of B. subtilis ATCC 6633 was clustered with three validated UGTs (gray background in Figure 2 ). BsUGT398 (GenBank Protein Accession No. WP_003225398), BsGT110 (GenBank Protein Accession No. WP_003220110), BsGT292...”

7vlbA / A0A289QH46 Crystal structure of ugt109a1 from bacillus
100% identity, 98% coverage

• Ligand: uridine-5'-diphosphate (7vlbA)

NDPGT_BACSU / O34539 NDP-glycosyltransferase YjiC; UDP-glycosyltransferase YjiC; EC 2.4.1.384 from Bacillus subtilis (strain 168) (see 3 papers)
O34539 NDP-glycosyltransferase (EC 2.4.1.384) from Bacillus subtilis (see 2 papers)
NP_389104 putative glycosyltransferase from Bacillus subtilis subsp. subtilis str. 168
95% identity, 100% coverage

• function: Glycosyltransferase that can glycosylate a wide range of substrates, including various flavonoids, phenyl ketones, curcuminoid, lignins, zingerone, triterpenes, stilbene and anthraquinone, using UDP- glucose or ADP-glucose as sugar donor (PubMed:28315700, PubMed:33152360). It also exhibits O-, N- and S-glycosylation activities towards simple aromatics (PubMed:28315700). In vivo, the broad acceptor tolerance of YjiC might function as a detoxification agent against exogenous xenobiotics to make the strain adaptable to the changeable environment (Probable).
  catalytic activity: an NDP-glycose + an acceptor = a glycosylated acceptor + NDP.
  subunit: Monomer.
• Recent Advances in the Metabolic Engineering of Yeasts for Ginsenoside Biosynthesis
  Chu, Frontiers in bioengineering and biotechnology 2020
  • “...(AKQ76388), UGTPg1 (AIE12479), UGTPg101 (AKQ76389), UGTPg29 (AKA44579), UGTPg74AE2 (AGR44631), UGTPg45 (AKA44586), and B. subtilis YjiC (NP_389104), UGT109A1 (ASY97769). Subsequently, the condensation of IPP and DMAPP was catalyzed by farnesyl diphosphate synthase (FPS/ERG20) to form farnesyl diphosphate (FPP). Next, FPP was converted into 2,3-oxidosqualene through two enzymatic...”
• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...microbial GTs were validated to have triterpenoid glycosylation activity, including BsYjiC (GenBank Protein accession no. NP_389104) from B. subtilis 168 [ 19 , 20 , 21 , 22 , 23 ], UGT109A1 (GenBank Protein accession no. ASY97769) from B. subtilis CTCG 63501 [ 24 , 28...”
• Uridine Diphosphate-Dependent Glycosyltransferases from Bacillus subtilis ATCC 6633 Catalyze the 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2018
  • “...three microbial UGTs were validated with triterpenoid glycosylation activity, including BsYjiC (GenBank Protein Accession No. NP_389104) from B. subtilis 168 [ 19 , 20 ], UGT109A1 (GenBank Protein Accession No. ASY97769) from B. subtilis CTCG 63501 [ 21 ], and BsGT1 (GenBank Protein Accession No. ANP92054)...”

7vlbB / A0A289QH46 Crystal structure of ugt109a1 from bacillus
92% identity, 98% coverage

• Ligand: uridine-5'-diphosphate (7vlbB)

6kqxA / O34539 Crystal structure of yijc from b. Subtilis in complex with udp (see paper)
82% identity, 97% coverage

• Ligand: uridine-5'-diphosphate (6kqxA)

NDPGT_BACLD / Q65JC2 NDP-glycosyltransferase YjiC; UDP-glucosyltransferase YjiC; EC 2.4.1.384 from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) (see 8 papers)
Q65JC2 flavone 7-O-beta-glucosyltransferase (EC 2.4.1.81) from Bacillus licheniformis (see paper)
AAU40842.1 UDP-Glc: isoflavonoid β-glucosyltransferase (YjiC;BLi01948;BL00446) (EC 2.4.1.-) (see protein)
56% identity, 98% coverage

• function: Glycosyltransferase that can glycosylate a wide range of substrates, including various flavonoids (flavones, flavonols, flavanones, flavanols, chalcones), isoflavonoids and stilbenes, to produce multiple glycosylated products (PubMed:23542617, PubMed:23974133, PubMed:24170092, PubMed:24893262, PubMed:24949266, PubMed:25239890, PubMed:27444326, PubMed:32238768). It can accept diverse nucleotide diphosphate-D/L-sugars as donors, including ADP-, GDP-, CDP-, TDP- or UDP-alpha-D-glucose, and catalyzes O-, N-, or S- glycosylation (PubMed:23542617, PubMed:23974133, PubMed:24170092, PubMed:24893262, PubMed:24949266, PubMed:25239890, PubMed:27444326, PubMed:32238768). In vitro, catalyzes the glycosylation of, among others, apigenin, 3-hydroxyflavone, phloretin or resveratrol, resulting in multiple glucosylated products, along with mono-, di-, tri- and tetraglucosides (PubMed:23542617, PubMed:23974133, PubMed:24170092, PubMed:24893262, PubMed:25239890, PubMed:27444326). Can also catalyze the glycosylation of the macrolide epothilone A with diverse NDP-D/L- sugars, forming different epothilone A glycoside derivatives (PubMed:24949266).
  catalytic activity: an NDP-glycose + an acceptor = a glycosylated acceptor + NDP.
• Polyphenol Utilization Proteins in the Human Gut Microbiome.
  Zheng, Applied and environmental microbiology 2022
  • “...Figure 3 and Fig. S1 showed that the 60 PUP seeds (except for I5AX49 and Q65JC2 ) contain in total 40 unique Pfam protein domains. According to a set of criteria (see Materials and Methods) and the sequence similarity network (SSN) analysis ( Fig. 3 ),...”
  • “...Pfam domain or multidomain combination ( Table 1 ). The two PUPs ( I5AX49 and Q65JC2 ) without Pfam domains were defined as two unclassified families. Therefore, dbPUP contains in total 26 protein families of six enzymatic classes according to their enzyme commission (EC) numbers at...”

SACE_3599 antibiotic resistance macrolide glycosyltransferase from Saccharopolyspora erythraea NRRL 2338
40% identity, 97% coverage

• Identification and Characterization of a Novel N- and O-Glycosyltransferase from Saccharopolyspora erythraea
  Gutacker, Molecules (Basel, Switzerland) 2020
  • “...to find the responsible glycosyltransferase, gene deletion experiments were performed and we identified the glycosyltransferase Sace_3599, which belongs to the CAZy family 1. When Streptomyces albus J1074, containing the dTDP- d -glucose synthase gene oleS and the plasmid pUWL-A- sace_3599 , was used as host, U3...”
  • “...show homology to Uridine diphosphate (UDP)-glucosyltransferases and N -GTs of family 1 ( sace_1884 , sace_3599 , sace_4470 ). All these GT genes are not located close to biosynthetic gene clusters, but distributed throughout the genome. 2.3. Heterologous Expression of Sace_3599 in S. albus Gluc To...”
• Transcriptome-guided target identification of the TetR-like regulator SACE_5754 and engineered overproduction of erythromycin in Saccharopolyspora erythraea
  Wu, Journal of biological engineering 2019
  • “...the targets of SACE_5754, and confirmed that transcription of SACE_0388 (encoding a pyruvate, water diknase), SACE_3599 (encoding an antibiotic resistance macrolide glycosyltransferase) and SACE_6149 (encoding a FAD-binding monooxygenase) were directly repressed by SACE_5754. A consensus palindromic sequence TYMAGG-n2/n4/n11-KKTKRA (Y: C/T, M: A/C, K: T/G, R: A/G)...”
  • “...and SACE_6148 were not affected by SACE_5754 deletion, but the transcriptional levels of SACE_0388 , SACE_3599 and SACE_6149 were increased by 158-, 4.7- and 95- folds, respectively (Fig. 3 d). It seemed that SACE_5754 directly represses the transcription of SACE_0388 , SACE_3599 and SACE_6149 . Fig....”
• Comparison of Antibiotic Resistance Mechanisms in Antibiotic-Producing and Pathogenic Bacteria
  Ogawara, Molecules (Basel, Switzerland) 2019
  • “...further rRNA methyltransferases are present in the genome. Furthermore, two putative macrolide glycosyltransferases (SACE_1884, and SACE_3599), and a number of efflux proteins for antibiotics exist outside of the cluster ( Table S1 ) [ 105 ]. These genes may be involved in the self-resistance. Oleandomycin is...”

2iyaA / Q3HTL7 The crystal structure of macrolide glycosyltransferases: a blueprint for antibiotic engineering (see paper)
38% identity, 93% coverage

• Ligands: uridine-5'-diphosphate; (3s,5r,6s,7r,8r,11r,12s,13r,14s,15s)-6-hydroxy-5,7,8,11,13,15-hexamethyl-4,10-dioxo-14-{[3,4,6-trideoxy-3-(dimethylamino)-beta-d-xylo-hexopyranosyl]oxy}-1,9-dioxaspiro[2.13]hexadec-12-yl 2,6-dideoxy-3-o-methyl-alpha-l-arabino-hexopyranoside (2iyaA)

oleI / Q3HTL7 oleandomycin glycosyltransferase from Streptomyces antibioticus (see 3 papers)
ABA42118.2 oleandomycin glycosyltransferase (OleI) (EC 2.4.1.-) (see protein)
36% identity, 87% coverage

3ia7A / Q8KNC3 Crystal structure of calg4, the calicheamicin glycosyltransferase (see paper)
37% identity, 98% coverage

• Ligand: calcium ion (3ia7A)

WP_006608209 macrolide family glycosyltransferase from Streptomyces auratus AGR0001
34% identity, 96% coverage

• Characterization and engineering of the biosynthesis gene cluster for antitumor macrolides PM100117 and PM100118 from a marine actinobacteria: generation of a novel improved derivative
  Salcedo, Microbial cell factories 2016
  • “...WP_040902110 82/91 3-oxoacyl-ACP synthase III gonA 146 WP_040902049 72/84 Cold-Shock DNA-binding domain-containing protein gonG3 402 WP_006608209 55/68 Glycosyltransferase gonMT 345 WP_014208548 49/62 Methylase involved in ubiquinone/menaquinone biosynthesis gonS2 344 WP_040246457 81/90 3-Oxoacyl-ACP synthase III gonP8 2408 WP_006608212 58/59 Type I polyketide synthase (loading module and extension...”

BAA84592.1 TDP-L-oleandrose: avermectin iterative α-L-oleandrosyltransferase (AveBI) (EC 2.4.1.-) (see protein)
34% identity, 93% coverage

AAC12648.1 UDP-Glc: oleandomycin β-glucosyltransferase (OleI) (EC 2.4.1.-) (see protein)
34% identity, 87% coverage

7xx4A / Q3HTL6 Designed glycosyltransferase (see paper)
33% identity, 96% coverage

• Ligand: uridine-5'-diphosphate-glucose (7xx4A)

AAS41089.1 UDP-Glc: β-glucosyltransferase (BcGT-1;BCE2168) (EC 2.4.1.-) (see protein)
34% identity, 94% coverage

3rscA / Q8KNE0 Crystal structure of calg2, calicheamicin glycosyltransferase, tdp and calicheamicin t0 bound form (see paper)
36% identity, 92% coverage

• Ligands: thymidine-5'-diphosphate; calicheamicin t0 (3rscA)

SACE_1884 antibiotic resistance macrolide glycosyltransferase from Saccharopolyspora erythraea NRRL 2338
36% identity, 93% coverage

• Identification and Characterization of a Novel N- and O-Glycosyltransferase from Saccharopolyspora erythraea
  Gutacker, Molecules (Basel, Switzerland) 2020
  • “...gene products show homology to Uridine diphosphate (UDP)-glucosyltransferases and N -GTs of family 1 ( sace_1884 , sace_3599 , sace_4470 ). All these GT genes are not located close to biosynthetic gene clusters, but distributed throughout the genome. 2.3. Heterologous Expression of Sace_3599 in S. albus...”
  • “...S. albus Gluc is controlled by the constitutive ermE* promoter [ 37 ]. Plasmids containing sace_1884 , sace_3599 , and sace_4470 were introduced into S. albus Gluc, leading to S. albus Gluc x pUWL-A- sace_1884 , S. albus Gluc x pUWL-A- sace_3599 , and S. albus...”
• Comparison of Antibiotic Resistance Mechanisms in Antibiotic-Producing and Pathogenic Bacteria
  Ogawara, Molecules (Basel, Switzerland) 2019
  • “...addition, 11 further rRNA methyltransferases are present in the genome. Furthermore, two putative macrolide glycosyltransferases (SACE_1884, and SACE_3599), and a number of efflux proteins for antibiotics exist outside of the cluster ( Table S1 ) [ 105 ]. These genes may be involved in the self-resistance....”

CAC33935.1 SCO6090 or SCBAC1A6.14 (EC 2.4.1.-) (see protein)
32% identity, 91% coverage

BC2066 Macrolide glycosyltransferase from Bacillus cereus ATCC 14579
33% identity, 94% coverage

• Necrotrophism is a quorum-sensing-regulated lifestyle in Bacillus thuringiensis
  Dubois, PLoS pathogens 2012
  • “...the necrotrophic development of Bt . A putative efflux system (BC1063), two macrolide glycosyl transferases (BC2066 and BC2622) and a N-hydroxyarylamine O-acetyltransferase could be involved in resistance to antimicrobial molecules, and cytochrome P450 (BC2613) may be involved in resistance to reactive oxygen species. The membrane-associated proteins...”

ABA28305.1 macrolide glycosyltransferase (MGT) (EC 2.4.1.-) (see protein)
32% identity, 92% coverage

FQZ25_16345 macrolide family glycosyltransferase from Bacillus thuringiensis
33% identity, 94% coverage

• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...glycosyltransferase (GT) family genes were identified from the complete genome, among which three genes ( FQZ25_16345 , FQZ25_19840 , and FQZ25_19010 ) were closely related to BsUGT398 and BsUGT489. Two of the three candidate genes, FQZ25_16345 and FQZ25_19010 , were successfully cloned and expressed in a...”
  • “...4 ). Among the 40 GTs, one GT1 ( FQZ25_19010 ) and two GT28 ( FQZ25_16345 , FQZ25_19840 ) family genes were most closely related to the five validated genes (marked by stars in Figure 4 ), and were considered putative gene candidates. 2.4. Cloning, Overexpression,...”

oleD / Q53685 oleandomycin glycosyltransferase from Streptomyces antibioticus (see 4 papers)
Q53685 Oleandomycin glycosyltransferase from Streptomyces antibioticus
31% identity, 88% coverage

• Crystal structure of the MurG:UDP-GlcNAc complex reveals common structural principles of a superfamily of glycosyltransferases
  Hu, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...GT (oleandomycin GTase, Streptomyces antibioticus, Q53685); flavonol GluT (flavonol O3-glucosyltransferase, Perilla frutescens, O04114); rhamnosylT (UDP...”

tylCV / Q9XC67 demethyllactenocin mycarosyltransferase (EC 2.4.1.318) from Streptomyces fradiae (see paper)
TYLCV_STRFR / Q9XC67 Demethyllactenocin mycarosyltransferase; EC 2.4.1.318 from Streptomyces fradiae (Streptomyces roseoflavus) (see paper)
Q9XC67 demethyllactenocin mycarosyltransferase (EC 2.4.1.318) from Streptomyces fradiae (see paper)
AAD41824.1 mycarosyltransferase (TylCV) (EC 2.4.1.-) (see protein)
34% identity, 84% coverage

• function: Involved in the biosynthesis of mycarose which is a 6- deoxyhexose sugar required during production of the macrolide antibiotic tylosin. Catalyzes the transfer of L-mycarosyl from dTDP- beta-L-mycarose to demethyllactenocin to yield demethylmacrocin.
  catalytic activity: dTDP-beta-L-mycarose + demethyllactenocin = demethylmacrocin + dTDP + H(+) (RHEA:14649)
  disruption phenotype: Cells lacking this gene accumulate desmycosin (tylosin B).

6j31B / A0A514S208 Crystal structure analysis of the glycotransferase of kitacinnamycin (see paper)
30% identity, 97% coverage

• Ligand: peptide (6j31B)

ABA42119.2 UDP-Glc: oleandomycin glycosyltransferase (OleD;UGT102A2) (EC 2.4.1.-) (see protein)
31% identity, 91% coverage

KALB_6579 macrolide family glycosyltransferase from Kutzneria albida DSM 43870
33% identity, 94% coverage

• Complete genome sequence of producer of the glycopeptide antibiotic Aculeximycin Kutzneria albida DSM 43870T, a representative of minor genus of Pseudonocardiaceae
  Rebets, BMC genomics 2014
  • “...be explained by the fact that some of them might participate in self-resistance mechanism. AcuGT3 (KALB_6579) has a high degree of similarity to numerous glycosyltransferases involved in resistance to macrolides, including one involved in self-resistance of oleandomycin producer [ 44 , 45 ]. Another component of...”

AAA26780.1 macrolide glycosyltransferase (Mgt;UGT102A1) (EC 2.4.1.-) (see protein)
Q54387 Macrolide glycosyltransferase from Streptomyces lividans
31% identity, 91% coverage

• Molecular basis of intrinsic macrolide resistance in the Mycobacterium tuberculosis complex
  Buriánková, Antimicrobial agents and chemotherapy 2004
  • “...such as glycosyltransferases, e.g., MgtA (accession no. Q54387) from Streptomyces lividans and OleI (accession no. AAC12648) from Streptomyces antibioticus,...”
• Crystal structure of the MurG:UDP-GlcNAc complex reveals common structural principles of a superfamily of glycosyltransferases
  Hu, Proceedings of the National Academy of Sciences of the United States of America 2003
  • “...GT (macrolide GTase, Streptomyces lividans, Q54387); daunosamin GT (daunosamine transferase, Stretomyces peucetius, Q54824); zeaxanthin GluT (zeaxanthin...”

7vm0B / O31853 Crystal structure of yojk from b.Subtilis in complex with udp (see paper)
32% identity, 95% coverage

• Ligand: uridine-5'-diphosphate (7vm0B)

BSU19420 putative glycosyltransferase from Bacillus subtilis subsp. subtilis str. 168
32% identity, 95% coverage

• Secondary structural entropy in RNA switch (Riboswitch) identification
  Manzourolajdad, BMC bioinformatics 2015
  • “...-43.21 - 0.3300 123.4840012 - 0.4200 199 cotD BSU22200 0.8028732538 200 nt 2116670 2116869 reverse BSU19420 yojK -282 -43.45 - 0.3300 123.3679962 - 0.3150 99 cwlS BSU19410 0.8022140265 200 nt 3941242 3941441 reverse BSU38430 gspA -3219 -42.84 - 0.4300 126.9950027 - 0.4600 1699 ywbA BSU38390 0.8019362092...”

GYO_2344 macrolide family glycosyltransferase from Bacillus spizizenii TU-B-10
32% identity, 93% coverage

• Disparate Effects of Two Clerodane Diterpenes of Giant Goldenrod (Solidago gigantea Ait.) on Bacillus spizizenii
  Bozsó, International journal of molecular sciences 2024
  • “...importance of menaquinone dependent respiratory electron transport during diterpene-induced stress response. Finally, a putative glycosyltransferase (GYO_2344, yojK ) was activated in all samples. Glycosyltransferases catalyze the transfer of sugar moieties to an acceptor molecule. B. subtilis has three putative UDP-glycosyltransferases with broad substrate ranges, capable of...”
  • “...glycerol-3-phosphate dehydrogenase GYO_1674 2.3 1.8 2.8 1.2 B. subtilis (BSU_13490) htpX , stress-responsive membrane protease GYO_2344 2.4 2.5 2.6 2.9 B. subtilis (BSU_19420) yojK similar to macrolide glycosyltransferase GYO_2953 1.1 1.0 2.1 1.7 B. subtilis (BSU_27160) yrhJ , cytochrome P450, fatty acid metabolism GYO_3335 1.1 2.1...”

WP_003220110 macrolide family glycosyltransferase from Bacillus spizizenii
31% identity, 93% coverage

• Uridine Diphosphate-Dependent Glycosyltransferases from Bacillus subtilis ATCC 6633 Catalyze the 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2018
  • “...in Figure 2 ). BsUGT398 (GenBank Protein Accession No. WP_003225398), BsGT110 (GenBank Protein Accession No. WP_003220110), BsGT292 (GenBank Protein Accession No. WP_032727292), and BsGT296 (GenBank Protein Accession No. WP_003219296) were closely related to the UGT cluster. Thus, the five candidates (bold text in Figure 2 )...”

AAS41737.1 flavonoid β-3(7)-O-glucosyltransferase (BcGT-3;BCE2825) (EC 2.4.1.-) (see protein)
32% identity, 95% coverage

CDR20291_2958 macrolide family glycosyltransferase from Clostridioides difficile R20291
34% identity, 94% coverage

• Identification of two glycosyltransferases required for synthesis of membrane glycolipids in <i>Clostridioides difficile</i>
  Zbylicki, mBio 2025
  • “...37 ). We chose cdr20291_0008 (named ugtA ), cdr20291_1186 (named ugtB ), cdr20291_0773 , and cdr20291_2958 for further study. We chose not to follow up on cdr20291_2539 ( murG ) , cdr20291_2614 ( hexS ) , and cdr20291_2658 because these already have known functions in synthesis...”
• HexSDF Is Required for Synthesis of a Novel Glycolipid That Mediates Daptomycin and Bacitracin Resistance in C. difficile
  Pannullo, mBio 2023
  • “...three C. difficile genes predicted to encode UgtP-like homologs ( cdr20291_0008 , cdr20291_1186 , and cdr20291_2958 ) synthesizes MHDRG and HexS and then adds N -acetyl-hexosyl to MHDRG to generate HNacHDRG. This is supported by our data showing that HexS is absolutely required for HNHDRG synthesis....”

KALB_6584 macrolide family glycosyltransferase from Kutzneria albida DSM 43870
32% identity, 95% coverage

• Complete genome sequence of producer of the glycopeptide antibiotic Aculeximycin Kutzneria albida DSM 43870T, a representative of minor genus of Pseudonocardiaceae
  Rebets, BMC genomics 2014
  • “...or AcuN2 (Additional file 1 : Table S1). Eight putative glycosyltransferase genes ( acuGT1-8 ; KALB_6584, 6581, 6579, 6575, 6574, 6570, 6569, 6559) were found within the aculeximycin biosynthesis gene cluster. The redundant number of GTs can be explained by the fact that some of them...”

WP_003225398 macrolide family glycosyltransferase from Bacillus spizizenii
33% identity, 97% coverage

• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...and two GTs, BsUGT398 and BsUGT489, from B. subtilis ATCC 6633 (GenBank Protein accession nos. WP_003225398 and WP_003220489, respectively) [ 4 ]. To classify which genes were responsible for the biotransformation of GAA, GT genes were first annotated from the GA A07 genome. The 40 identified...”
• Uridine Diphosphate-Dependent Glycosyltransferases from Bacillus subtilis ATCC 6633 Catalyze the 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2018
  • “...with three validated UGTs (gray background in Figure 2 ). BsUGT398 (GenBank Protein Accession No. WP_003225398), BsGT110 (GenBank Protein Accession No. WP_003220110), BsGT292 (GenBank Protein Accession No. WP_032727292), and BsGT296 (GenBank Protein Accession No. WP_003219296) were closely related to the UGT cluster. Thus, the five candidates...”

J8Y18_13760 macrolide family glycosyltransferase from Bacillus cereus
33% identity, 95% coverage

• Investigating the Role of OrbF in Biofilm Biosynthesis and Regulation of Biofilm-Associated Genes in Bacillus cereus BC1
  Sun, Foods (Basel, Switzerland) 2024
  • “...IV subunit A ( J8Y18_17815 ), phosphoribosylamine-glycine ligase ThiC (J8Y18_25845 ), glycosyltransferase family I ( J8Y18_13760 ), adenosine succinate hydrolase ( J8Y18_01690 ), and UDP-N-acetylglucosamine lipid carrier transferase ( J8Y18_08880 ) ( Table 2 ). The gene encoding adenosine succinate hydrolase, J8Y18_01690 , plays a role...”
  • “...NJS-5-10 J8Y18_17815 (2424) DNA topoisomerase IV subunit A NJS-5-26 J8Y18_25845 (1761) phosphomethylpyrimidine synthase ThiC NJS-5-26 J8Y18_13760 (1194) glycosyl transferase family 1 NJS-5-58 J8Y18_01690 (1308) adenylosuccinate lyase NJS-5-73 J8Y18_08880 (804) UDP-galactose-lipid carrier transferase...”

WP_051422100 macrolide family glycosyltransferase from Streptomyces griseolus
29% identity, 97% coverage

• Biological characterization of the hygrobafilomycin antibiotic JBIR-100 and bioinformatic insights into the hygrolide family of natural products
  Molloy, Bioorganic & medicinal chemistry 2016
  • “...S. halstedii genome is a glycosyltransferase that might be responsible for hygrolide glycosylation (GenBank accession WP_051422100), given its 34% protein sequence identity and 49% similarity to the K . sp. MBT66 leucanicidin glycosyltransferase. This homologue is also found in the genome of S . sp. DpondAA-B6,...”

FQZ25_19840 macrolide family glycosyltransferase from Bacillus thuringiensis
32% identity, 95% coverage

• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...family genes were identified from the complete genome, among which three genes ( FQZ25_16345 , FQZ25_19840 , and FQZ25_19010 ) were closely related to BsUGT398 and BsUGT489. Two of the three candidate genes, FQZ25_16345 and FQZ25_19010 , were successfully cloned and expressed in a soluble form...”
  • “...Among the 40 GTs, one GT1 ( FQZ25_19010 ) and two GT28 ( FQZ25_16345 , FQZ25_19840 ) family genes were most closely related to the five validated genes (marked by stars in Figure 4 ), and were considered putative gene candidates. 2.4. Cloning, Overexpression, and Purification...”

BSU05720 putative glycosyltransferase from Bacillus subtilis subsp. subtilis str. 168
32% identity, 97% coverage

• Comparison of Bacillus subtilis transcriptome profiles from two separate missions to the International Space Station
  Morrison, NPJ microgravity 2019
  • “...BSU03300 nasD 2.45 2.66 1.42 2.02 Assimilatory nitrite reductase (subunit) Fur, NsrR, ResD, SigA, TnrA BSU05720 ydhE 1.32 1.33 1.23 1.27 Similar to macrolide glycosyltransferase LiaR BSU06240 bdhA 1.45 1.46 1.19 1.32 Acetoin reductase/butanediol dehydrogenase AbrB BSU10230 yhfH 1.19 1.29 1.59 1.74 Unknown Unknown BSU17710 tatAC...”

XNR_4394 macrolide family glycosyltransferase from Streptomyces albidoflavus
29% identity, 96% coverage

• Insights into naturally minimised Streptomyces albus J1074 genome
  Zaburannyi, BMC genomics 2014
  • “...for daunorubicin (XNR_2457-58, XNR_4042-43), camphor (XNR_2486-87), bicyclomycin (XNR_0140), tetracycline (XNR_3352) and one putative macrolide glycosyltransferase (XNR_4394). S. albus contains two genes for tryptophanyl-tRNA synthetase: XNR_3910 and XNR_3513, of which the latter is an ortholog of indolmycin-resistant Trp-synthetase from S. coelicolor [ 37 ]. It is worth...”

SACE_4470 glycosyltransferase; possible macrolide glycosyltransferase from Saccharopolyspora erythraea NRRL 2338
31% identity, 93% coverage

• Identification and Characterization of a Novel N- and O-Glycosyltransferase from Saccharopolyspora erythraea
  Gutacker, Molecules (Basel, Switzerland) 2020
  • “...to Uridine diphosphate (UDP)-glucosyltransferases and N -GTs of family 1 ( sace_1884 , sace_3599 , sace_4470 ). All these GT genes are not located close to biosynthetic gene clusters, but distributed throughout the genome. 2.3. Heterologous Expression of Sace_3599 in S. albus Gluc To identify the...”
  • “...by the constitutive ermE* promoter [ 37 ]. Plasmids containing sace_1884 , sace_3599 , and sace_4470 were introduced into S. albus Gluc, leading to S. albus Gluc x pUWL-A- sace_1884 , S. albus Gluc x pUWL-A- sace_3599 , and S. albus Gluc x pUWL-A- sace_4470 ,...”

FQZ25_19010 macrolide family glycosyltransferase from Bacillus thuringiensis
30% identity, 97% coverage

• A Genome-Centric Approach Reveals a Novel Glycosyltransferase from the GA A07 Strain of Bacillus thuringiensis Responsible for Catalyzing 15-O-Glycosylation of Ganoderic Acid A
  Chang, International journal of molecular sciences 2019
  • “...identified from the complete genome, among which three genes ( FQZ25_16345 , FQZ25_19840 , and FQZ25_19010 ) were closely related to BsUGT398 and BsUGT489. Two of the three candidate genes, FQZ25_16345 and FQZ25_19010 , were successfully cloned and expressed in a soluble form in Escherichia coli...”
  • “...with triterpenoid glycosylation activities ( Figure 4 ). Among the 40 GTs, one GT1 ( FQZ25_19010 ) and two GT28 ( FQZ25_16345 , FQZ25_19840 ) family genes were most closely related to the five validated genes (marked by stars in Figure 4 ), and were considered...”

SGGBAA2069_c10380 macrolide family glycosyltransferase from Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
30% identity, 82% coverage

• Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex
  Papadimitriou, BMC genomics 2014
  • “...(t) Glucan biosynthesis gene cluster - GALLO_1052 - SGGBAA2069_c10370 - - - - GALLO_1053 SGGB_1042 SGGBAA2069_c10380 - - - rggA GALLO_1054 SGGB_1043 SGGBAA2069_c10390 - - Sinf_0876 gtfA GALLO_1055 SGGB_1044 SGGBAA2069_c10400 - - Sinf_0877 rggB GALLO_1056 SGGB_1045 SGGBAA2069_c10410 - - - gtfB GALLO_1057 SGGB_1046 SGGBAA2069_c10420 - -...”

GALLO_1053 putative glycosyltransferase from Streptococcus gallolyticus UCN34
29% identity, 82% coverage

• Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex
  Papadimitriou, BMC genomics 2014
  • “...SMA_1299 Sinf_1186 (t) Glucan biosynthesis gene cluster - GALLO_1052 - SGGBAA2069_c10370 - - - - GALLO_1053 SGGB_1042 SGGBAA2069_c10380 - - - rggA GALLO_1054 SGGB_1043 SGGBAA2069_c10390 - - Sinf_0876 gtfA GALLO_1055 SGGB_1044 SGGBAA2069_c10400 - - Sinf_0877 rggB GALLO_1056 SGGB_1045 SGGBAA2069_c10410 - - - gtfB GALLO_1057 SGGB_1046 SGGBAA2069_c10420...”
• Genome sequence of Streptococcus gallolyticus: insights into its adaptation to the bovine rumen and its ability to cause endocarditis
  Rusniok, Journal of bacteriology 2010
  • “...California, Berkeley with a regulatory gene (Fig. 3B). gallo_1053, encoding a nonsecreted transferase, is preceded by an abrB-like regulatory gene, and the two...”

GBAA2638 glycosyl transferase, putative from Bacillus anthracis str. 'Ames Ancestor'
30% identity, 97% coverage

• The global transcriptional responses of Bacillus anthracis Sterne (34F2) and a Delta sodA1 mutant to paraquat reveal metal ion homeostasis imbalances during endogenous superoxide stress
  Passalacqua, Journal of bacteriology 2007
  • “...envelope GBAA0781 GBAA0837 GBAA1093 GBAA1650 GBAA1904 GBAA2638 GBAA3179 GBAA4738 GBAA4746 Membrane protein, putative Lipoprotein, putative S-layer protein,...”

SGGB_1042 macrolide family glycosyltransferase from Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
30% identity, 82% coverage

• Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex
  Papadimitriou, BMC genomics 2014
  • “...Sinf_1186 (t) Glucan biosynthesis gene cluster - GALLO_1052 - SGGBAA2069_c10370 - - - - GALLO_1053 SGGB_1042 SGGBAA2069_c10380 - - - rggA GALLO_1054 SGGB_1043 SGGBAA2069_c10390 - - Sinf_0876 gtfA GALLO_1055 SGGB_1044 SGGBAA2069_c10400 - - Sinf_0877 rggB GALLO_1056 SGGB_1045 SGGBAA2069_c10410 - - - gtfB GALLO_1057 SGGB_1046 SGGBAA2069_c10420 -...”

CA_P0045 Glycosyl transferase from Clostridium acetobutylicum ATCC 824
28% identity, 93% coverage

• A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
  Janssen, Applied microbiology and biotechnology 2010
  • “...protein 0.21 0.19 0.26 0.22 0.03 CA_P0044 Hypothetical protein 0.18 0.17 0.29 0.19 0.21 0.05 CA_P0045 Glycosyl transferase 0.19 0.18 0.23 0.14 0.18 0.04 G,C CA_P0053 xynb Xylanase 0.06 0.07 0.05 0.05 0.06 0.01 G CA_P0054 Xylanase/chitin deacetylase family protein 0.06 0.06 0.06 0.04 0.05 0.01...”

BC2622 Macrolide glycosyltransferase from Bacillus cereus ATCC 14579
30% identity, 78% coverage

• Necrotrophism is a quorum-sensing-regulated lifestyle in Bacillus thuringiensis
  Dubois, PLoS pathogens 2012
  • “...value (p) smaller than 0.01, were considered for subsequent analysis. The genes matching probes for BC2622, a macrolide glycosyltransferase, and BC3725, an exochitinase, were also investigated due to their functional similarity to the genes fulfilling these criteria. Quantitative RT-PCR confirmed that these 41 genes were at...”
  • “...development of Bt . A putative efflux system (BC1063), two macrolide glycosyl transferases (BC2066 and BC2622) and a N-hydroxyarylamine O-acetyltransferase could be involved in resistance to antimicrobial molecules, and cytochrome P450 (BC2613) may be involved in resistance to reactive oxygen species. The membrane-associated proteins are mainly...”
• The bcr1 DNA repeat element is specific to the Bacillus cereus group and exhibits mobile element characteristics
  Økstad, Journal of bacteriology 2004
  • “...Deoxyribonuclease, TatD family, putative BC2949 BC2622 BC0673 BC0556 Hypothetical membrane-spanning protein Macrolide glycosyltransferase (EC 2.4.1.-)...”

staG / Q83WG5 K252c N-glycosyltransferase from Streptomyces sp. TP-A0274 (see paper)
24% identity, 85% coverage

slr1125 zeaxanthin glucosyl transferase from Synechocystis sp. PCC 6803
25% identity, 90% coverage

• Photosynthesis in Synechocystis sp. PCC 6803 is not optimally regulated under very high CO₂
  Carrasquer-Alvarez, Applied microbiology and biotechnology 2025
  • “...rod linker polypeptide 2.28 1.71 2.82 sll1580 cpcC1 PBS rod linker polypeptide 2.27 2.04 3.05 slr1125 Probable glucosyl transferase 2.25 0.32 1.82 slr8021 Hypothetical protein 2.21 0.37 1.83 sll0268 Hypothetical protein 2.15 0.04 1.49 slr1042 pilH Two-component response regulator CheY subfamily 2.14 1.74 0.29 An interactive...”
• Comparative analysis of the Spirulina platensis subcellular proteome in response to low- and high-temperature stresses: uncovering cross-talk of signaling components
  Kurdrid, Proteome science 2011
  • “...protein in the present study was not the one encoded by the gene (AP07710045 or slr1125) shown in the potential PPI [Additional file 10 Figure S1b]. The Rubisco small subunit was found to be up-regulated in a moss, Physcomitrella patens , in response to abscisic acid...”
• Four novel genes required for optimal photoautotrophic growth of the cyanobacterium Synechocystis sp. strain PCC 6803 identified by in vitro transposon mutagenesis
  Zhang, Journal of bacteriology 2004
  • “...strain PCC 6803 genes (sll1495, sll0804, slr1306, and slr1125) which encode hypothetical proteins were determined by transposon mutagenesis to be required for...”
  • “...homologuec Malic enzyme 4YD9 3ZA12 4BA2 CG4 slr1125 slr1306 sll0804 sll1495 NAe NA NA NA Probable glucosyltransferasef Hypothetical proteinf Hypothetical...”

WP_006678995 glycosyltransferase from Paenibacillus dendritiformis C454
24% identity, 90% coverage

• Three enzymes involved in the N-methylation and incorporation of the pradimicin sugar moieties
  Napan, Bioorganic & medicinal chemistry letters 2015
  • “...proteins with the highest homology include two proposed GTs from Paenibacillus dendritiformis (GenBank accession number WP_006678995, 423 aa, 61% identity) and Bacillus cereus (GenBank accession number WP_002061747, 416 aa, 59% identity). However, none of these are functionally characterized. To understand the role of PdmS in pradimicin...”

8sftB / T1KUK4 Crystal structure of tuugt202a2 (tetur22g00270) in complex with kaempferol
32% identity, 39% coverage

• Ligands: 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one; uridine-5'-diphosphate (8sftB)

T1KUK4 UDP-glycosyltransferase 202A2 from Tetranychus urticae
32% identity, 38% coverage

• Structural and functional studies reveal the molecular basis of substrate promiscuity of a glycosyltransferase originating from a major agricultural pest
  Arriaza, The Journal of biological chemistry 2023
  • “...Cruz Biotechnology, or Thermo Fisher Scientific. The pET100 Directional TOPO (pET100-D-Topo) plasmid containing Tetur22g00270 (UniProt: T1KUK4) was transformed into E.coli strain BL21(DE3) by heat shock method and spread on 2% agar plates (100g/ml ampicillin). A single colony of BL21(DE3) cells harboring pET100-D-Topo-tetur22g00270 was picked up and...”

Rta_07730 glycosyltransferase from Ramlibacter tataouinensis TTB310
22% identity, 84% coverage

• The cyst-dividing bacterium Ramlibacter tataouinensis TTB310 genome reveals a well-stocked toolbox for adaptation to a desert environment
  De, PloS one 2011
  • “...note the presence of genes encoding for enzymes involved in carotenoid biosynthesis ( Rta_07680 to Rta_07730 ) to quench ROS in the presence of light, in accordance with the presence of carotenoid pigments in strain TTB310 [4] . Strain TTB310 encodes a complete set of enzymes...”

3othA / Q8KNF2 Crystal structure of calg1, calicheamicin glycostyltransferase, tdp and calicheamicin alpha3i bound form (see paper)
26% identity, 76% coverage

• Ligands: thymidine-5'-diphosphate; calicheamicin alpha3i (3othA)

SACE_4644 putative glycosyltransferase from Saccharopolyspora erythraea NRRL 2338
34% identity, 42% coverage

• Complete gene expression profiling of Saccharopolyspora erythraea using GeneChip DNA microarrays
  Peano, Microbial cell factories 2007
  • “...terpenoid which is likely to be modified by multiple hydroxylations (SACE_4643, _4649 and _4651), glycosylation (SACE_4644), amination (SACE_4645) and O -methylation (SACE_4650). The genes from the nrps5 , tcp2 and tcp3 clusters appear to be up-regulated during Phases B and C. From the nrps5 cluster, the...”

ESA_00345 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
22% identity, 88% coverage

• Comprehensive approaches to molecular biomarker discovery for detection and identification of Cronobacter spp. (Enterobacter sakazakii) and Salmonella spp
  Yan, Applied and environmental microbiology 2011
  • “...ESA_02084 ESA_00341 ESA_00341 ESA_00343 ESA_00344 ESA_00345 ESA_00346 ESA_00347 ESA_03721 ESA_02154 ESA_02391 ESA_00314 ESA_01872 ESA_01203 ESA_01574 ESA_04127...”

PputUW4_03146 nucleotide disphospho-sugar-binding domain-containing protein from Pseudomonas sp. UW4
27% identity, 60% coverage

• The complete genome sequence of the plant growth-promoting bacterium Pseudomonas sp. UW4
  Duan, PloS one 2013
  • “...which may confer the ampicillin resistance of the strain. One gene that encodes macrolide glycosyltransferase (PputUW4_03146) was identified; the product of this gene can glycosylate and inactivate macrolide antibiotics such as erythromycin [61] . Novobiocin is produced by Streptomyces and this antibiotics target is DNA gyrase...”

asm25 / Q8KUH5 ansamitocin N-glucosyltransferase from Actinosynnema pretiosum subsp. auranticum (see 4 papers)
AAM54103.1 ansamitocin N-β-glucosyltransferase (Asm25) (EC 2.4.1.-) (see protein)
24% identity, 88% coverage

CA_C2007, CEA_G2022 glycosyltransferase from Clostridium acetobutylicum EA 2018
22% identity, 95% coverage

• Gene coexpression network analysis reveals a novel metabolic mechanism of Clostridium acetobutylicum responding to phenolic inhibitors from lignocellulosic hydrolysates
  Liu, Biotechnology for biofuels 2020
  • “...and repair, the other including the neighborhood genes CA_C2007~CA_C20015 and CA_C20019. Among them, glycosyl transferase (CA_C2007), 3-oxoacyl-ACP synthase ( pksF , CA_C2008), 3-hydroxyacyl-CoA dehydrogenase ( mmgB , CA_C2009), Fe-S oxidoreductase (CA_C2010), 3-oxoacyl-ACP synthase ( fabH , CA_C2011), enoyl-CoA hydratase ( fadB , CA_C2012), esterase (CA_C2014), and...”
• Elucidation of the roles of adhE1 and adhE2 in the primary metabolism of Clostridium acetobutylicum by combining in-frame gene deletion and a quantitative system-scale approach
  Yoo, Biotechnology for biofuels 2016 (no snippet)
• Comparative genomic and transcriptomic analysis revealed genetic characteristics related to solvent formation and xylose utilization in Clostridium acetobutylicum EA 2018
  Hu, BMC genomics 2011
  • “...1.134795 1.816259 2.062687 glycogen phosphorylase CEA_G2012 CA_C1997 3.052977 3.503142 3.004392 2.8712 2.075025 1.372718 glycosyltransferase CEA_G2022 CA_C2007 3.179932 3.308867 2.812136 2.509044 1.656072 1.958591 glycosyltransferase CEA_G2528 CA_C2514 2.588809 2.748177 3.625871 4.329215 2.708288 1.042021 Beta galactosidase CEA_G2815 CA_C2807 2.40568 2.124155 2.476058 2.653992 2.808752 1.737289 endo-1,3(4)-beta-glucanase family protein 16 CEA_G2818...”
  • “...subunit beta CEA_G2016 CA_C2001 2.832561 3.688549 3.007107 3.355002 2.718563 2.206461 indolepyruvate ferredoxin oxidoreductase, subunit CEA_G2022 CA_C2007 3.179932 3.308867 2.812136 2.509044 1.656072 1.958591 glycosyltransferase CEA_G2025 CA_C2010 3.282342 3.533526 2.84142 3.003615 2.50221 2.005231 Fe-S oxidoreductase CEA_G2555 CA_C2542 8.22595 5.876659 5.423124 5.135223 4.224852 4.280766 FAD/FMN-containing dehydrogenase CEA_G2556 CA_C2543 8.451735...”
  • “...2.53088 1.134795 1.816259 2.062687 glycogen phosphorylase CEA_G2012 CA_C1997 3.052977 3.503142 3.004392 2.8712 2.075025 1.372718 glycosyltransferase CEA_G2022 CA_C2007 3.179932 3.308867 2.812136 2.509044 1.656072 1.958591 glycosyltransferase CEA_G2528 CA_C2514 2.588809 2.748177 3.625871 4.329215 2.708288 1.042021 Beta galactosidase CEA_G2815 CA_C2807 2.40568 2.124155 2.476058 2.653992 2.808752 1.737289 endo-1,3(4)-beta-glucanase family protein 16...”
  • “...oxidoreductase subunit beta CEA_G2016 CA_C2001 2.832561 3.688549 3.007107 3.355002 2.718563 2.206461 indolepyruvate ferredoxin oxidoreductase, subunit CEA_G2022 CA_C2007 3.179932 3.308867 2.812136 2.509044 1.656072 1.958591 glycosyltransferase CEA_G2025 CA_C2010 3.282342 3.533526 2.84142 3.003615 2.50221 2.005231 Fe-S oxidoreductase CEA_G2555 CA_C2542 8.22595 5.876659 5.423124 5.135223 4.224852 4.280766 FAD/FMN-containing dehydrogenase CEA_G2556 CA_C2543...”

novM / Q9L9F5 4-O-demethyl-L-noviosyl transferase (EC 2.4.1.302) from Streptomyces niveus (see paper)
NOVM_STRNV / Q9L9F5 L-demethylnoviosyl transferase; Novobiocin biosynthesis protein M; EC 2.4.1.302 from Streptomyces niveus (Streptomyces spheroides) (see 3 papers)
24% identity, 89% coverage

• function: Catalyzes the transfer of L-noviose from dTDP-4-O-demethyl- beta-L-noviose to the phenolic oxygen of novobiocic acid, creating the full ABC ring system in the novobiocin biosynthesis pathway. Novobiocin is an aminocoumarin family antibiotic that targets bacterial DNA gyrases. Also shows activity with variant coumarin aglycones, suggesting it may be a promiscuous catalyst for noviosylation of a range of planar scaffolds. Does not show activity with TDP-L-rhamnose.
  catalytic activity: dTDP-4-O-demethyl-beta-L-noviose + novobiocic acid = desmethyldescarbamoylnovobiocin + dTDP + H(+) (RHEA:36695)

crtX / Q47843 zeaxanthin glucosyltransferase (EC 2.4.1.276) from Enterobacter agglomerans (see 3 papers)
23% identity, 89% coverage

D4GFK6 CrtX from Pantoea ananatis (strain LMG 20103)
23% identity, 89% coverage

• High-level de novo biosynthesis of glycosylated zeaxanthin and astaxanthin in Escherichia coli
  Chen, Bioresources and bioprocessing 2021
  • “...for industrial applications. Here, using the zeaxanthin glucosyltransferase (ZGT, the gene crtX , UniProt ID D4GFK6) from P. ananatis , we have constructed a 14- and 15-gene pathway in E. coli to synthesize various carotenoid glucosides, such as zeaxanthin D-glucoside (yellow) and astaxanthin D-glucoside (red). The...”

CRTX_PSEVU / Q01330 Zeaxanthin glucosyltransferase; EC 2.4.1.276 from Pseudescherichia vulneris (Escherichia vulneris) (see paper)
Q01330 zeaxanthin glucosyltransferase (EC 2.4.1.276) from Pseudescherichia vulneris (see paper)
AAA64979.1 UDP-Glc: zeaxanthin glucosyltransferase (CrtX;Ugt101) (EC 2.4.1.-) (see protein)
24% identity, 93% coverage

• function: Catalyzes the glycosylation reaction which converts zeaxanthin to zeaxanthin bis(beta-D-glucoside). The reaction proceeds in two steps with the monoglucoside as an intermediate
  catalytic activity: all-trans-zeaxanthin + 2 UDP-alpha-D-glucose = zeaxanthin bis(beta-D-glucoside) + 2 UDP + 2 H(+) (RHEA:31543)
• The first aspartic acid of the DQxD motif for human UDP-glucuronosyltransferase 1A10 interacts with UDP-glucuronic acid during catalysis.
  Xiong, Drug metabolism and disposition: the biological fate of chemicals 2008

P21686 zeaxanthin glucosyltransferase (EC 2.4.1.276) from Pantoea ananatis (see 2 papers)
BAA14125.1 zeaxanthin glucosyltransferase (CrtX) (EC 2.4.1.-) (see protein)
23% identity, 88% coverage

• Enhancing astaxanthin biosynthesis and pathway expansion towards glycosylated C40 carotenoids by Corynebacterium glutamicum.
  Göttl, Scientific reports 2024
  • “...genes from two different organisms were chosen to test, firstly crtX from P.ananatis 33 (uniprot: P21686) and crtX from F. pelagi (uniprot: A0A0P0Z8H5), both being annotated as zeaxanthin glycosyltransferases. We chose crtX from P. ananatis as an established gene for production of glycosylated C40 carotenoid 20...”

rebG / Q8KHE4 RebG N-glycosyl transferase (EC 4.3.3.5) from Lentzea aerocolonigenes (see 2 papers)
REBG_LENAE / Q8KHE4 4'-demethylrebeccamycin synthase; Arcyriaflavin A N-glycosyltransferase; EC 4.3.3.5 from Lentzea aerocolonigenes (Lechevalieria aerocolonigenes) (Saccharothrix aerocolonigenes) (see 3 papers)
Q8KHE4 4'-demethylrebeccamycin synthase (EC 4.3.3.5) from Lentzea aerocolonigenes (see paper)
CAC93713.1 rebeccamycin N-glucosyltransferase (RebG;RbmA) (EC 2.4.1.-) (see protein)
rebG / BAC15749.1 N-glycosyl transferase RebG from Lentzea aerocolonigenes (see 3 papers)
21% identity, 81% coverage

• function: Catalyzes the penultimate step in the biosynthesis of rebeccamycin, an indolocarbazole alkaloid that inhibits topoisomerase 1. Has a wide substrate range, including staurosporine aglycone, EJG- III-108A, J-104303, 6-N-methyl-arcyriaflavin and indolo-[2,3-a]- carbazole.
  catalytic activity: 4'-demethylrebeccamycin + H2O = dichloroarcyriaflavin A + beta-D-glucose (RHEA:27397)

Q83ZA2 Glycosyltransferase from Escherichia coli
22% identity, 86% coverage

• Involvement of enterobactin synthesis pathway in production of microcin H47
  Azpiroz, Antimicrobial agents and chemotherapy 2004 (secret)

7lvyA / T1K1R5 Crystal structure of tetur04g02350
22% identity, 88% coverage

• Ligands: uridine-5'-diphosphate; beta-d-glucopyranose (7lvyA)

Q83ZB1 Putative glycosyltransferase McmL from Escherichia coli
22% identity, 86% coverage

• Involvement of enterobactin synthesis pathway in production of microcin H47
  Azpiroz, Antimicrobial agents and chemotherapy 2004 (secret)

AAN77910.1 UDP-Glc: sterol glucosyltransferase (UGT51D1) (EC 2.4.1.173) (see protein)
24% identity, 55% coverage

RJF2_RS26160 salmochelin biosynthesis C-glycosyltransferase IroB from Klebsiella pneumoniae subsp. pneumoniae
22% identity, 83% coverage

• Whole-Genome-Sequencing characterization of bloodstream infection-causing hypervirulent Klebsiella pneumoniae of capsular serotype K2 and ST374
  Wang, Virulence 2018
  • “...rmpA2 ( RJF2_RS26605 ) , the iroBCDN gene clusters involved in salmochelin biosynthesis ( RJF2_RS26145 RJF2_RS26160 ), and the iucABCD/iutA gene cluster related to aerobactin biosynthesis ( RJF2_RS26550- RJF2_RS26570 ). These virulence determinants are encoded on pRJF293 or similar virulence plasmids reported in K. pneumoniae (120-230kb...”

cloM / Q8GHC2 L-demethylnoviosyl:clorobiocic acid transferase (EC 2.4.1.302) from Streptomyces roseochromogenus subsp. oscitans (see paper)
24% identity, 88% coverage

ATG26_KOMPG / Q9Y751 Sterol 3-beta-glucosyltransferase; Autophagy-related protein 26; Peroxisome degradation protein 3; Pexophagy zeocin-resistant mutant protein 4; UDP-glycosyltransferase 51; EC 2.4.1.-; EC 2.4.1.173 from Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) (see 5 papers)
Q9Y751 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Komagataella pastoris (see 3 papers)
CAY71393.1 UDP-Glc: sterol glucosyltransferase (UGT51B1;PAS_chr4_0167) (EC 2.4.1.173) (see protein)
22% identity, 31% coverage

• function: Sterol glycosyltransferase responsible for the glycosylation of ergosterol to form ergosterol-glucoside (PubMed:10224056). Shows also activity in vitro on other sterols such as cholesterol, beta- sitosterol, stigmasterol and tomatidine (PubMed:10224056). Probable sterol 3-beta-glucosyltransferase that mediates autophagic degradation of peroxisomes (pexophagy) (PubMed:11856375, PubMed:12839986, PubMed:14585290, PubMed:19605559).
  catalytic activity: a sterol + UDP-alpha-D-glucose = a sterol 3-beta-D-glucoside + UDP + H(+) (RHEA:22724)
  catalytic activity: ergosterol + UDP-alpha-D-glucose = ergosteryl 3-beta-D- glucoside + UDP + H(+) (RHEA:61836)

Z1190 putative glucosyltransferase from Escherichia coli O157:H7 EDL933
22% identity, 86% coverage

• Global effect of RpoS on gene expression in pathogenic Escherichia coli O157:H7 strain EDL933
  Dong, BMC genomics 2009
  • “...0.3 2 O-Island 43 Putative enzyme Z1185 11.5 0.2 10.3 0.2 2 O-Island 43 Unknown Z1190 12.2 0.7 7.9 0.2 20 O-Island 43 Putative enzyme Z1193 10.2 0.8 6.3 0.8 15 O-Island 43 Unknown Z1385 11.8 0.1 10.5 0.3 2 O-Island 44 Unknown (cryptic prophage CP-933M)...”

GAME18 / A0A3Q7H9X4 γ-tomatine glucosyltransferase from Solanum lycopersicum (see paper)
23% identity, 77% coverage

mchA / CAG25570.1 MchA protein from Escherichia coli (see 5 papers)
22% identity, 86% coverage

LOC107778878 beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like from Nicotiana tabacum
24% identity, 83% coverage

• Plant Soft Rot Development and Regulation from the Viewpoint of Transcriptomic Profiling
  Tsers, Plants (Basel, Switzerland) 2020
  • “...and carotenoid modification were revealed. A strong upregulation was observed for genes (LOC107783555, LOC107761722, LOC107820493. LOC107778878, LOC107790993, LOC107827640, LOC107820494, LOC107763569, LOC107767710, and LOC107780597) encoding biosynthetic enzymes of crocina water-soluble apocarotenoid with high antioxidant activity [ 65 ]. Genes encoding isoflavone 2-hydroxylases (yielding different compounds with antioxidant...”

STM2773 putative glycosyl transferase, related to UDP-glucuronosyltransferase from Salmonella typhimurium LT2
22% identity, 87% coverage

• Comparative genomics between Colombian clinical isolates of Monophasic VariantSalmonellaTyphimurium and international clonal lineages
  Paloma, 2023
• Evidence of international transmission of mobile colistin resistant monophasic Salmonella Typhimurium ST34
  Supa-Amornkul, Scientific reports 2023
  • “...was accompanied by an inversion of a 150,626-bp-long segment (position 2,916,0403,066,666), including 152 genes from STM2773 ( iroB ) to STM2924 ( rpoS ) and the last 111bp of STM2925c ( nlpD ). The inverted segment was flanked on both sides by IS 26 . There...”
• Identification of a Recently Dominant Sublineage in Salmonella 4,[5],12:i:- Sequence Type 34 Isolated From Food Animals in Japan
  Arai, Frontiers in microbiology 2021
  • “...and Pairwise Alignment of the DNA Sequences Nucleotide sequences of the genes from STM2743 to STM2773 in the Salmonella Typhimurium LT2 strain were used as query sequences. The detection thresholds were as follows: minimum coverage length 80% and nucleotide sequence identity 85%. Pairwise alignment of the...”
• Sequence Analyses and Phenotypic Characterization Revealed Multidrug Resistant Gene Insertions in the Genomic Region Encompassing Phase 2 Flagellin Encoding fljAB Genes in Monophasic Variant Salmonella enterica Serovar 4,5,12:i:- Isolates From Various Sources in Thailand
  Win, Frontiers in microbiology 2021
  • “...five target regions (131L, tniA , tetC , MAK, and 131R) spanning from STM2759 to STM2773 ( iroB ) among 108 Thai S . 4,5,12:i:- isolates and four non-Thai isolates (two Spanish and two U.S. strains) was performed. We identified nine patterns of presence or absence...”
• Population structure, case clusters, and genetic lesions associated with Canadian Salmonella 4,[5],12:i:- isolates
  Clark, PloS one 2021
  • “...of adjacent DNA, including fljAB hin , between homologs of S. Typhimurium homologs STM2692 and STM2773. A small number of isolates with this element are also found in other clades in which they do not predominate, raising questions about whether this prophage fragment is, in fact,...”
• Genotyping Study of Salmonella 4,[5],12:i:- Monophasic Variant of Serovar Typhimurium and Characterization of the Second-Phase Flagellar Deletion by Whole Genome Sequencing
  Arrieta-Gisasola, Microorganisms 2020
  • “...A1 ) fljAB 2 fljAB 2-A 1 1201 bp of STM2746 334 bp upstream from STM2773 ( iroB ) 820 bp (one IS26) fljAB 2-B 1 1263 bp of STM2746 fljAB 3 fljAB 3-A 1 177 of STM2753 334 bp upstream from STM2773 ( iroB )...”
  • “...353 bp of STM2753 fljAB 4 3 222 bp downstream of STM2757 571 bp of STM2773 ( iroB ) 820 bp (one IS26) fljAB 5 1 222 bp downstream of STM2757 848 bp of the STM2784 820 bp (one IS26) fljAB 6 fljAB 6-A 1 1079...”
• Horizontal Acquisition of a Multidrug-Resistance Module (R-type ASSuT) Is Responsible for the Monophasic Phenotype in a Widespread Clone of Salmonella Serovar 4,[5],12:i:
  García, Frontiers in microbiology 2016
  • “...is inserted between two chromosomal loci, named STM2759 (encoding a putative phosphotransferase) and iro B (STM2773, a putative glycosyl transferase), causing the deletion of the genomic fragment located in between (15,716 bp). The latter comprises the genes STM2760STM2769 (encoding different putative proteins), the fljAB operon (encoding...”
  • “...unknown function. The module is inserted between two chromosomal loci, named STM2759 and iro B (STM2773), causing the deletion of the genomic fragment located in between. Regarding the flanking chromosomal DNA of RR3, it shows high-level sequence identity to the corresponding regions of the biphasic S...”
• Characterization of Salmonella enterica serovar Typhimurium and Salmonella enterica serovar 4,[5],12:i:- isolates from pigs presenting with diarrhea in Korea
  Lee, The Journal of veterinary medical science 2015
  • “...25922 was used as a control strain. The expression of flagellar genes (STM1053-1997, STM2740, STM2757, STM2773, fljA , fljB and hin ) was assessed by PCR ( Table 1 ) as described previously [ 27 ]. DNA fragments were separated on a 1.5% agarose gel. Fragments...”
• More

t2668 putative glycosyl transferase from Salmonella enterica subsp. enterica serovar Typhi Ty2
22% identity, 87% coverage

• Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18
  Deng, Journal of bacteriology 2003
  • “...for CT18 (22). Virulence-related genes iroBCDEN (Ty2 ORFs t2668 to t2672, encoding an iron uptake and storage system) and sopE (t4303, encoding an...”

Q93GK9 DUF1205 domain-containing protein from Klebsiella pneumoniae
22% identity, 83% coverage

• Involvement of enterobactin synthesis pathway in production of microcin H47
  Azpiroz, Antimicrobial agents and chemotherapy 2004 (secret)

c1254 Putative glucosyltransferase from Escherichia coli CFT073
22% identity, 83% coverage

• Transposon-Sequencing Analysis Unveils Novel Genes Involved in the Generation of Persister Cells in Uropathogenic Escherichia coli
  Molina-Quiroz, Antimicrobial agents and chemotherapy 2016
  • “...c0608 c0751 c0764 c0861 c0909 c0943 c1174 c1176 c1179 c1254 c1303 c1560 c1572 c1610 c1822 c1884 c1888 c1925 c1927 c1945 c1956 c2004 c2034 c2144 c2199 c2232...”
• Resistance to Isoniazid and Ethionamide in Mycobacterium tuberculosis: Genes, Mutations, and Causalities
  Vilchèze, Microbiology spectrum 2014
  • “...61 ) G413D ( 61 ) g32 del ( 154 ) A248D ( 154 ) c1254 del ( 154 ) A20 ins ( 62 ) Y250ST0P ( 154 ) g1268 del ( 154 ) a65 del ( 46 ) cg754 ins ( 62 ) c1290 del...”
• Quantitative profile of the uropathogenic Escherichia coli outer membrane proteome during growth in human urine
  Alteri, Infection and immunity 2007
  • “...AcrA ZipA YfgM YfiO OmpX DcrB FliC c3623 c4308 c2482 c1254 c0185 c3610 c1250 c5174 c0238 c1071 c3781 c1093 c2758 c4304 c0849 c4722 c4929 c3139 c1722 c0521 c2889...”
• The asymptomatic bacteriuria Escherichia coli strain 83972 outcompetes uropathogenic E. coli strains in human urine
  Roos, Infection and immunity 2006
  • “...sitB araE b2736 iutA ryhB iroN srlB c4310 c1596 c1254 c0669 c2701 b2165 b0584 c3627 b1018 c1600 c4315 b0061 b0063 c3624 b1498 b0593 b1616 b2737 c1599 b2841...”

UTI89_C1122 putative glucosyltransferase from Escherichia coli UTI89
O2ColV53 IroB from Escherichia coli
21% identity, 83% coverage

• Glycosuria Alters Uropathogenic Escherichia coli Global Gene Expression and Virulence
  Islam, mSphere 2022
  • “...LB vs fUG fU vs fUG UTI89_C1121 iroC 0.5412 1.5493* 1.0244* ABC transporter ATP-binding protein UTI89_C1122 iroB 1.2711 3.1580* 1.9088* Glycosyltransferase UTI89_C1336 sitD 1.376* 3.355* 1.997* Iron/manganese ABC transporter permease subunit SitD UTI89_C1337 sitC 0.959 2.552* 1.612* Iron/manganese ABC transporter permease subunit SitC UTI89_C1338 sitB 0.816...”
• Metabolic Requirements of Escherichia coli in Intracellular Bacterial Communities during Urinary Tract Infection Pathogenesis
  Conover, mBio 2016
  • “...UTI89_C2178 ybtS 6.132778168 Salicylate synthase UTI89_C4033 chuT 5.365860462 Putative periplasmic binding protein with FepB/HutB regions UTI89_C1122 iroB 5.215178967 Putative glucosyl transferase UTI89_C1995 yeaR 4.653666496 Hypothetical protein UTI89_C0599 ybdB 4.367933273 Paal_thioesterasetetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for PA, phenylacetic...”
• The plasmid of Escherichia coli strain S88 (O45:K1:H7) that causes neonatal meningitis is closely related to avian pathogenic E. coli plasmids and is associated with high-level bacteremia in a neonatal rat meningitis model
  Peigne, Infection and immunity 2009
  • “...100 O2ColV98 O2ColV61 O2ColV59 O2ColV57 O2ColV56 O2ColV55 O2ColV54 O2ColV53 100 97.5 100 100 100 100 26.7 O2ColV188 O2ColV67 O2ColV67 O2ColV66 O2ColV65 O2ColV64...”

NRG857_30008 salmochelin biosynthesis C-glycosyltransferase IroB from Escherichia coli O83:H1 str. NRG 857C
21% identity, 83% coverage

• Genome sequence of adherent-invasive Escherichia coli and comparative genomic analysis with other E. coli pathotypes
  Nash, BMC genomics 2010
  • “...microcin V common NRG857_30029 cma 99 structural gene for colicin M common Iron acquisition/Transport systems NRG857_30008 iroB 93 siderophore common NRG857_30010 iroC 91 siderophore common NRG857_30012 iroD 99 siderophore common NRG857_30013 iroE 93 siderophore common NRG857_30015 iroN 97 siderophore common NRG857_30235 iutA 95 cloacin DF13/aerobactin outer...”

iroB / A0A0H2V630 enterobactin C-glucosyltransferase (EC 2.4.1.369) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see 3 papers)
IROB_ECOL6 / A0A0H2V630 Enterobactin C-glucosyltransferase; Ent C-glucosyltransferase; EC 2.4.1.369 from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see 3 papers)
A0A0H2V630 enterobactin C-glucosyltransferase (EC 2.4.1.369) from Escherichia coli O6:H1 (see 2 papers)
23% identity, 83% coverage

• function: Catalyzes the successive monoglucosylation, diglucosylation and triglucosylation of enterobactin (Ent) (PubMed:15598734, PubMed:24960592). Transfers glucosyl groups from uridine-5'- diphosphoglucose (UDP-Glc) to C5 of one, two or three of the 2,3- dihydroxybenzoyl (DHB) units of Ent to yield monoglucosyl-C-Ent (MGE), diglucosyl-C-Ent (DGE) and triglucosyl-C-Ent (TGE) (PubMed:15598734, PubMed:24960592). Glucosylation decreases the membrane affinity of Ent and increases the iron acquisition rate (PubMed:17163637).
  catalytic activity: enterobactin + UDP-alpha-D-glucose = monoglucosyl-enterobactin + UDP (RHEA:24448)
  catalytic activity: monoglucosyl-enterobactin + UDP-alpha-D-glucose = diglucosyl- enterobactin + UDP + H(+) (RHEA:59096)
  catalytic activity: diglucosyl-enterobactin + UDP-alpha-D-glucose = triglucosyl- enterobactin + UDP + H(+) (RHEA:59100)

CGT_MANIN / A0A0M4KE44 UDP-glycosyltransferase 13; MiUGT13; C-glycosyltransferase; MiCGT; EC 2.4.1.- from Mangifera indica (Mango) (see paper)
27% identity, 41% coverage

• function: Benzophenone C-glycosyltransferase involved in the biosynthesis of mangiferin. Exhibits a robust regio- and stereospecific C-glycosylation activity toward over 35 substrates from 18 structurally different types with UDP-glucose. Also able to produce O- and N- glycosides and to use UDP-xylose as sugar donor. Generates only C- glycosides with 2,4,6-tri-hydroxy acceptors at the A ring, both C- and O- glycosides with 2,4-di-hydroxyl acceptors at the A ring, and only O- glycosides with 2- or 4-mono-hydroxy acceptors at the A ring.

BAA83130.1 indolocarbazole N-glucosyltransferase (NGT) (EC 2.4.1.-) (see protein)
20% identity, 83% coverage

plu1760 No description from Photorhabdus luminescens subsp. laumondii TTO1
22% identity, 82% coverage

• Small molecule perimeter defense in entomopathogenic bacteria
  Crawford, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...(plu2816 and plu2817) from two glycosyltransferase homologs (plu1760 and plu1762) (Fig. 2A). It seemed likely that both glycosyltransferase genes contributed to...”

XP_044491083 UDP-glycosyltransferase 13 from Mangifera indica
28% identity, 41% coverage

• Identification and Characterization of CtUGT3 as the Key Player of Astragalin Biosynthesis in Carthamus tinctorius L
  Ren, Journal of agricultural and food chemistry 2023
  • “...Pueraria montana var. lobata), Gt5GT7 (B2NID7, Gentiana trifloral ), GtUF6CGT1 (A0A0B6VIJ5, Gentiana trifloral ), MiCGT (XP_044491083, Mangifera indica ), MiCGTb (KT989668.1, Mangifera indica ), OSCGT (C3W7B0, Oryza sativa ), OsUGT706C2 (DP000009.2, Oryza sativa ), PfA5GT (Q9ZR27.1, Perilla frutescens var. crispa), PgUGT95B2 (MH507175.1, Punica granatum ), PlUGT2...”

AAD13555.1 olivosyltransferase (LanGT1) (EC 2.4.1.-) (see protein)
22% identity, 97% coverage

7va8A / A0A0M4KE44 Crystal structure of micgt
27% identity, 41% coverage

• Ligand: uridine-5'-diphosphate-glucose (7va8A)

AAS20331.1 β-olivosyltransferase (LndGT1) (EC 2.4.1.-) (see protein)
24% identity, 84% coverage

L0BH17 zeaxanthin glucosyltransferase (EC 2.4.1.276) from Pantoea agglomerans (see paper)
23% identity, 88% coverage

ATG26_PICAN / A7KAK6 Sterol 3-beta-glucosyltransferase; Autophagy-related protein 26; EC 2.4.1.-; EC 2.4.1.173 from Pichia angusta (Yeast) (Hansenula polymorpha) (see paper)
A7KAK6 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Ogataea angusta (see paper)
21% identity, 31% coverage

• function: Sterol glycosyltransferase responsible for the glycosylation of ergosterol to form ergosterol-glucoside (By similarity). Mediates autophagic degradation of peroxisomes (pexophagy) (PubMed:17204848).
  catalytic activity: a sterol + UDP-alpha-D-glucose = a sterol 3-beta-D-glucoside + UDP + H(+) (RHEA:22724)
  catalytic activity: ergosterol + UDP-alpha-D-glucose = ergosteryl 3-beta-D- glucoside + UDP + H(+) (RHEA:61836)

LOC18044391 LOW QUALITY PROTEIN: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase from Citrus x clementina
20% identity, 83% coverage

• Transcriptome analysis of the pulp of citrus fruitlets suggests that domestication enhanced growth processes and reduced chemical defenses increasing palatability
  Perez-Roman, Frontiers in plant science 2022
  • “...repressed. Supplementary Table 3 also lists two upregulated - D -glucosyl crocetin -1,6-glucosyltransferases (LOC18045744 and LOC18044391), catalyzing the 1-6 glucosylation of crocetin, a natural apocarotenoid. In addition, this table reports on other two glycosyltransferases (LOC18054015 and LOC18033356) conjugating diterpenes that are downregulated, and an upregulated gene...”

ABC02800.1 indolocarbazole N-glucosyltransferase (AtmG;AtG) (EC 2.4.1.-) (see protein)
20% identity, 82% coverage

ATG26_CANAL / Q5A950 Sterol 3-beta-glucosyltransferase; Autophagy-related protein 26; UDP-glycosyltransferase 51; EC 2.4.1.-; EC 2.4.1.173 from Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (see paper)
Q5A950 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Candida albicans (see paper)
21% identity, 25% coverage

• function: Sterol glycosyltransferase responsible for the glycosylation of ergosterol to form ergosterol-glucoside.
  catalytic activity: a sterol + UDP-alpha-D-glucose = a sterol 3-beta-D-glucoside + UDP + H(+) (RHEA:22724)
  catalytic activity: ergosterol + UDP-alpha-D-glucose = ergosteryl 3-beta-D- glucoside + UDP + H(+) (RHEA:61836)
• Effect of the Ethyl Acetate Fraction of Eugenia uniflora on Proteins Global Expression during Morphogenesis in Candida albicans
  Silva-Rocha, Frontiers in microbiology 2017
  • “...protein 2 ACB2 Protein transport P61868 10,084 4.74 Decrease 31 Sterol 3-beta-glucosyltransferase ATG26 Membrane synthesis Q5A950 170,545 5.57 32 ATP-dependent RNA helicase DBP10 DBP10 Ribossomal structure Q5ANB2 103,561 9.64 34 U6 snRNA-associated Sm-like protein LSm3 LSM3 RNA processing P57743 10,030 4.29 35 Actin cytoskeleton-regulatory complex protein...”

LOC113510033 UDP-glucosyltransferase 2-like from Galleria mellonella
28% identity, 33% coverage

• RNAi-mediated knockdown of gut receptor-like genes prohibitin and α-amylase altered the susceptibility of Galleria mellonella to Cry1AcF toxin
  Dutta, BMC genomics 2022
  • “...1869 MZ576276 623 68.53 7.56 ADAM LOC113515341 51805 17 4476 MZ576274 990 111.99 8.12 UDP-GT LOC113510033 4642 4 1852 MZ561436 431 49.67 6.93 arylphorin LOC113516268 3829 5 2195 MZ576275 702 83.37 5.09 a Coding sequences with accession numbers are cloned and sequenced from the midgut mRNA...”

An07g06610 uncharacterized protein from Aspergillus niger
23% identity, 28% coverage

• The carbon starvation response of Aspergillus niger during submerged cultivation: insights from the transcriptome and secretome
  Nitsche, BMC genomics 2012
  • “...2.8 4.9 4.8 4.9 1.7 1.7 1.7 2.0E-06 3.3E-06 2.3E-06 atg26 UDP-glucose:sterol glucosyltransferase S000004179 AN4601 An07g06610 3.8 10.3 9.8 7.6 2.7 2.6 2.0 2.7E-09 5.8E-09 2.2E-07 atg27 Type I membrane protein S000003714 AN0861 An01g13390 1.1 1.7 1.5 1.5 1.6 1.4 1.4 2.8E-06 1.8E-04 6.8E-05 atg28 Coiled-coil...”

FRAAL4787 putative N-glycosyltransferase from Frankia alni ACN14a
30% identity, 29% coverage

• Genomic Insights of Alnus-Infective Frankia Strains Reveal Unique Genetic Features and New Evidence on Their Host-Restricted Lifestyle
  Kim, Genes 2023
  • “...example, recovered from the list of lost genes in Sp+ genomes, such as FRAAL3448 or FRAAL4787 encoding a putative Glycerophosphoryl diester phosphodiesterase (indicated as GlpQ in Table 5 ) and putative N-glycosyltransferase, respectively. GlpQ is a protein able to hydrolyze glycerophosphodiester bonds [ 70 ] of...”
  • “...FRAAL1769 Hypothetical protein FRAAL5611 Single copy C Energy production and conversion FRAAL1457 Putative Xanthine dehydrogenase FRAAL4787 Putative N-glycosyltransferase FRAAL3448 glpQ Glycerophosphoryl diester phosphodiesterase SP D Cell cycle control, cell division, chromosome partitioning FRAAL2959 ATP/GTP binding protein TM E Amino acid transport and metabolism FRAAL5354 Hypothetical protein...”

LOC112052352 uncharacterized protein LOC112052352 from Bicyclus anynana
34% identity, 11% coverage

• Transcriptional responses of Daphnis nerii larval midgut to oral infection by Daphnis nerii cypovirus-23
  Kuang, Virology journal 2021
  • “...hypothetical protein B5X24_HaOG201493 [Helicoverpa armigera] RDH12 TRINITY_DN9738_c0_g1_i1_6 438.41149 83.17535239 0.189719828 0.04256225 0.7412925 Down uncharacterized protein LOC112052352 [Bicyclus anynana] UGT TRINITY_DN8673_c0_g1_i3_3 839.7824168 167.2848772 0.199200262 0.00073535 0.0803495 Down PREDICTED: UDP-glucuronosyltransferase 2B19-like isoform X6 [Amyelois transitella] UGT TRINITY_DN17220_c0_g1_i1_4 6379.593263 3.929259199 0.000615911 0.00570705 0.2744919 Down UDP-glycosyltransferase UGT340C1 precursor [Bombyx mori]...”

LOC126984017 UDP-glycosyltransferase UGT5-like from Eriocheir sinensis
27% identity, 35% coverage

• Transcriptome and metabolomics analysis of adaptive mechanism of Chinese mitten crab (Eriocheir sinensis) to aflatoxin B1
  Yang, PloS one 2023
  • “...38 ]. In our sequencing results, we found that the gene novel.6517 and the gene LOC126984017 ( UGT ) were associated with the synthesis of eytoehrome P450. Gene novel . 6517 encoded NADPHcytochrome P450 reductase, with an mean FPKM of 0.01 and 2.50 in the L-C...”

AAD29571.1 UDP-Glc: sterol glucosyltransferase (UGT51C1) (EC 2.4.1.173) (see protein)
21% identity, 25% coverage

Bm17378, Bm1_13480 Uncharacterized protein from Brugia malayi
29% identity, 29% coverage

• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...malayi intestinal UGT exhibits high homology to other filarial species Previously, we reported that Bm-UGT (Bm17378) was a specific intestinal protein of B . malayi adult worms [ 12 ]. Sequence analyses indicated the presence of homologues in human filarial worms ( Brugia sp., W ....”
  • “...WormBase Parasite based on a BLAST query [ 24 ] against the Bm-UGT protein sequence (Bm17378). The following are the accession numbers of each ortholog as identified in WormBase Parasite: Brugia timori (BTMF_0001026401), Wuchereria bancrofti (WBA_0000030501), Brugia pahangi (BPAG_0000208101), Loa loa (LOAG_03428), Dirofilaria immitis (nDi.2.2.2.t06727), Litomosoides...”
• A Proteomic Analysis of the Body Wall, Digestive Tract, and Reproductive Tract of Brugia malayi
  Morris, PLoS neglected tropical diseases 2015
  • “...nonmuscle type 1, putative 7.8E-04 2.0 Phagocytosis associated Bm1_02265 MGC69076 protein-related 7.3E-04 3.77 Xenobiotic metabolism Bm1_13480 UDP-glucoronosyl and UDP-glucosyl transferase family protein 7.0E-04 28.16 RNA binding Bm1_20295 Glycine-rich RNA-binding protein.-related 6.9E-04 8.96 Miscellaneous Bm1_25280 Prion-likerelated 6.4E-04 2.37 Cell Adhesion Bm1_10500 AMOP domain containing protein 6.1E-04 5.99...”
  • “...Bm1_44655 Fukutin.-related 31 138364 96 1362 73 1364 85 1364 75 1364 28364 1 # Bm1_13480 UDP-glucoronosyl and UDP-glucosyl transferase family protein 27 35509 95 1425 29 214293 81 1423 72 155502 1486 1 Miscellaneous # Bm1_49590 CG3054-PA-related 28 97260 81 1242 69 1260 63 1262...”

UGT51C1 sterol 3-beta-glucosyltransferase; EC 2.4.1.173 from Candida albicans (see paper)
21% identity, 25% coverage

• CharProtDB CGD description: UDP-glucose

CCM_01158 UDP-glucose:sterol glycosyltransferase from Cordyceps militaris CM01
22% identity, 26% coverage

• Discovering a novel glycosyltransferase gene CmUGT1 enhances main metabolites production of Cordyceps militaris
  He, Frontiers in microbiology 2024
  • “...CCM_01719 31.60 6.81 1.56 6.34 CCM_02376 32.49 19.41 20.20 24.83 CCM_09110 13.52 21.56 21.72 16.99 CCM_01158 42.95 13.39 24.64 55.63 CCM_03311 36.40 12.38 22.41 45.44 CCM_05430 123.36 51.68 82.33 125.88 CCM_07583 105.38 38.62 41.08 92.83 CCM_03951 15.93 21.82 20.92 9.97 CCM_03309 134.03 8.54 7.05 8.48 CCM_09129...”

Celf_3212 glycosyltransferase from Cellulomonas fimi ATCC 484
24% identity, 86% coverage

• The genome sequences of Cellulomonas fimi and "Cellvibrio gilvus" reveal the cellulolytic strategies of two facultative anaerobes, transfer of "Cellvibrio gilvus" to the genus Cellulomonas, and proposal of Cellulomonas gilvus sp. nov
  Christopherson, PloS one 2013
  • “...PL3, and PL11 families in addition to four gene products involved in uronic acid interconversions (Celf_3212, _3268, _3292, and _3346) while C. flavigena had a PL3 and a PL11 pectate lyase and six predicted uronic acid gene products (Cfla_0976, _2984, _3012, _0879, _9878, _3194). In contrast,...”

5gl5A / Q06321 Sterol 3-beta-glucosyltransferase (ugt51) from saccharomyces cerevisiae (strain atcc 204508 / s288c): udpg complex (see paper)
21% identity, 88% coverage

• Ligand: uridine-5'-diphosphate-glucose (5gl5A)

LOC105219094 UDP-glucosyltransferase 2 from Zeugodacus cucurbitae
33% identity, 19% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued ( Table 2 ). Therefore, these retinol metabolism-associated DEGs with specific expression patterns were highly likely to be involved in testis development....”
  • “...11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422 2.08642 5.149338 5.300399 * * Vitamin B6 metabolism PNPO LOC105219330 4.915588 10.87719 9.781125 * * PDXK LOC105220897 4.831618...”

UGT2 / A0A291PQH4 kermesate C-glycosyltranferase from Dactylopius coccus (see 2 papers)
UGT2_DACCO / A0A291PQH4 UDP-glucosyltransferase 2; DcUGT2; EC 2.4.1.- from Dactylopius coccus (Cochineal) (see paper)
25% identity, 30% coverage

• function: Membrane-bound UDP-glucosyltransferase (UGT) which catalyzes the C-glucosylation of kermesate and flavokermesate to produce carminate and flavokermesate 7-C-beta-D-glucoside (dcll) respectively (PubMed:29215010). Carminate is used as a deterrent against insect predators (PubMed:29215010).
  catalytic activity: kermesate + UDP-alpha-D-glucose = carminate + UDP + 2 H(+) (RHEA:63752)
  catalytic activity: flavokermesate + UDP-alpha-D-glucose = flavokermesate 7-C- beta-D-glucoside + UDP + 2 H(+) (RHEA:63756)

LOC105218578 UDP-glycosyltransferase UGT5 from Zeugodacus cucurbitae
24% identity, 34% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...(1 RDH (LOC105212701), 3 SDR16C (LOC105209516, LOC105209517, and LOC105213735) and 3 UGT (LOC105209919, LOC105210791, and LOC105218578)) were significantly continuously upregulated. Additionally, the expression level of 1 DGAT ( Dgat1_0 ) and 6 UGT (LOC105210436, LOC105218581, LOC105219093, LOC105219094, LOC105220158, and LOC105221422) was significantly increased and plateaued (...”
  • “...26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581 1.9247 4.529353 3.680961 * * LOC105219093 0.553394 2.890756 2.247317 * * LOC105219094 2.26124 14.76726 11.56811 * * LOC105220158 12.73465 27.6289 27.27457 * * LOC105221422...”

XNC1_1223 / D3V9Q6 rhabduscin glycosyltransferase from Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6) (see 2 papers)
XNC1_1223 rhabduscin glycosyltransferase from Xenorhabdus nematophila ATCC 19061
22% identity, 88% coverage

• Biosynthesis of Isonitrile- and Alkyne-Containing Natural Products
  Del, Annual review of chemical and biomolecular engineering 2022
  • “...P. luminescens contain not only the isnA and isnB homologs but also the glycosyltransferase genes XNC1_1223 and plu1760-plu1762 that presumably convert 4 into rhabduscin. The specific function of these glycosyltransferases in the rhabduscin biosynthetic pathway is not well understood, but they have been hypothesized to either...”
• Inhibition of Spodoptera frugiperda phenoloxidase activity by the products of the Xenorhabdus rhabduscin gene cluster
  Eugenia, PloS one 2019
  • “...biosynthetic genes) deletion mutant [ 27 ] Xn GT 1 X . nematophila ATCC19061 T XNC1_1223 (glycosyltransferaseencoding gene) deletion mutant [ 27 ] Xp Xenorhabdus poinarii G6 strain isolated from Steinernema glaseri SK29 nematodes collected in North Carolina, USA [ 32 ] Se Serratia entomophila Mor4.1...”

Q6CUV2 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Kluyveromyces lactis (see paper)
22% identity, 31% coverage

YP_003204087 UDP-glucuronosyl/UDP-glucosyltransferase from Nakamurella multipartita DSM 44233
30% identity, 31% coverage

• Functional metagenomics reveals previously unrecognized diversity of antibiotic resistance genes in gulls
  Martiny, Frontiers in microbiology 2011
  • “...PilT domain protein ZP_03985770 84 unk2 N/A Burkholderia Flagellar asso. protein ZP_02357438 53 Nakamurella UDP-glucosyltransferase YP_003204087 71 unk3 N/A Methylobacterium Hypothetical protein YP_001691243 79 Rhizobium Hypothetical protein YP_471752 60 unk4 N/A Enterococcus Dihydroorotate dehydrogenase ZP_06697492 69 Mycoplasma Dihydroorotate dehydrogenase NP_758176 68 unk5 N/A Pseudomonas phage EL...”

GT742_SIRGR / P0DO74 Mogroside I-E synthase; Mogroside II-E synthase; Mogroside III synthase; Mogroside IIIx synthase; Siamenoside I synthase; UDP-glycosyltransferase 74-345-2; UGT74-345-2; EC 2.4.1.350; EC 2.4.1.- from Siraitia grosvenorii (Monk's fruit) (Luo han guo) (see paper)
23% identity, 83% coverage

• function: UDP-glycosyltransferase involved in the biosynthesis of cucurbitacin and mogroside tetracyclic triterpene natural products (e.g. siamenoside I and mogrosides IV, V and VI) (PubMed:27821754). Cucurbitacins have cytotoxic properties and exhibit deterrent taste as a defense barrier against herbivores (PubMed:27821754). Mogrosides are nonsugar highly oxygenated compounds used as high-intensity zero- calorie sweeteners; they also possess pharmacological properties such as regulating immunity, lowering blood sugar and lipid levels, protecting the liver, and acting as antioxidants and antitumor agents (PubMed:27821754). Catalyzes the C3 primary glucosylation of mogrol, mogroside I-A1, mogroside II-A1, mogroside II-A and mogroside III-A1 (PubMed:27821754).
  catalytic activity: mogrol + UDP-alpha-D-glucose = mogroside IE + UDP + H(+) (RHEA:52044)

LOC725997 UDP-glucuronosyltransferase 2C1 from Apis mellifera
25% identity, 30% coverage

• Developmental regulation of ecdysone receptor (EcR) and EcR-controlled gene expression during pharate-adult development of honeybees (Apis mellifera)
  Mello, Frontiers in genetics 2014
  • “...function related to ecdysteroid metabolism (Iida et al., 2007 ). The products of LOC413043 and LOC725997 may regulate ecdysteroid titer and function since the enzymes encoded by these genes catalyze the transfer of glucose from UDP-glucose to ecdysteroids, and thus are possibly related to ecdysteroid inactivation...”

Q3SY77 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 2 papers)
31% identity, 28% coverage

• Global and Comparative Proteome Signatures in the Lens Capsule, Trabecular Meshwork, and Iris of Patients With Pseudoexfoliation Glaucoma
  Sahay, Frontiers in molecular biosciences 2022
  • “...(GATM) 2.7508166 9 P30711 Glutathione S-transferase theta-1 (GSTT1) 2.7638696 10 Q06828 Fibromodulin (FMOD) 2.7716544 11 Q3SY77 UDP-glucuronosyltransferase 3A2 (UGT3A2) 2.8206772 12 Q15370 Transcription elongation factor B polypeptide 2 (TCEB2) 2.828358 13 P21281 V-type proton ATPase subunit B, brain isoform (ATP6V1B2) 2.9473999 14 O00292 Left-right determination factor...”
• Altered Metabolism of Polycyclic Aromatic Hydrocarbons by UDP-Glycosyltransferase 3A2 Missense Variants.
  Vergara, Chemical research in toxicology 2020
  • “...from the SWISS-MODEL Repository ( http://swissmodel.expasy.org/ ) using the search term ugt3a2. UniProtKB accession number Q3SY77, corresponding to the human UGT3A2 sequence, was selected, and model coordinates were downloaded. The model of UGT3A2 was built by standard SWISS-MODEL Repository procedures based on available coordinates for UGT76G1...”

NP_001161788 UDP-glucuronosyltransferase 3A2 isoform 2 precursor from Homo sapiens
31% identity, 30% coverage

• Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
  Meech, The Journal of biological chemistry 2012
  • GeneRIF: A phenylalanine (Phe-391) in UGT3A2 favors UDP-Glc use.
• MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
  Zhang, Carcinogenesis 2010
  • GeneRIF: Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

PAU_02756 similar to probable glycosyltransferase from Photorhabdus asymbiotica
23% identity, 85% coverage

• From Insect to Man: Photorhabdus Sheds Light on the Emergence of Human Pathogenicity
  Mulley, PloS one 2015
  • “...encode glycosidase enzymes that add the sugar groups to produce the final rhabduscin molecule. Note PAU_02756 is unique to the P . asymbiotica (replaced by a transposase in Pl TT01 ) and so the final Pa ATCC43949 rhabduscin structure from Pa ATCC43949 may not be the...”

LOC660846 UDP-glycosyltransferase UGT5 from Tribolium castaneum
26% identity, 38% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...LOC103313826 2.22 Down 8.77E-05 FMO 2 Phase I LOC664598 2.25 Down 0 OBPC01 Phase 0 LOC660846 2.44 Down 7.10E-103 Ugt2C1 Phase II LOC662337 2.49 Down 6.97E-127 CYP4C1 Phase I LOC107398495 2.77 Down 7.86E-25 GSTe4 like Phase II LOC664475 2.87 Down 5.91E-05 CYP6A20 Phase I LOC661930 3.09...”

plu1762 No description from Photorhabdus luminescens subsp. laumondii TTO1
22% identity, 82% coverage

• Small molecule perimeter defense in entomopathogenic bacteria
  Crawford, Proceedings of the National Academy of Sciences of the United States of America 2012
  • “...plu2817) from two glycosyltransferase homologs (plu1760 and plu1762) (Fig. 2A). It seemed likely that both glycosyltransferase genes contributed to rhabduscin...”

LOC109430808 UDP-glucosyltransferase 2 from Aedes albopictus
33% identity, 23% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito Aedes albopictus in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...3.32* 1.32E-18 UGT49B1 LOC109410284 14.67 47.18 2.97* 3.85E-03 26.15 1.61 1.63E-01 52.21 2.90* 2.05E-26 UGT49C1a LOC109430808 1.73 14.04 7.07* 1.01E-08 6.31 3.22* 1.35E-04 12.54 5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37 4.81E-01 34.03 2.22* 5.97E-11 UGT5 LOC109408672 3.87 17.61 4.40* 4.60E-03 10.07 2.38*...”

UD3A2_MOUSE / Q8JZZ0 UDP-glucuronosyltransferase 3A2; UDPGT 3A2; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
30% identity, 28% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• Deciphering the Kidney Matrisome: Identification and Quantification of Renal Extracellular Matrix Proteins in Healthy Mice
  Rende, International journal of molecular sciences 2023
  • “...the MD. Protein ID Protein Name Gene Symbol Identified by Method Ref * CME SME Q8JZZ0 Alpha-2-macroglobulin; Alpha-2-macroglobulin 165 kDa subunit; Alpha-2-macroglobulin 35 kDa subunit A2m + MD P09470 Angiotensin-converting enzyme Ace + + [ 40 ] Q8R0I0 Angiotensin-converting enzyme 2 Ace2 + + [ 38...”
• Dataset on the mass spectrometry-based proteomic profiling of the kidney from wild type and the dystrophic mdx-4cv mouse model of X-linked muscular dystrophy.
  Dowling, Data in brief 2020
  • “...Transmembrane protein 33 Tmem33 2 6.1302 0.00735 1.38 Q61207 Prosaposin Psap 2 5.1656 0.00022 1.37 Q8JZZ0 UDP-glucuronosyltransferase 3A2 Ugt3a2 2 6.4221 0.02672 1.37 Q9DBX3 Sushi domain-containing protein 2 Susd2 4 14.5368 0.00470 1.37 Q9Z1J3 Cysteine desulfurase, mitochondrial Nfs1 2 11.6958 1.28E-05 1.36 Q3U9G9 Lamin-B receptor Lbr...”
• Alport syndrome: Proteomic analysis identifies early molecular pathway alterations in Col4a3 knock out mice.
  Nicolaou, Nephrology (Carlton, Vic.) 2020
  • “...2.74E04 14.7 MM NN Protein S100A8 P20852 CP2A5 1.59E02 4.0 MM NN Cytochrome P450 2A5 Q8JZZ0 UD3A2 2.03E06 3.0 MM NN UDPglucuronosyltransferase 3A2 Q99K74 MED24 1.09E02 2.5 MM NN Mediator of RNA polymerase II transcription subunit 24 Q9JIY7 NAT8 1.86E02 2.2 MM NN Nacetyltransferase 8 Q8K0H1...”

Q8TYD0 UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
24% identity, 92% coverage

• Agl24 is an ancient archaeal homolog of the eukaryotic N-glycan chitobiose synthesis enzymes
  Meyer, eLife 2022
  • “...producing Euryarchaeota with higher sequence similarity to the MurG are aligned (turquoise background): Methanopyrus kandleri (Q8TYD0), Methanothermus fervidus (E3GWY2), Methanobacterium formicicum (A0A089ZDB2), Methanothermobacter marburgensis (D9PUE1). Conserved amino acids (65% threshold) are highlighted in color corresponding to the amino acids: G, S, T, P (orange), K, R,...”

ADN68481.1 UDP-Glc: sorangicin A glucosyltransferase (SorF) (EC 2.4.1.-) (see protein)
31% identity, 40% coverage

AAK16234.1 UDP-Gal: ceramide galactosyltransferase (EC 2.4.1.47) (see protein)
Q98TB5 UDP-galactose ceramide galactosyltransferase from Gallus gallus
30% identity, 24% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5 Modulation of gGlcT1...”

LOC118279357 UDP-glucosyltransferase 2-like from Spodoptera frugiperda
28% identity, 25% coverage

• Transcriptome and Metabolome Analysis Reveals the Importance of Amino-Acid Metabolism in Spodoptera Frugiperda Exposed to Spinetoram
  Gao, Insects 2022
  • “...cytochrome P450 301a1 Up Up LOC118279412 UDP-glucuronosyltransferase 2B15 Up Up LOC118269333 UDP-glucuronosyltransferase 2B19 Up Up LOC118279357 UDP-glucuronosyltransferase 2B7 Up Up insects-13-00852-t003_Table 3 Table 3 Changes of key metabolites in S. frugiperda by exposure to LC 10 and LC 90 dose of the spinetoram compared to the...”

UD3A1_MOUSE / Q3UP75 UDP-glucuronosyltransferase 3A1; UDPGT 3A1; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
31% identity, 28% coverage

• function: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)

Q9VGT8 UDP-glucuronosyltransferase from Drosophila melanogaster
27% identity, 24% coverage

• Satellite DNA-like elements associated with genes within euchromatin of the beetle Tribolium castaneum
  Brajković, G3 (Bethesda, Md.) 2012
  • “...P41596 FBgn0011582 Transposon 900 D6X259 656290 Transport and Golgi organization 13 9 14 5 9456 Q9VGT8 FBgn0040256 Satellite 222 0.6 D6X260 656373 Protein-tyrosine sulfotransferase 9 14 3 33,523 Q9VYB7 FBgn0086674 Satellite 222 0.6 D6X075 658603 MICAL-like protein 9 15 5 39,684 Q9VU34 FBgn0036333 Satellite 203 0.6...”

UGT1A3 / P35503 UDP-glucuronosyltransferase 1A3 (EC 2.4.1.17) from Homo sapiens (see 4 papers)
UD13_HUMAN / P35503 UDP-glucuronosyltransferase 1A3; UGT1A3; UDP-glucuronosyltransferase 1-3; UDPGT 1-3; UGT1*3; UGT1-03; UGT1.3; UDP-glucuronosyltransferase 1-C; UGT-1C; UGT1C; UDP-glucuronosyltransferase 1A isoform 3; EC 2.4.1.17 from Homo sapiens (Human) (see 10 papers)
P35503 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 26 papers)
AAG30423.1 UDP-GlcA: glucuronosyltransferase 1A3 (Ugt1a3;UGT1C;UGT1;GNT1) (EC 2.4.1.17) (see protein)
NP_061966 UDP-glucuronosyltransferase 1A3 precursor from Homo sapiens
27% identity, 34% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:15472229, PubMed:18674515, PubMed:18719240, PubMed:23288867, PubMed:23756265, PubMed:24641623, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:23756265). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone (PubMed:15472229, PubMed:18719240, PubMed:23288867). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Involved in the glucuronidation of calcidiol, which is the major circulating form of vitamin D3, essential for the regulation of calcium and phosphate homeostasis (PubMed:24641623). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonists losartan, candesartan and zolarsartan, which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UDP-glucuronosyltransferase (UGT) activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: chenodeoxycholate + UDP-alpha-D-glucuronate = chenodeoxycholoyl-24-O-(beta-D-glucuronate) + UDP (RHEA:52940)
  catalytic activity: deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52948)
  catalytic activity: lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O- (beta-D-glucuronate) + UDP (RHEA:52952)
  catalytic activity: hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholoyl- 24-O-(beta-D-glucuronate) + UDP (RHEA:52956)
  catalytic activity: hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta- D-glucuronate) + UDP (RHEA:52960)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 25-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55840)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan-2-N-beta- D-glucuronide + UDP (RHEA:63728)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-2-N-beta-D- glucuronide + UDP (RHEA:63748)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Evaluation of pharmacogenomics and hepatic nuclear imaging-related covariates by population pharmacokinetic models of irinotecan and its metabolites.
  Liu, European journal of clinical pharmacology 2022 (PubMed)
  • GeneRIF: Evaluation of pharmacogenomics and hepatic nuclear imaging-related covariates by population pharmacokinetic models of irinotecan and its metabolites.
• Identification of low-frequency variants of UGT1A3 associated with bladder cancer risk by next-generation sequencing.
  Zheng, Oncogene 2021
  • GeneRIF: Identification of low-frequency variants of UGT1A3 associated with bladder cancer risk by next-generation sequencing.
• UGT1A3 and Sex Are Major Determinants of Telmisartan Pharmacokinetics-A Comprehensive Pharmacogenomic Study.
  Hirvensalo, Clinical pharmacology and therapeutics 2020 (PubMed)
  • GeneRIF: UGT1A3 and Sex Are Major Determinants of Telmisartan Pharmacokinetics-A Comprehensive Pharmacogenomic Study.
• Combination of hesperetin and platinum enhances anticancer effect on lung adenocarcinoma.
  Wang, Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2019 (PubMed)
  • GeneRIF: our study demonstrated that UGT1A3 functioned as an oncogenic factor in lung adenocarcinoma progression
• Glucuronidation of icaritin by human liver microsomes, human intestine microsomes and expressed UDP-glucuronosyltransferase enzymes: identification of UGT1A3, 1A9 and 2B7 as the main contributing enzymes.
  Wang, Xenobiotica; the fate of foreign compounds in biological systems 2018
  • GeneRIF: Icaritin was subjected to significant glucuronidation, wherein UGT1A3, 1A7, 1A8, 1A9 and 2B7 were main contributing enzymes.
• Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
  Yilmaz, Asian Pacific journal of cancer prevention : APJCP 2015 (PubMed)
  • GeneRIF: Increased UGT1A3 expression is associated with pancreatic cancer.
• Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3: metabolite structure, kinetics, inducibility, and interindividual variability.
  Wang, Endocrinology 2014
  • GeneRIF: Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3.
• Human UDP-glucuronosyltransferase (UGT) 2B10 in drug N-glucuronidation: substrate screening and comparison with UGT1A3 and UGT1A4.
  Kato, Drug metabolism and disposition: the biological fate of chemicals 2013 (PubMed)
  • GeneRIF: the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
• More
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...Cytochrome P450 2C19 Steroid hydroxylase activity 18577768 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8...”
  • “...Cytochrome P450 2B6 Steroid hydroxylase activity 21289075 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 Fluvastatin DB01095 CYP1A1 P04798 Cytochrome P450 1A1 Vitamin d 24-hydroxylase activity 11555828 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 11555828 CYP3A5 P20815...”
• KNIME workflow for retrieving causal drug and protein interactions, building networks, and performing topological enrichment analysis demonstrated by a DILI case study.
  Füzi, Journal of cheminformatics 2022
  • “...P05177 CYP1A2 6.0 Q9NPD5 SLCO1B3 6.0 Q9Y6L6 SLCO1B1 6.0 P11712 CYP2C9 5.8 P02763 ORM1 5.0 P35503 UGT1A3 5.0 Network Similarly to the causal target part, the network part of the workflow also provides the possibility for different types of analyses. Here we present a subsequential analysis...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...P25874 Tar094 UGT1A1 UDP-glucuronosyltransferase 1A1 P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...LDLR low density lipoprotein receptor None 54 P11388 TOP2A DNA topoisomerase II alpha None 55 P35503 UGT1A3 UDP glucuronosyltransferase family 1 member A3 None 56 O60656 UGT1A9 UDP glucuronosyltransferase family 1 member A9 None 57 P04035 HMGCR 3-hydroxy-3-methylglutaryl -CoA reductase None 58 P10636 MAPT microtubule associated...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P22309 UGT1A1 UDP-glucuronosyltransferase 1-1 Homo sapiens Drugbank Q9HAW8 UGT1A10 UDP-glucuronosyltransferase 1-10 Homo sapiens Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data bank (PDB) structures. Based...”
• Intrinsic Disorder in Transmembrane Proteins: Roles in Signaling and Topology Prediction
  Bürgi, PloS one 2016
  • “...calcium binding protein involved in synaptic vesicles fusion. (E) Disorder prediction of UDP-glucuronosyltranferase 13 (UniProtID: P35503), an enzyme involved in the addition of glucoronic acid moieties to various compounds and important in detoxification. For (D and E) the blue dots represent the average disorder score using...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• More

UD11_HUMAN / P22309 UDP-glucuronosyltransferase 1A1; UGT1A1; Bilirubin-specific UDPGT isozyme 1; hUG-BR1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UDP-glucuronosyltransferase 1A isoform 1; EC 2.4.1.17 from Homo sapiens (Human) (see 44 papers)
P22309 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 44 papers)
AAA63195.1 UDP-GlcA: glucuronosyltransferase 1A1 (Ugt1a1;Ugt1;Gnt1) (EC 2.4.1.17) (see protein)
NP_000454 UDP-glucuronosyltransferase 1A1 precursor from Homo sapiens
Q5DT03 UDP-glucuronosyltransferase from Homo sapiens
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15472229, PubMed:18004206, PubMed:18004212, PubMed:18719240, PubMed:19830808, PubMed:23288867, PubMed:15231852, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004206, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed:15472229, PubMed:18719240, PubMed:23288867). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (PubMed:17187418, PubMed:18004206, PubMed:19830808, PubMed:24525562). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20- HETE, PGB1 and F2-isoprostane (8-iso-PGF2alpha) (PubMed:15231852, PubMed:38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:18004212, PubMed:20610558).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2 (PubMed:17187418, PubMed:20610558). Isoform 1 also interacts with respective i2 isoforms of UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• The aggregation tendencies of the signal peptide regions of prone and not prone to aggregate proteins.
  Horgan, Biochemistry and biophysics reports 2025
  • “...PTH is P01270, SERPINA7 is P05543, SERPINE1 is P05121, PRSS1 is P07477, and UGT1A1 is P22309. 2.3 Congo red (CR) binding assays CR binding assays were used to identify amyloid formation by its binding affinity to fibrillar -aggregates. A CR stock solution was prepared by dissolving...”
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase...”
  • “...Vitamin d3 25-hydroxylase activity 10681376 CYP2C19 P33261 Cytochrome P450 2C19 Steroid hydroxylase activity 18577768 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17...”
• ProtVar: mapping and contextualizing human missense variation.
  Stephenson, Nucleic acids research 2024
  • “...ref, alt (consequence) NM_000202.8:c.1327C>T NM_020975.6(RET):c.3105G>A (p.Glu1035Glu) Protein UniProt accession and position accession, position, (ref), (alt) P22309 71 Gly Arg HGVSp RefSeq, type, ref, position, alt NP_001305738.1:p.Pro267Ser Variant ID dbSNP Variant ID rs864622779 ClinVar RCV001270034, VCV002573141 COSMIC COSV64777467, COSM1667583 Input format is assessed for type and then...”
• Similarities in Structure and Function of UDP-Glycosyltransferase Homologs from Human and Plants.
  Lethe, International journal of molecular sciences 2024
  • “...colon, and small intestine, corresponding to their role as catalysts in phase II metabolism (Uniprot P22309, 2023). The UGT1A and UGT2B subfamilies have vital roles in phenolic drug elimination, which are not limited to acetaminophen, SN38, morphine, and assorted cancer drugs like irinotecan [ 15 ]....”
  • “...UDP (tan, PDB#: 2ACW); UGT1A1 was predicted using the AI software AlphaFold2 (light blue; UniProt# P22309; AlphaFold Protein Structure Database# AF-P22309-F1). UGT1A1 has a helical transmembrane-spanning region that is cropped from the image. Figure 4 Size comparison of the acceptor-binding pocket of UGT71G1 with PaGT3. The...”
• Cuproptosis gene-related, neural network-based prognosis prediction and drug-target prediction for KIRC.
  Liu, Cancer medicine 2024
  • “...Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654 P07949 Protooncogene tyrosineprotein kinase receptor Ret DB06486 Enzastaurin P22309 UDPglucuronosyltransferase 1A1 DB00307 Bexarotene P22309 UDPglucuronosyltransferase 1A1 DB00544 5Fluorouracil O60656 UDPglucuronosyltransferase 1A9 DB08073 A443654 P21802 Fibroblast growth factor receptor 2 DB00544 5Fluorouracil P07949 Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654...”
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...17 beta 13 (HSD17B13) Q7Z5P4 Liver enriched Medium Low in many DME UDPglucuronosyltransferase 1A1 (UGT1A1) P22309 Liver enriched High Low in intestine Group 2: Enrichment in liver and 12 other tissues DME Cytochrome P450 3A5 (CYP3A5) P20815 Liver, intestine High High in intestine DME Carboxylesterase 1...”
• The Effect of Citrus aurantium on Non-Small-Cell Lung Cancer: A Research Based on Network and Experimental Pharmacology
  Yao, BioMed research international 2023
  • “...Cytochrome P450 19A1 CYP19A1 P11511 32 Glutathione S-transferase P GSTP1 P09211 33 UDP-glucuronosyltransferase 1-1 UGT1A1 P22309 34 Glutathione reductase, mitochondrial GSTO1 P78417 35 Adiponectin ADIPOQ Q15848 36 Aldo-keto reductase family 1 member C1 AKR1C2 P52895 37 Liver carboxylesterase 1 CES1 P23141 38 Nitric oxide synthase, inducible...”
• Characterizing common and rare variations in non-traditional glycemic biomarkers using multivariate approaches on multi-ancestry ARIC study.
  Ray, medRxiv : the preprint server for health sciences 2023
  • “...for proteins encoded by both UGT1A1 ( p = 2.0 10 278 , Uniprot ID P22309) and UGT1A6 ( p = 5.6 10 104 , Uniprot ID P19224) corresponding to isoforms of the UDP-glucuronosyltransferase 1A protein complex ( Figure 1 ). It was identified as cis...”
• More
• Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population.
  Fan, BMC pediatrics 2024
  • GeneRIF: Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population.
• [UGT1A1 gene mutation spectrum with indirect hyperbilirubinemia in children].
  Shen, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2024 (PubMed)
  • GeneRIF: [UGT1A1 gene mutation spectrum with indirect hyperbilirubinemia in children].
• Activation of Cryptic Donor Splice Sites within the UDP-Glucuronosyltransferase (UGT)1A First-Exon Region Generates Variant Transcripts That Encode UGT1A Proteins with Truncated Aglycone-Binding Domains.
  Hu, Drug metabolism and disposition: the biological fate of chemicals 2024 (PubMed)
  • GeneRIF: Activation of Cryptic Donor Splice Sites within the UDP-Glucuronosyltransferase (UGT)1A First-Exon Region Generates Variant Transcripts That Encode UGT1A Proteins with Truncated Aglycone-Binding Domains.
• Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
  Jiang, World journal of gastroenterology 2024
  • GeneRIF: Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
• [Correlation between the mutation spectrum of the UGT1A1 gene and clinical phenotype in patients with inherited hyperunconjugated bilirubinemia].
  Xiong, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2024 (PubMed)
  • GeneRIF: [Correlation between the mutation spectrum of the UGT1A1 gene and clinical phenotype in patients with inherited hyperunconjugated bilirubinemia].
• The Evaluation of the Genetic Variation Types of the Uridine Diphosphate Glucuronosyl Transferase 1A1 Gene by Next-Generation Sequencing and Their Effects on Bilirubin Levels in Obese Children.
  Aslantas, Genetic testing and molecular biomarkers 2024
  • GeneRIF: The Evaluation of the Genetic Variation Types of the Uridine Diphosphate Glucuronosyl Transferase 1A1 Gene by Next-Generation Sequencing and Their Effects on Bilirubin Levels in Obese Children.
• Analysis of UGT1A1 genotype-phenotype correlation in Chinese patients with gilbert and crigler-Najjar II syndrome.
  Wu, European journal of medical genetics 2024 (PubMed)
  • GeneRIF: Analysis of UGT1A1 genotype-phenotype correlation in Chinese patients with gilbert and crigler-Najjar II syndrome.
• Polycyclic aromatic hydrocarbon and its adducts in peripheral blood: Gene and environment interaction among Chinese population.
  Guo, Environment international 2024 (PubMed)
  • GeneRIF: Polycyclic aromatic hydrocarbon and its adducts in peripheral blood: Gene and environment interaction among Chinese population.
• More
• Regioselective sulfation and glucuronidation of phenolics: insights into the structural basis.
  Wu, Current drug metabolism 2011
  • “...for homology modeling. The aligned sequence identity is 13.7%. The full length UGT1A1 sequence (Accession: Q5DT03) was downloaded from the SwissProt database ( http://www.uniprot.org/ ). Approximately 450 amino acids long sequence of human 1A1 (excluding N-terminal signal peptide, C-terminal transmembrane domain and cytosolic tail) was aligned...”

ML0125 putative glycosyl transferase from Mycobacterium leprae TN
29% identity, 36% coverage

• The genome of Mycobacterium leprae: a minimal mycobacterial gene set
  Vissa, Genome biology 2001
  • “...100/100 Y 61/74 ? plant and microbial glucosyl or 6-deoxyglycosyl transferases; candidate rhamnosyltransferase for PGL-I ML0125 Rv2962c Y 99/99 ? 27/41 ? Clustered with methyltransferases ( ML0127 / Rv2959c ); candidate genes for glycosyltransferases in PGL-I synthesis ML0128 Rv2958c Y 99/99 C-terminal ? See comments for...”

AAB81536.1 Glucuronosyltransferase 1A7 (Ugt1a7) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

LOC118279412 UDP-glucosyltransferase 2 from Spodoptera frugiperda
27% identity, 34% coverage

• Transcriptome and Metabolome Analysis Reveals the Importance of Amino-Acid Metabolism in Spodoptera Frugiperda Exposed to Spinetoram
  Gao, Insects 2022
  • “...6B5 Up Up LOC118264635 cytochrome P450 9e2 Up Up LOC118271250 cytochrome P450 301a1 Up Up LOC118279412 UDP-glucuronosyltransferase 2B15 Up Up LOC118269333 UDP-glucuronosyltransferase 2B19 Up Up LOC118279357 UDP-glucuronosyltransferase 2B7 Up Up insects-13-00852-t003_Table 3 Table 3 Changes of key metabolites in S. frugiperda by exposure to LC 10...”

UD16_HUMAN / P19224 UDP-glucuronosyltransferase 1A6; UGT1A6; Phenol-metabolizing UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UDP-glucuronosyltransferase 1-F; UGT-1F; UGT1F; EC 2.4.1.17 from Homo sapiens (Human) (see 7 papers)
P19224 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 30 papers)
AAG30420.1 UDP-GlcA: glucuronosyltransferase 1A6 (Ugt1a6) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:15231852, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:15231852, PubMed:21422672). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and 20-HETE (PubMed:15231852). Conjugates small planar phenolic molecules such as 4-nitrophenol, 1-naphthol, and 4- methylumbelliferone. The bulky phenol 4-hydroxybiphenyl, androgens and estrogens are not substrates. 2-hydroxybiphenyl is an excellent substrate (By similarity). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672).
  function: [Isoform 3]: Isoform 3 lacks transferase activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Isoform 1 interacts with isoform 3/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 3. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A7, UGT1A8, UGT1A9 and UGT1A10.
• Exploring potential plasma drug targets for cholelithiasis through multiancestry Mendelian randomization.
  Liu, International journal of surgery (London, England) 2025
  • “...Wald ratio 0.865 (0.8450.886) 4.7010 32 1479.658 Ferkingstad et al . 7 European UGT 1A6 P19224 rs1976391 G Wald ratio 0.680 (0.4960.626) 9.5810 30 759.910 Ferkingstad et al . 7 European NOE1 Q99784 rs977371848 T Wald ratio 0.557 (0.4960.626) 4.2110 23 174.518 Ferkingstad et al ....”
  • “...FUT3 P21217 rs708686 0.806 (0.5861.107) Passed (1.4910 242 ) 1.000 Statistically significance European UGT 1A6 P19224 rs1976391 0.965 (0.8631.079) Passed (4.6510 118 ) 0.996 Statistically significance European NOE1 Q99784 rs977371848 1.015 (0.9861.045) Passed (8.3710 23 ) 0.993 Directional consistency European GCKR Q14397 rs1260326 1.029 (0.9821.078) Passed...”
• Establishing the capacity to monitor proteins relevant to the study of drug exposure and response using liver-derived extracellular vesicles.
  Newman, British journal of clinical pharmacology 2024
  • “...Ketohexokinase (KHK) P50053 Liver, intestine, kidney High High in intestine, kidney DME UDPglucuronosyltransferase 1A6 (UGT1A6) P19224 Liver, kidney Medium High in kidney, medium in intestine DME UDPglucuronosyltransferase 2B4 (UGT2B4) P06133 Liver, intestine, kidney Medium High in intestine, kidney DME UDPglucuronosyltransferase 2B7 (UGT2B7) P16662 Liver, kidney High...”
• Characterizing common and rare variations in non-traditional glycemic biomarkers using multivariate approaches on multi-ancestry ARIC study.
  Ray, medRxiv : the preprint server for health sciences 2023
  • “..., Uniprot ID P22309) and UGT1A6 ( p = 5.6 10 104 , Uniprot ID P19224) corresponding to isoforms of the UDP-glucuronosyltransferase 1A protein complex ( Figure 1 ). It was identified as cis -eQTL for UGT1A3 and UGT1A8 in the same complex of alternatively spliced...”
• Druggable proteins influencing cardiac structure and function: Implications for heart failure therapies and cancer cardiotoxicity.
  Schmidt, Science advances 2023
  • “...Inhibitor ISK2 (P20155) LYAM2 (P16581) Indirectly druggable None None Harmful 3 3 Antagonist, inhibitor UD16 (P19224) Currently not druggable Left Harmful Harmful 0 0 CD33 (P20138) Directly drugged Left Harmful Beneficial 4 6 Binding agent, other CAH6 (P23280) Directly drugged Right Harmful Harmful 4 1 Inhibitor...”
• IgGFc-binding protein and MUC2 mucin produced by colonic goblet-like cells spatially interact non-covalently and regulate wound healing.
  Gorman, Frontiers in immunology 2023
  • “...P12277 0.719577745 RBM39 RNA-binding protein 39 Q14498 0.735175542 INF2 Inverted formin-2 Q27J81 0.752149128 UGT1A6 UDP-glucuronosyltransferases P19224 0.763751492 EPB41L2 Band 4.1-like protein 2 O43491 0.777451278 HSP90AB2P Putative heat shock protein HSP 90-beta 2 Q58FF8 0.789186704 ATP1A1 Sodium/potassium-transporting ATPase subunit alpha-1 P05023 0.801241448 BSG Basigin P35613 0.809002775 CD9...”
• Intra- and Inter-individual Differences in the Human Intestinal Microbial Conversion of (-)-Epicatechin and Bioactivity of Its Major Colonic Metabolite 5-(3',4'-Dihydroxy-Phenyl)-γ-Valerolactone in Regulating Nrf2-Mediated Gene Expression.
  Liu, Frontiers in nutrition 2022
  • “...glutathione peroxidase 8 GPX8 2.11 (0.376) 0.97 (0.979) Q13162 Peroxiredoxin-4 PRDX4 1.57 (0.034) 1.24 (0.410) P19224 UDP-glucuronosyltransferase UGT1A6 1.10 (0.749) 1.31 (0.344) P34913 Bifunctional epoxide hydrolase 2 EPHX2 1.14 (0.440) 1.40 (0.043) Q13501 Sequestosome-1 SQSTM1 1.05 (0.969) 1.21 (0.874) O75027 ABCB7 ABCB7 0.49 (0.526) 2.31 (0.297)...”
• Homology Modeling of Human Uridine-5'-diphosphate-glucuronosyltransferase 1A6 Reveals Insights into Factors Influencing Substrate and Cosubstrate Binding
  Smith, ACS omega 2020
  • “...Modeling of UGT1A6 Homology models of the human UGT1A6 protein (GenBank accession #: NP_001063.2, Uniprot: P19224) were produced using the I-TASSER server. 64 66 UGT1A6 possesses a 26-amino acid N-terminal signal peptide which acts to target the immature protein to the ER. 40 Once inserted into...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the...”
• More

UD15_HUMAN / P35504 UDP-glucuronosyltransferase 1A5; UGT1A5; UDP-glucuronosyltransferase 1-5; UDPGT 1-5; UGT1*5; UGT1-05; UGT1.5; UDP-glucuronosyltransferase 1-E; UGT-1E; UGT1E; EC 2.4.1.17 from Homo sapiens (Human) (see 2 papers)
P35504 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 4 papers)
AAG30421.1 glucuronosyltransferase 1A5 (Ugt1a5) (EC 2.4.1.17) (see protein)
NP_061951 UDP-glucuronosyltransferase 1A5 precursor from Homo sapiens
27% identity, 34% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18674515). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18674515). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist zolarsatan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-1-N-beta-D- glucuronide + UDP (RHEA:63744)
  subunit: Homodimer (By similarity). Homooligomer (By similarity). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (By similarity). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (By similarity).
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• A common polymorphic variant of UGT1A5 displays increased activity due to optimized cofactor binding.
  Yang, FEBS letters 2018 (PubMed)
  • GeneRIF: Extensive molecular dynamics simulations revealed that the Gly259Arg mutation stabilizes helix Q through a newly formed hydrogen bonding network, which places the cofactor in a much more favorable geometry in UGT1A5*8 as compared to the wild-type.
• Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
  Bailey, Diabetes care 2010
  • GeneRIF: Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
• Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
  Ross, Nature genetics 2009 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
  Talmud, American journal of human genetics 2009
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Genetic variations and haplotypes of UDP-glucuronosyltransferase 1A locus in a Korean population.
  Yea, Therapeutic drug monitoring 2008 (PubMed)
  • GeneRIF: Observational study of genotype prevalence. (HuGE Navigator)

UD19_HUMAN / O60656 UDP-glucuronosyltransferase 1A9; UGT1A9; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UDP-glucuronosyltransferase 1-I; UGT-1I; UGT1I; lugP4; EC 2.4.1.17 from Homo sapiens (Human) (see 14 papers)
O60656 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 37 papers)
AAC31425.1 UDP-GlcA: glucuronosyltransferase 1A9 (Ugt1a9) (EC 2.4.1.17) (see protein)
NP_066307 UDP-glucuronosyltransferase 1A9 precursor from Homo sapiens
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15470161, PubMed:15472229, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:19545173, PubMed:15231852, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone (PubMed:15472229). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, PGB1 and F2-isoprostanes (8-iso-PGF2alpha and 5-epi-5-F2t-IsoP) (PubMed:15231852, PubMed:38211441). Glucuronates the phytochemical ferulic acid efficently at both the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:20610558). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161, PubMed:18004212).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT1A8 Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099...”
• Bioinformatic characterization of ENPEP, the gene encoding a potential cofactor for SARS-CoV-2 infection.
  Arppo, PloS one 2024
  • “...cysteine protease Kidney cortex UGT2A3 0.8434 28528 Q6UWM9 UDP-glucuronosyltransferase 2A3 Kidney cortex UGT1A9 0.8335 12541 O60656 UDP-glucuronosyltransferase 1A9 glycosyltransferase Kidney cortex ANPEP 0.8259 500 P15144 Aminopeptidase N metalloprotease Kidney cortex SLC4A4 0.8179 11030 Q9Y6R1 Electrogenic sodium bicarbonate cotransporter 1 secondary carrier transporter Kidney cortex TCN2 0.8102...”
• Cuproptosis gene-related, neural network-based prognosis prediction and drug-target prediction for KIRC.
  Liu, Cancer medicine 2024
  • “...2D6 DB06486 Enzastaurin P10635 Cytochrome P450 2D6 DB08073 A443654 P10635 Cytochrome P450 2D6 DB00307 Bexarotene O60656 UDPglucuronosyltransferase 1A9 DB06486 Enzastaurin O60656 UDPglucuronosyltransferase 1A9 DB08073 A443654 O60656 UDPglucuronosyltransferase 1A9 DB00307 Bexarotene P07949 Protooncogene tyrosineprotein kinase receptor Ret DB08073 A443654 P07949 Protooncogene tyrosineprotein kinase receptor Ret DB06486 Enzastaurin...”
• KNIME workflow for retrieving causal drug and protein interactions, building networks, and performing topological enrichment analysis demonstrated by a DILI case study.
  Füzi, Journal of cheminformatics 2022
  • “...often downregulated by the mostDILI than the noDILI group Uniprot_ID Gene_name Significance_score P23219 PTGS1 16.0 O60656 UGT1A9 14.0 O94956 SLCO2B1 11.0 Q92887 ABCC2 9.0 P11509 CYP2A6 9.0 P22309 UGT1A1 7.5 Q9Y694 SLC22A7 7.0 P05177 CYP1A2 6.0 Q9NPD5 SLCO1B3 6.0 Q9Y6L6 SLCO1B1 6.0 P11712 CYP2C9 5.8 P02763...”
  • “...Table 7 Example of a causal network output row target_uniprot_id typeA Interactor_uniprot_id typeB Effect moi O60656 protein P20823 protein up-regulates quantity by expression 1 Table 8 Upregulated proteins by the downregulated proteins significantly connected to the mostDILI group target_uniprot_id Interactor_uniprot_id O60656 P20823 P22309 P35869 P22309 P20823...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all the...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...topoisomerase II alpha None 55 P35503 UGT1A3 UDP glucuronosyltransferase family 1 member A3 None 56 O60656 UGT1A9 UDP glucuronosyltransferase family 1 member A9 None 57 P04035 HMGCR 3-hydroxy-3-methylglutaryl -CoA reductase None 58 P10636 MAPT microtubule associated protein tau None 59 P26358 DNMT1 DNA methyltransferase 1 None...”
• Identification of HO-1 as a novel biomarker for graft acute cellular rejection and prognosis prediction after liver transplantation
  Jia, Annals of translational medicine 2020
  • “...O43175 D-3-phosphoglycerate dehydrogenase PHGDH 0.604 Q15493 Regucalcin RGN 0.604 Q6NVY1 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial HIBCH 0.605 O60656 UDP-glucuronosyltransferase 1-9 UGT1A9 0.607 P49326 Dimethylaniline monooxygenase [N-oxide-forming] 5 FMO5 0.609 Q7Z4W1 L-xylulose reductase DCXR 0.609 Q14353 Guanidinoacetate N-methyltransferase GAMT 0.615 P08684 Cytochrome P450 3A4 CYP3A4 0.619 Q02252 Methylmalonate-semialdehyde dehydrogenase...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase 2B4 Homo sapiens Drugbank P16662 UGT2B7 UDP-glucuronosyltransferase 2B7 Homo sapiens Drugbank P02768 ALB Serum albumin Homo sapiens Drugbank, Genecards P23219 PTGS1...”
• More
• Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism.
  Zhou, Drug metabolism and disposition: the biological fate of chemicals 2024 (PubMed)
  • GeneRIF: Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism.
• Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
  Matsumoto, Molecular and cellular biochemistry 2023 (PubMed)
  • GeneRIF: Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
• UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro.
  Li, Molecules (Basel, Switzerland) 2022
  • GeneRIF: UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro.
• Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.
  Borrego-Soto, The pharmacogenomics journal 2020
  • GeneRIF: Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.
• Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.
  Hryniewiecka, Transplantation proceedings 2020 (PubMed)
  • GeneRIF: Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.
• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...against the Bm-UGT peptide sequence. The following are the orthologs selected for analyses: Homo sapiens (NP_066307), Canis lupus familiaris (XP_005635657), and Felis catus (BAA2492). Structural analysis of Bm-UGT The Bm-UGT sequence was initially analyzed for properties including signal peptide sequence, and potential transmembrane sequence using InterPro,...”
• Epigenetic regulation of UDP-Glucuronosyltransferase by microRNA-200a/-183: implications for responses to sorafenib treatment in patients with hepatocellular carcinoma.
  Ge, Cancer letters 2019 (PubMed)
  • GeneRIF: Direct binding was further demonstrated by luciferase reporter gene vector carrying wild-type or binding site truncated UGT1A9 3'-UTR. MicroRNA-200a/-183 downregulated UGT1A9 expression in a dose-dependent manner and significantly reduced sorafenib beta-D-glucuronide formation in HCC cells.
• Novel analytical methods to interpret large sequencing data from small sample sizes.
  Lichou, Human genomics 2019
  • GeneRIF: Using a graphical representation, from 708 identified polymorphisms, a reduced list of 115 candidates was obtained. Then, by analyzing each gene and the distribution of variant alleles, several candidates were highlighted such as UGT1A9, PTPN22, and ERCC5. These genes were already associated with the transport, the metabolism, and even the sensitivity to imatinib in previous studies.
• More

UGT1A4 / P22310 UDP-glucuronosyltransferase 1-4 (EC 2.4.1.17) from Homo sapiens (see 6 papers)
UD14_HUMAN / P22310 UDP-glucuronosyltransferase 1A4; UGT1A4; Bilirubin-specific UDPGT isozyme 2; hUG-BR2; UDP-glucuronosyltransferase 1-4; UDPGT 1-4; UGT1*4; UGT1-04; UGT1.4; UDP-glucuronosyltransferase 1-D; UGT-1D; UGT1D; EC 2.4.1.17 from Homo sapiens (Human) (see 9 papers)
P22310 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 27 papers)
AAA63196.1 UDP-GlcA: glucuronosyltransferase 1A4 (Ugt1a4) (EC 2.4.1.17) (see protein)
NP_009051 UDP-glucuronosyltransferase 1A4 precursor from Homo sapiens
27% identity, 34% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:18177842, PubMed:24641623, PubMed:15231852). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:18177842). Involved in the glucuronidation of calcidiol, which is the major circulating form of vitamin D3 essential for the regulation of calcium and phosphate homeostasis (PubMed:24641623). Also glucuronidates the biologically active form of vitamin D3, calcitriol, probably leading to its biliary transport and intestinal reabsorption (PubMed:18177842). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE and PGB1 (PubMed:15231852).
  function: [Isoform 2]: Lacks UDP-glucuronosyltransferase (UGT) activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 25-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55840)
  catalytic activity: calcidiol + UDP-alpha-D-glucuronate = calcidiol 3-O-(beta-D- glucuronide) + UDP + H(+) (RHEA:55844)
  catalytic activity: calcitriol + UDP-alpha-D-glucuronate = calcitriol 25-O-(beta- D-glucuronide) + UDP + H(+) (RHEA:55836)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Characterization and Proteomic Profiling of Hepatocyte-like Cells Derived from Human Wharton's Jelly Mesenchymal Stromal Cells: De Novo Expression of Liver-Specific Enzymes
  Lo, Biology 2025
  • “...Nuclear receptor subfamily 1 group I member 3 (**) E9PCF2 NR1I3 + UDP-glucuronosyltransferase 14 (**) P22310 UGT1A4 - + Lipid metabolic process Acetyl-CoA acetyltransferase, cytosolic (**) Q9BWD1 ACAT2 + + Acetyl-CoA acetyltransferase, mitochondrial P24752 ACAT1 + + Acyl-coenzyme A thioesterase 2, mitochondrial P49753 ACOT2 + +...”
• Evaluation of tea (Camellia sinensis L.) phytochemicals as multi-disease modulators, a multidimensional in silico strategy with the combinations of network pharmacology, pharmacophore analysis, statistics and molecular docking.
  Nag, Molecular diversity 2023
  • “...Hyperbilirubinemia (H00208), Bilirubin, serum level of, quantitative trait locus 1; biliqtl1 (#601,816) Adenine (DB00173) 19 P22310 Homologous model UDP-glucuronosyltransferase 14 Gilbert syndrome (#143,500) Idelalisib (DB09054) 20 P22748 1ZNC [ 72 ] Carbonic anhydrase 4 Retinitis pigmentosa (H00527) Topiramate (DB00273) 21 P24385 2W9Z [ 67 ] G1/S-specific...”
  • “...homology modeling of two proteins (UDP-glucuronosyltransferase 11: UniProt id P22309 and UDP-glucuronosyltransferase 14: UniProt id P22310) were performed by SWISS-Model server, based on the templates of PDB id 6KVJ.1.A and 6O86.1.A. The quality analysis was done by the parameters MolProbity score, QMEAN and GMQE (Global Model...”
• Abnormal ECA-Binding Membrane Glycans and Galactosylated CAT and P4HB in Lesion Tissues as Potential Biomarkers for Hepatocellular Carcinoma Diagnosis.
  Kong, Frontiers in oncology 2022
  • “...36.106 17 7.35 P22695 UQCRC2 Cytochrome b-c1 complex subunit 2, mitochondrial 453 48.443 18 6.67 P22310 UGT1A4 UDP-glucuronosyltransferase 1-4 534 60.025 19 6.53 P11509 CYP2A6 Cytochrome P450 2A6 494 56.501 20 6.45 Q8NBX0 SCCPDH Saccharopine dehydrogenase-like oxidoreductase 429 47.151 20 proteins with the highest Unuesd scores....”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches against the protein data bank (PDB)...”
• A nanoparticle formula for delivering siRNA or miRNAs to tumor cells in cell culture and in vivo.
  Choi, Nature protocols 2014
  • “...see Table 1 for RNA sequences) Paclitaxel, Oregon Green 488 conjugate (OG-PTX; Invitrogen, cat. no. P22310) pcDNA3.1 (Invitrogen, cat. no. V790-20) Potassium carbonate (K 2 CO 3 ; Sigma-Aldrich, cat. no. 209619) 1-Propanol (Sigma-Aldrich, cat. no. 402893) ! CAUTION It is volatile and flammable. RNA annealing/dilution...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• Protein targets of reactive electrophiles in human liver microsomes.
  Shin, Chemical research in toxicology 2007
• Impact of UGT1A4 and UGT2B7 polymorphisms on lamotrigine plasma concentration in patients with bipolar disorder.
  Zhao, Pharmacogenetics and genomics 2024 (PubMed)
  • GeneRIF: Impact of UGT1A4 and UGT2B7 polymorphisms on lamotrigine plasma concentration in patients with bipolar disorder.
• Hepatotoxicity with High-Dose Green Tea Extract: Effect of Catechol-O-Methyltransferase and Uridine 5'-Diphospho-glucuronosyltransferase 1A4 Genotypes.
  Acosta, Journal of dietary supplements 2023
  • GeneRIF: Hepatotoxicity with High-Dose Green Tea Extract: Effect of Catechol-O-Methyltransferase and Uridine 5'-Diphospho-glucuronosyltransferase 1A4 Genotypes.
• Bearing variant alleles at uridine glucuronosyltransferase polymorphisms UGT2B7 -161C > T (rs7668258) or UGT1A4*3 c.142 T > G (rs2011425) has no relevant consequences for lamotrigine troughs in adults with epilepsy.
  Božina, European journal of clinical pharmacology 2023 (PubMed)
  • GeneRIF: Bearing variant alleles at uridine glucuronosyltransferase polymorphisms UGT2B7 -161C > T (rs7668258) or UGT1A4*3 c.142 T > G (rs2011425) has no relevant consequences for lamotrigine troughs in adults with epilepsy.
• A validation study of the UGT1A4 rs2011404 variant and the risk of anti-tuberculosis drug-induced hepatotoxicity in an Eastern Chinese Han population.
  Zhu, Journal of clinical pharmacy and therapeutics 2021 (PubMed)
  • GeneRIF: A validation study of the UGT1A4 rs2011404 variant and the risk of anti-tuberculosis drug-induced hepatotoxicity in an Eastern Chinese Han population.
• Association of CYP2C19 and UGT1A4 polymorphisms with voriconazole-induced liver injury.
  Song, Personalized medicine 2020 (PubMed)
  • GeneRIF: Association of CYP2C19 and UGT1A4 polymorphisms with voriconazole-induced liver injury.
• The association of genetic polymorphisms in CYP1A2, UGT1A4, and ABCB1 with autonomic nervous system dysfunction in schizophrenia patients treated with olanzapine.
  Hattori, BMC psychiatry 2020
  • GeneRIF: The association of genetic polymorphisms in CYP1A2, UGT1A4, and ABCB1 with autonomic nervous system dysfunction in schizophrenia patients treated with olanzapine.
• Representation of CYP3A4, CYP3A5 and UGT1A4 Polymorphisms within Croatian Breast Cancer Patients' Population.
  Bojanic, International journal of environmental research and public health 2020
  • GeneRIF: Representation of CYP3A4, CYP3A5 and UGT1A4 Polymorphisms within Croatian Breast Cancer Patients' Population.
• The Effect of Polymorphism in UGT1A4 on Clinical Outcomes of Adjuvant Tamoxifen Therapy for Patients With Breast Cancer in China.
  Lan, Clinical breast cancer 2019 (PubMed)
  • GeneRIF: Chinese patients with A/A or G/A genotype in the promoter region of bilirubin glucuronoside glucuronosyltransferase (UGT1A4) have a lower 5-year disease-free survival (DFS) rate than those with the wild-type G/G genotype when treated with adjuvant tamoxifen. The rs869283 genotype remains an independent prognostic marker for DFS in multivariate analysis.
• More

ML0128 putative glycosyl transferase from Mycobacterium leprae TN
29% identity, 36% coverage

• Mycobacterium leprae's Infective Capacity Is Associated with Activation of Genes Involved in PGL-I Biosynthesis in a Schwann Cells Infection Model
  Chavarro-Portillo, International journal of molecular sciences 2023
  • “...( Figure 5 a,b,df). The analysis of the transcriptional behavior of the ML0126, ML0127, and ML0128 genes, located in a different locus in the M. leprae genome ( Figure 5 g), which are involved in the process of methylation and translocation of the rhamnosyl residues of...”
  • “...days analyzed, reaching their maximum peak at 3 days post-infection, which decreased over time. The ML0128 gene began with a negative transcription at 2 h post-infection, rising at 3 days and decreasing negatively at 7 days post-infection ( Figure 5 j). Since the function of glycosyltransferases...”
• PGL-III, a Rare Intermediate of Mycobacterium leprae Phenolic Glycolipid Biosynthesis, Is a Potent Mincle Ligand
  Ishizuka, ACS central science 2023
  • “...genes, 20 i.e., rhamnosyl 3- O -methyltransferase (ML0126), rhamnosyl 2- O -methyltransferase (ML0127), rhamnosyl transferase (ML0128), two glucosyl methyltransferases (ML2346 and ML2347), and glucosyltransferase (ML2348), M. marinum produced a large amount of PGL-I, as previously reported. 21 When developing the lipid extract of this PGL-I-producing M....”
  • “...each enzyme and the Hsp60 promoter, respectively. ML0126, Rha-3- O -methyltransferase; ML0127, Rha-2- O -methyltransferase; ML0128, rhamnosyl transferase; ML2346 and ML2347, Glc-3- and Glc-6- O -methyltransferases; and ML2348, glycosyl transferase. (b) Acetone-soluble lipids were extracted from crude lipids derived from mock and recombinant M. marinum and...”
• Mycobacterium lepromatosis as a Second Agent of Hansen's Disease
  Deps, Frontiers in microbiology 2021
  • “...al., 2015 ). M. leprae genes encoding laminin-2 binding protein ML1683c and the six enzymes (ML0128, ML2348 ML0126, ML0127, ML23246c, and ML2347) required to produce the terminal trisaccharide moiety of phenolic glycolipid 1 (PGL-1) are highly conserved in M. lepromatosis ( Singh et al., 2015 ),...”
• A Macrophage Response to Mycobacterium leprae Phenolic Glycolipid Initiates Nerve Damage in Leprosy
  Madigan, Cell 2017
  • “...by transforming M.marinum with the integrating plasmid pWM122, which encodes the M.leprae genes ML0126, ML0127, ML0128, ML2346c, ML2347, and ML2348 under the M.fortuitum pBlaF promoter ( Tabouret etal., 2010 ). Kanamycin-resistant transformants were confirmed by PCR using primers targeting all six M.leprae genes ( Tabouret etal.,...”
• Insight into the evolution and origin of leprosy bacilli from the genome sequence of Mycobacterium lepromatosis
  Singh, Proceedings of the National Academy of Sciences of the United States of America 2015
  • “...are required, namely a rhamnosyl transferase (ML0128), a glucosyltransferase (ML2348), and four methyltransferases (ML0126, ML0127, ML23246c, and ML2347)...”
• Mycobacterium leprae phenolglycolipid-1 expressed by engineered M. bovis BCG modulates early interaction with human phagocytes
  Tabouret, PLoS pathogens 2010
  • “...transfer of the two terminal residues and for the methylation of the first rhamnosyl residue: ML0128 and ML2348 encoding proteins with similarities to glycosyltransferases, and ML0126 , ML0127 , ML2346c and ML2347 encoding proteins with similarities to methyltransferases ( Figures 1B and 1C ) [18] ,...”
  • “...or 6 M. leprae genes. Next, a DNA fragment encompassing the ML0126 , ML0127 and ML0128 genes was inserted into the mycobacterial vector pMIP12H [24] to yield plasmid pBNF03 ( Figure S1 ). In parallel, a second DNA fragment carrying ML2346c , ML2347 and ML2348 genes...”
• The genome of Mycobacterium leprae: a minimal mycobacterial gene set
  Vissa, Genome biology 2001
  • “...Clustered with methyltransferases ( ML0127 / Rv2959c ); candidate genes for glycosyltransferases in PGL-I synthesis ML0128 Rv2958c Y 99/99 C-terminal ? See comments for ML0125 Putative mannosyltransferase for glycoproteins (O-linked) ML0192 Rv1002c Y 99/99 Y 85/91 Y 42/59 Some homology to protein mannosyltransferases in yeast Unassigned...”

AAB84259.1 Glucuronosyltransferase 1A8 (Ugt1a8) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

CAE17535.1 dideacetyl-prechromomycin A4 D-olivosyltransferase (CmmGI) (EC 2.4.1.-) (see protein)
21% identity, 83% coverage

UD17_HUMAN / Q9HAW7 UDP-glucuronosyltransferase 1A7; UGT1A7; UDP-glucuronosyltransferase 1-7; UDPGT 1-7; UGT1*7; UGT1-07; UGT1.7; UDP-glucuronosyltransferase 1-G; UGT-1G; UGT1G; EC 2.4.1.17 from Homo sapiens (Human) (see 13 papers)
Q9HAW7 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 20 papers)
NP_061950 UDP-glucuronosyltransferase 1A7 precursor from Homo sapiens
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15470161, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:20610558, PubMed:23360619, PubMed:21422672, PubMed:38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormone epiestradiol (PubMed:18719240). Involved in the glucuronidation of F2-isoprostane (5-epi-5-F2t-IsoP) (PubMed:38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:18004212, PubMed:20610558, PubMed:23360619). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 10681376 CYP3A5 P20815 Cytochrome P450 3A5...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...with an input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...2015). The accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT sequences were used in blast searches...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• [Gene mutation pattern of Gilbert's syndrome combined with viral hepatitis and its relationship with the exploration of clinical data].
  Ning, Zhonghua gan zang bing za zhi = Zhonghua ganzangbing zazhi = Chinese journal of hepatology 2020 (PubMed)
  • GeneRIF: [Gene mutation pattern of Gilbert's syndrome combined with viral hepatitis and its relationship with the exploration of clinical data].
• Interethnic Variations of UGT1A1 and UGT1A7 Polymorphisms in the Jordanian Population.
  Abudahab, Current drug metabolism 2019 (PubMed)
  • GeneRIF: We found that Circassians and Chechens have significantly higher allele frequencies of UGT1A7*2, UGT1A7*3 and UGT1A7*4 than the Jordanian-Arab population, but all three populations have similar frequencies of UGT1A1*28. Therefore, Circassians and Chechens are expected to have significantly lower levels of the UGT1A7 enzyme with almost 90% of these populations having genes that encode low or intermediate enzyme activity.
• Genetic polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and the risk for benign Warthin's tumors of the parotid gland.
  Lacko, Head & neck 2016 (PubMed)
  • GeneRIF: high activity UGT1A7 genotype is associated with an increased risk for Warthin's tumor.
• Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
  Yilmaz, Asian Pacific journal of cancer prevention : APJCP 2015 (PubMed)
  • GeneRIF: Increased UGT1A7 expression is associated with pancreatic cancer.
• Alteration of the function of the UDP-glucuronosyltransferase 1A subfamily by cytochrome P450 3A4: different susceptibility for UGT isoforms and UGT1A1/7 variants.
  Ishii, Drug metabolism and disposition: the biological fate of chemicals 2014 (PubMed)
  • GeneRIF: Results suggest that CYP3A4 changes the catalytic function of the UGT1A subfamily in a UGT isoform-specific manner.
• Differences in UGT1A1, UGT1A7, and UGT1A9 polymorphisms between Uzbek and Japanese populations.
  Maeda, Molecular diagnosis & therapy 2014
  • GeneRIF: The rate of Results show that UGT1A7*12 allele frequency was not significantly different between the Uzbek and Japanese populations.
• The association between UGT1A7 polymorphism and cancer risk: a meta-analysis.
  Han, Cancer epidemiology 2012 (PubMed)
  • GeneRIF: the UGT1A7*3 allele is a risk factor for cancer among Asians, especially for hepatocellular carcinoma (Meta-Analysis)
• Association between polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and colorectal cancer risk.
  Osawa, Asian Pacific journal of cancer prevention : APJCP 2012 (PubMed)
  • GeneRIF: Polymorphism in UDP-glucuronosyltransferase 1A7 is associated with colorectal cancer.
• More

UGT1A8 / Q9HAW9 UDP-glucuronosyltransferase 1-8 (EC 2.4.1.17) from Homo sapiens (see 4 papers)
UD18_HUMAN / Q9HAW9 UDP-glucuronosyltransferase 1A8; UGT1A8; UDP-glucuronosyltransferase 1-8; UDPGT 1-8; UGT1*8; UGT1-08; UGT1.8; UDP-glucuronosyltransferase 1-H; UGT-1H; UGT1H; EC 2.4.1.17 from Homo sapiens (Human) (see 13 papers)
Q9HAW9 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 20 papers)
NP_061949 UDP-glucuronosyltransferase 1A8 precursor from Homo sapiens
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:15472229, PubMed:16595710, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:19545173, PubMed:23288867, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:15472229, PubMed:16595710, PubMed:23288867). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens and estrogens (PubMed:15472229, PubMed:16595710, PubMed:18719240, PubMed:23288867). Produces dihydrotestosterone (DHT) diglucuronide from the DHT after two subsequent glucoronidation steps (PubMed:16595710). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161, PubMed:18004212).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 2-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53032)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 4- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53036)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = 4-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53052)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 2-methoxyestrone + UDP-alpha-D-glucuronate = 2-methoxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53064)
  catalytic activity: 4-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 4- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53080)
  catalytic activity: 4-methoxyestrone + UDP-alpha-D-glucuronate = 4-methoxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53068)
  catalytic activity: 17beta-hydroxy-5alpha-androstan-3-one + UDP-alpha-D- glucuronate = 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53000)
  catalytic activity: 5alpha-dihydrotestosterone 17-O-(beta-D-glucuronate) + UDP- alpha-D-glucuronate = 5alpha-dihydrotestosterone 17-O-[beta-D- glucuronosyl-(1->2)-glucuronate] + UDP + H(+) (RHEA:53388)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A9 and UGT1A10 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A9 and UGT1A10 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...P450 3A5 Oxygen binding 2732228 Mycophenolate DB01024 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT1A8 Q9HAW9 UDP-glucuronosyltransferase 18 Steroid binding 15472229 UGT1A9 O60656 UDP-glucuronosyltransferase 19 Retinoic acid binding 12181437 UGT1A1 P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8...”
• AlphaFun: Structural-Alignment-Based Proteome Annotation Reveals why the Functionally Unknown Proteins (uPE1) Are So Understudied.
  Pan, Journal of proteome research 2024
  • “...and 5 candidates, respectively. (BD) Illustration of GO terms predicted by the three tools of Q9HAW9, Q8TDI8 and Q502X0. GO terms were illustrated according to the GO hierarchy. The known GO annotations of these three proteins (taken as the correct GO annotation) are shown in an...”
  • “...the effectiveness of our AlphaFun strategy, we selected three representative proteins were selected. The protein Q9HAW9 (Uniprot Accession) was predicted with 80% precision by AlphaFun. The predicted GO terms were of detailed levels, such as retinoic acid metabolic processes and uronic acid metabolic processes, which provided...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...an input of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A...”
• Proteome biology of primary colorectal carcinoma and corresponding liver metastases.
  Fahrner, Neoplasia (New York, N.Y.) 2021
  • “...0.645 1.79E-03 3.00E-02 TRA2A Transformer-2 protein homolog alpha Q3LXA3 0.784 1.64E-03 2.88E-02 TKFC Triokinase/FMN cyclase Q9HAW9 1.288 4.08E-05 2.57E-03 UGT1A8 UDP-glucuronosyltransferase 1A8 P02774 0.79 3.06E-05 2.02E-03 GC Vitamin D-binding protein P04004 0.76 2.59E-03 3.97E-02 VTN Vitronectin Significantly depleted proteins in liver metastases P62736 -1.065 6.90E-06 6.60E-04...”
• Exploring active ingredients and function mechanisms of Ephedra-bitter almond for prevention and treatment of Corona virus disease 2019 (COVID-19) based on network pharmacology
  Gao, BioData mining 2020
  • “...P05177 CYP1A2 113 P08581 MET 173 P14679 TYR 54 Q16678 CYP1B1 114 O43451 MGAM 174 Q9HAW9 UGT1A8 55 P08684 CYP3A4 115 P03956 MMP1 175 P19320 VCAM1 56 Q96PD7 DGAT2 116 P08253 MMP2 176 P15692 VEGFA 57 P27487 DPP4 117 P08254 MMP3 177 P47989 XDH 58 P21728...”
• Uncovering the mechanism of the effects of Paeoniae Radix Alba on iron-deficiency anaemia through a network pharmacology-based strategy
  Ye, BMC complementary medicine and therapies 2020
  • “...P08700 IL3 interleukin 3 None 67 P19320 VCAM1 vascular cell adhesion molecule 1 None 68 Q9HAW9 UGT1A8 UDP glucuronosyl transferase family 1member A8 None 69 P29474 NOS3 nitric oxide synthase 3 None 70 Q16790 CA9 carbonic anhydrase 9 None 71 P83111 LACTB lactamase beta None 72...”
• Molecular Insight into Stereoselective ADME Characteristics of C20-24 Epimeric Epoxides of Protopanaxadiol by Docking Analysis.
  Guo, Biomolecules 2020
  • “...cytochrome P450 (CYP) isoform 3A4 (PDB ID: 1W0F) and UDP-glucuronosyltransferase (UGT) isoform 1A8 (accession ID: Q9HAW9). According to the available results from both in vitro and in vivo experiments [ 14 , 17 , 18 ], the three target proteins are mainly involved in disposition of...”
  • “...sequence was retrieved as a target from the NCBI database with an accession number of Q9HAW9 and downloaded as a FAST ALL format file. Then BLAST (the program Basic Local Alignment Search Tool) was performed to find the best homologous sequence with known 3-D structure as...”
• More
• The function of uterine UDP-glucuronosyltransferase 1A8 (UGT1A8) and UDP-glucuronosyltransferase 2B7 (UGT2B7) is involved in endometrial cancer based on estrogen metabolism regulation.
  Zhao, Hormones (Athens, Greece) 2020 (PubMed)
  • GeneRIF: The function of uterine UDP-glucuronosyltransferase 1A8 (UGT1A8) and UDP-glucuronosyltransferase 2B7 (UGT2B7) is involved in endometrial cancer based on estrogen metabolism regulation.
• In Vitro Study on Influences of UGT1A8 Gene Polymorphisms on Mycophenolate Mofetil Metabolism.
  Zhou, Experimental and clinical transplantation : official journal of the Middle East Society for Organ Transplantation 2018 (PubMed)
  • GeneRIF: UGT1A8 gene polymorphisms can affect the activity of UDP glucuronosyltransferase enzyme, which may influence the elimination of mycophenolate mofetil in different patients.
• Cooperative Regulation of Intestinal UDP-Glucuronosyltransferases 1A8, -1A9, and 1A10 by CDX2 and HNF4α Is Mediated by a Novel Composite Regulatory Element.
  Mubarokah, Molecular pharmacology 2018 (PubMed)
  • GeneRIF: studies lead to a model for the developmental patterning of UGT1A8, UGT1A9, and UGT1A10 in hepatic and/or extrahepatic tissues involving discrete regulatory modules that may function (independently and cooperatively) in a context-dependent manner
• Common variants in glucuronidation enzymes and membrane transporters as potential risk factors for colorectal cancer: a case control study.
  Falkowski, BMC cancer 2017
  • GeneRIF: Polymorphism of UGT1A8 rs1042597-G variant allele is associated with colorectal cancer.
• Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
  Kishi, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
• Species- and gender-dependent differences in the glucuronidation of a flavonoid glucoside and its aglycone determined using expressed UGT enzymes and microsomes.
  Dai, Biopharmaceutics & drug disposition 2015 (PubMed)
  • GeneRIF: Data suggest UGT1A8 is involved in differential metabolism of dietary flavonoids (glucosides and aglycones); glucuronidation of flavonoid glucosides is considerably slower than glucuronidation of flavonoid aglycones in microsomes of intestine/liver.
• Characterization of raloxifene glucuronidation: potential role of UGT1A8 genotype on raloxifene metabolism in vivo.
  Sun, Cancer prevention research (Philadelphia, Pa.) 2013
  • GeneRIF: UGT1A8 Polymorphism is associated with response to raloxifene in breast cancer.
• Genetic polymorphisms of UGT1A8, UGT1A9, UGT2B7 and ABCC2 in Chinese renal transplant recipients and a comparison with other ethnic populations.
  Deng, Die Pharmazie 2013 (PubMed)
  • GeneRIF: A much higher frequency of UGT1A8*2 variant allele was found in Chinese than in Caucasians and Africans
• More

HZ99_RS01145 glycosyltransferase from Pseudomonas fluorescens
22% identity, 91% coverage

• Combined Transcriptome and Proteome Analysis of RpoS Regulon Reveals Its Role in Spoilage Potential of Pseudomonas fluorescens
  Liu, Frontiers in microbiology 2019
  • “...WP_038440714.1 Acyl-homoserine-lactone synthase RhlI 0.157 (2.51E-12) Down/ HZ99_RS01140 WP_038440716.1 Transcriptional regulator RhlR 0.192 (2.38E-10) Down/ HZ99_RS01145 WP_038440719.1 Rhamnosyltransferase chain B, RhlB 0.034 (1.36E-24) Down/ HZ99_RS01150 WP_038440722.1 Rhamnosyltransferase 1 subunit A, RhlA 0.029 (3.31E-19) Down/ HZ99_RS01735 WP_038440888.1 LuxR family transcriptional regulator 0.106 (1.78E-04) Down/ HZ99_RS01825 WP_038440917.1 RNA...”

AAB81537.1 glucuronosyltransferase 1A10 (Ugt1a10) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

UD110_HUMAN / Q9HAW8 UDP-glucuronosyltransferase 1A10; UGT1A10; UDP-glucuronosyltransferase 1-10; UDPGT 1-10; UGT1*10; UGT1-10; UGT1.10; UDP-glucuronosyltransferase 1-J; UGT-1J; UGT1J; EC 2.4.1.17 from Homo sapiens (Human) (see 14 papers)
Q9HAW8 glucuronosyltransferase (EC 2.4.1.17) from Homo sapiens (see 18 papers)
NP_061948 UDP-glucuronosyltransferase 1A10 precursor from Homo sapiens
27% identity, 35% coverage

• function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:18719240, PubMed:19545173, PubMed:23288867, PubMed:26220143, PubMed:15231852, PubMed:21422672). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed:18719240, PubMed:23288867, PubMed:26220143). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and PGB1 (PubMed:15231852). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed:21422672). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II (PubMed:18674515).
  function: [Isoform 2]: Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52464)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16alpha,17beta-estriol + UDP-alpha-D-glucuronate = 16alpha,17beta-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52468)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52876)
  catalytic activity: 16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52924)
  catalytic activity: 16alpha-hydroxyestrone + UDP-alpha-D-glucuronate = 16alpha- hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52448)
  catalytic activity: estrone + UDP-alpha-D-glucuronate = estrone 3-O-(beta-D- glucuronate) + UDP + H(+) (RHEA:52476)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan-2-N-beta- D-glucuronide + UDP (RHEA:63728)
  catalytic activity: zolasartan + UDP-alpha-D-glucuronate = zolarsartan-1-N-beta-D- glucuronide + UDP (RHEA:63744)
  subunit: Homodimer (PubMed:17179145). Homooligomer (Probable). Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A9 to form heterodimers (PubMed:17179145). Isoform 1 interacts with isoform 2/i2 suggesting that oligomerization is involved in negative regulation of transferase activity by isoform 2. Isoform 1 also interacts with respective i2 isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A9 (PubMed:20610558).
• Cytochrome P450 3A gene family and medication in childhood nephrotic syndrome: An update.
  Kochuthakidiyel, Global medical genetics 2025
  • “...P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A7 Q9HAW7 UDP-glucuronosyltransferase 17 Retinoic acid binding 12181437 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 CYP3A4 P08684 Cytochrome P450 3A4 Vitamin d3 25-hydroxylase activity 10681376 CYP3A5 P20815 Cytochrome P450 3A5 Oxygen binding 2732228 CYP2C8 CYP2C8 Cytochrome P450 2C8...”
  • “...P22309 UDP-glucuronosyltransferase 11 Steroid binding 12181437 UGT1A3 P35503 UDP-glucuronosyltransferase 13 Retinoic acid binding 15472229 UGT1A10 Q9HAW8 UDP-glucuronosyltransferase 110 Protein kinase c binding 15258099 UGT2B7 P16662 UDP-glucuronosyltransferase 2B7 Glucuronosyltransferase activity 10702251 UGT2B17 O75795 UDP-glucuronosyltransferase 2B17 Glucuronosyltransferase activity 8798464 CYP2C8 P10632 Cytochrome P450 2C8 Steroid hydroxylase activity 7574697...”
• Complete Reaction Phenotyping of Propranolol and 4-Hydroxypropranolol with the 19 Enzymes of the Human UGT1 and UGT2 Families.
  Yang, International journal of molecular sciences 2022
  • “...of the human UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2A1 sequence (UniProt, Identifiers: Q9HAW7, Q9HAW9, O60656, Q9HAW8 and P0DTE4), respectively. The crystal structure of sterol 3-beta-glucosyltransferase in complex with its cofactor UDP-glucose (PDB code: 5GL5 [ 45 ]) was chosen as the template, for all the homology...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology
  Sun, BioMed research international 2021
  • “...brown fat uncoupling protein 1 P25874 Tar094 UGT1A1 UDP-glucuronosyltransferase 1A1 P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855...”
• Network Pharmacology Identifies the Mechanisms of Action of Shaoyao Gancao Decoction in the Treatment of Osteoarthritis
  Zhu, Medical science monitor : international medical journal of experimental and clinical research 2019
  • “...Drugbank P48775 TDO2 Tryptophan 2,3-dioxygenase Homo sapiens Drugbank P22309 UGT1A1 UDP-glucuronosyltransferase 1-1 Homo sapiens Drugbank Q9HAW8 UGT1A10 UDP-glucuronosyltransferase 1-10 Homo sapiens Drugbank P35503 UGT1A3 UDP-glucuronosyltransferase 1-3 Homo sapiens Drugbank Q9HAW9 UGT1A8 UDP-glucuronosyltransferase 1-8 Homo sapiens Drugbank O60656 UGT1A9 UDP-glucuronosyltransferase 1-9 Homo sapiens Drugbank P06133 UGT2B4 UDP-glucuronosyltransferase...”
• Molecular Docking-Based Design and Development of a Highly Selective Probe Substrate for UDP-glucuronosyltransferase 1A10.
  Juvonen, Molecular pharmaceutics 2018
  • “...UniProt Knowledgebase at www.uniprot.org (UniProt Consortium, 2015). The accession codes for the retrieved UGT1As were: Q9HAW8 (1A10), O60656 (1A9), Q9HAW9 (1A8), Q9HAW7 (1A7), P19224 (1A6), P35504 (1A5), P22310 (1A4), P35503 (1A3), and P22039 (1A1). To identify template protein structures for homology modeling purposes, the retrieved UGT...”
• Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
  Uzozie, Molecular & cellular proteomics : MCP 2014
• Cooperative Regulation of Intestinal UDP-Glucuronosyltransferases 1A8, -1A9, and 1A10 by CDX2 and HNF4α Is Mediated by a Novel Composite Regulatory Element.
  Mubarokah, Molecular pharmacology 2018 (PubMed)
  • GeneRIF: studies lead to a model for the developmental patterning of UGT1A8, UGT1A9, and UGT1A10 in hepatic and/or extrahepatic tissues involving discrete regulatory modules that may function (independently and cooperatively) in a context-dependent manner
• Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
  Gramec, Xenobiotica; the fate of foreign compounds in biological systems 2015 (PubMed)
  • GeneRIF: UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
• Glucuronidation of estrone and 16α-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
  Kallionpää, The Journal of steroid biochemistry and molecular biology 2015 (PubMed)
  • GeneRIF: In further studies with UGT1A10, mutant F93G exhibited increased glucuronidation rates of 16alpha-hydroxyestrone, but not estrone
• Epigenetic regulation of the tissue-specific expression of human UDP-glucuronosyltransferase (UGT) 1A10.
  Oda, Biochemical pharmacology 2014 (PubMed)
  • GeneRIF: DNA hypermethylation results in defective expression of UGT1A10 in the liver.
• Electrochemically driven drug metabolism via a CYP1A2-UGT1A10 bienzyme confined in a graphene nano-cage.
  Lu, Chemical communications (Cambridge, England) 2014 (PubMed)
  • GeneRIF: A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method.
• Metabolic transformation of antitumor acridinone C-1305 but not C-1311 via selective cellular expression of UGT1A10 increases cytotoxic response: implications for clinical use.
  Pawlowska, Drug metabolism and disposition: the biological fate of chemicals 2013
  • GeneRIF: Suggest that extrahepatic UGT1A10 plays an important role in the metabolism and the bioactivation of the antitumor agent C-1305.
• Identification of UDP-glucuronosyltransferases responsible for the glucuronidation of darexaban, an oral factor Xa inhibitor, in human liver and intestine.
  Shiraga, Drug metabolism and disposition: the biological fate of chemicals 2012 (PubMed)
  • GeneRIF: Data suggest that darexaban glucuronidation in jejunum microsomes is mainly catalyzed by UGT1A10; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates).
• Role of human UDP-glucuronosyltransferases in the biotransformation of the triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311: highly selective substrates for UGT1A10.
  Fedejko-Kap, Drug metabolism and disposition: the biological fate of chemicals 2012
  • GeneRIF: Triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311 are glucuronidated in human liver and intestine.
• More

SAD10 / C4MF47 UDP-glucose: acyl glucosyltransferase from Avena strigosa (see paper)
37% identity, 20% coverage

XP_967924 UDP-glycosyltransferase UGT5-like from Tribolium castaneum
32% identity, 20% coverage

• Microarray analysis yields candidate markers for rotation resistance in the western corn rootworm beetle, Diabrotica virgifera virgifera
  Knolhoff, Evolutionary applications 2010
  • “...EW761417 511 C 6.07 6.83 None (no open reading frame) CN497825 742 C 6.60 5.71 XP_967924 ( S = 125, E = 2e-27) UDP-glucoronosyl and UDP-glucosyl transferase XP_967924: PREDICTED: similar to CG18578-PA ( S = 125, E = 2e-27) Contig1160 * 889 C 4.66 5.54 ACI32832...”

AAP48599.1 Glucuronosyltransferase 1.7 (EC 2.4.1.17) (see protein)
25% identity, 51% coverage

NP_995584 UDP-glucuronosyltransferase 1A6 isoform 2 from Homo sapiens
27% identity, 47% coverage

• Distribution pattern of UGT1A6 and UGT2B7 gene polymorphism and its impact on the pharmacokinetics of valproic acid and carbamazepine: Prospective genetic association study conducted in Pakistani patients with epilepsy.
  Saleh, Gene 2024 (PubMed)
  • GeneRIF: Distribution pattern of UGT1A6 and UGT2B7 gene polymorphism and its impact on the pharmacokinetics of valproic acid and carbamazepine: Prospective genetic association study conducted in Pakistani patients with epilepsy.
• The Role of RARG rs2229774, SLC28A3 rs7853758, and UGT1A6*4 rs17863783 Single-nucleotide Polymorphisms in the Doxorubicin-induced Cardiotoxicity in Solid Childhood Tumors.
  Gündüz, Journal of pediatric hematology/oncology 2024 (PubMed)
  • GeneRIF: The Role of RARG rs2229774, SLC28A3 rs7853758, and UGT1A6*4 rs17863783 Single-nucleotide Polymorphisms in the Doxorubicin-induced Cardiotoxicity in Solid Childhood Tumors.
• Molecular biology of glucose-6-phosphate dehydrogenase and UDP-glucuronosyltransferase 1A1 in the development of neonatal unconjugated hyperbilirubinemia.
  Hung, Pediatrics and neonatology 2024 (PubMed)
  • GeneRIF: Molecular biology of glucose-6-phosphate dehydrogenase and UDP-glucuronosyltransferase 1A1 in the development of neonatal unconjugated hyperbilirubinemia.
• Association of UGT1A6 gene polymorphisms with sodium valproate-induced tremor in patients with epilepsy.
  Yin, Seizure 2024 (PubMed)
  • GeneRIF: Association of UGT1A6 gene polymorphisms with sodium valproate-induced tremor in patients with epilepsy.
• Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
  Matsumoto, Molecular and cellular biochemistry 2023 (PubMed)
  • GeneRIF: Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.
• Effects of UGT1A, CYP2C9/19 and ABAT polymorphisms on plasma concentration of valproic acid in Chinese epilepsy patients.
  Zheng, Pharmacogenomics 2023 (PubMed)
  • GeneRIF: Effects of UGT1A, CYP2C9/19 and ABAT polymorphisms on plasma concentration of valproic acid in Chinese epilepsy patients.
• Impact of MDR1 and UGT Gene Polymorphisms on Sodium Valproate Plasma Concentration in Patients with Epilepsy.
  Song, Clinical laboratory 2022 (PubMed)
  • GeneRIF: Impact of MDR1 and UGT Gene Polymorphisms on Sodium Valproate Plasma Concentration in Patients with Epilepsy.
• UGT1A6 and UGT2B7 Gene Polymorphism and its Effect in Pediatric Epileptic Patients on Sodium Valproate Monotherapy.
  Nandith, Indian journal of pediatrics 2021 (PubMed)
  • GeneRIF: UGT1A6 and UGT2B7 Gene Polymorphism and its Effect in Pediatric Epileptic Patients on Sodium Valproate Monotherapy.
• More

UD19_MOUSE / Q62452 UDP-glucuronosyltransferase 1A9; UGT1A9; UDP-glucuronosyltransferase 1-7; UDPGT; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UGT1A12; UGTP4; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
NP_964006 UDP-glucuronosyltransferase 1A9 precursor from Mus musculus
25% identity, 51% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone. Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, PGB1 and F2-isoprostanes (8-iso-PGF2alpha and 5-epi- 5-F2t-IsoP). Glucuronates the phytochemical ferulic acid efficently at both the phenolic or the carboxylic acid group. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan. Also metabolizes mycophenolate, an immunosuppressive agent.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta- estradiol 4-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53040)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O- (beta-D-glucuronate) + UDP + H(+) (RHEA:53060)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer. Homooligomer. Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8 and UGT1A10 to form heterodimers.
• Circadian Clock Component Rev-erbα Regulates Diurnal Rhythm of UDP-Glucuronosyltransferase 1a9 and Drug Glucuronidation in Mice.
  Xu, Drug metabolism and disposition: the biological fate of chemicals 2020 (PubMed)
  • GeneRIF: Circadian Clock Component Rev-erbalpha Regulates Diurnal Rhythm of UDP-Glucuronosyltransferase 1a9 and Drug Glucuronidation in Mice.
• Cyp3a11-mediated testosterone-6β-hydroxylation decreased, while UGT1a9-mediated propofol O-glucuronidation increased, in mice with diabetes mellitus.
  Shi, Biopharmaceutics & drug disposition 2016 (PubMed)
  • GeneRIF: Diabetes mellitus caused a decrease in the activity of Cyp3a11-mediated testosterone-6beta-hydroxylation, but no change in the activity of Cyp3a11-mediated midazolam 1-hydroxylation and an increase in the activity of UGT1a9-mediated propofol O-glucuronidation in db/db mice
• Chronic Aroclor 1260 exposure alters the mouse liver proteome, selenoproteins, and metals in steatotic liver disease
  Piell, Environmental toxicology and pharmacology 2024 (secret)
• Tandem mass tag-based proteomics analysis of type 2 diabetes mellitus with non-alcoholic fatty liver disease in mice treated with acupuncture
  Wang, Bioscience reports 2022
  • “...synthase Fasn 0.698 0.00244 down P97311 DNA replication licensing factor MCM6 Mcm6 0.682 0.00278 down Q62452 UDP-glucuronosyltransferase 1-9 Ugt1a9 0.676 0.00134 down P10648 Glutathione S-transferase A2 Gsta2 0.674 0.000537 down P56655 Cytochrome P450 2C38 Cyp2c38 0.669 0.0061 down Q8BUE4 Apoptosis-inducing factor 2 Aifm2 0.669 0.000524 down...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology.
  Sun, BioMed research international 2021
  • “...Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion protein 1 P19320 Tar104 VEGFA Vascular endothelial growth factor A P15692 Tar105 XDH Xanthine dehydrogenase/oxidase...”
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...UDP-glucuronosyltransferase 1A1 Drugs = opioids, SN-38 (irinotecan); endogenous substrates = bilirubin, ethinylestradiol; polymorphic enzyme DOWN/UP Q62452 Ugt1a9 UDP-glucuronosyltransferase 1A9 Drugs = R-oxepam, mycophenolic acid, SN-38 (irinotecan); halogenated phenols; polymorphic enzyme DOWN P09875 Ugt2b1 UDP-glucuronosyltransferase 2B1 Drug = diclofenac ; bisphenol A (environmental chemical) UP P36511 Ugt2b15...”
• The invertebrate Caenorhabditis elegans biosynthesizes ascorbate
  Patananan, Archives of biochemistry and biophysics 2015
  • “...67% 0 Yes UDP-glucose dehydrogenase * O70475 UDP-glucoseUDP-glucuronate F29F11.1 * 66% 0 Yes UDP-glucuronosyltransferase * Q62452 UDP-glucuronateacceptor-beta-D-glucuronoside C08F11.8 *** 27% 710 56 2 nd -glucuronidase ** P12265 a beta-D-glucuronosideD-glucuronate Y105E8B.9 **** 40% 9310 154 Yes Glucuronate reductase ** Q540D7 D-glucuronateL-gulonate Y39G8B.1 **** 47% 410 97 2...”
• Proteomic analysis of Nrf2 deficient transgenic mice reveals cellular defence and lipid metabolism as primary Nrf2-dependent pathways in the liver.
  Kitteringham, Journal of proteomics 2010
  • “...0.58 0.80 0.72 0.021 O70475 UDP-glucose 6-dehydrogenase 1.09 0.97 1.23 0.79 0.63 0.99 0.73 0.183 Q62452 UDP-glucuronosyltransferase 1-9 0.99 0.93 1.06 0.73 0.58 0.92 0.74 0.183 Q91VA0 Acyl-coenzyme A synthetase ACSM1, mitochondrial 0.97 0.91 1.04 0.79 0.74 0.84 0.81 0.001 Q64442 Sorbitol dehydrogenase 1.02 0.92 1.13...”

CAA76552.1 UDP-Glc: balhimycin aglycone Hpg-glucosyltransferase B (BgtfB) (EC 2.4.1.-) (see protein)
35% identity, 29% coverage

NP_787040 UDP-glucuronosyltransferase 1A8 precursor from Rattus norvegicus
25% identity, 54% coverage

• Analysis of substrate specificities and tissue expression of rat UDP-glucuronosyltransferases UGT1A7 and UGT1A8.
  Webb, Drug metabolism and disposition: the biological fate of chemicals 2005 (PubMed)
  • GeneRIF: Studies of their activities and tissue expression suggest complementary functions of UGT1A8 and UGT1A7 isoforms in xenobiotic metabolism.

LOAG_03428 UDP-glucoronosyl and UDP-glucosyl transferase from Loa loa
28% identity, 35% coverage

• Intestinal UDP-glucuronosyltransferase as a potential target for the treatment and prevention of lymphatic filariasis
  Flynn, PLoS neglected tropical diseases 2019
  • “...identified in WormBase Parasite: Brugia timori (BTMF_0001026401), Wuchereria bancrofti (WBA_0000030501), Brugia pahangi (BPAG_0000208101), Loa loa (LOAG_03428), Dirofilaria immitis (nDi.2.2.2.t06727), Litomosoides sigmodontis (nLs.2.1.2.t00666-RA), Ancylostoma caninum (ANCCAN_05977), Anyclostoma duodenale (ANCDUO_14383), Dictyocaulus viviparous (NDV.1.0.1.g111112), Haemonchus contortus (HCON_00121250), Heligmosomoides polygyrus (HPOL_0001615101), Nippostrongylus brasiliensis (NBR_0001252501), Caenorhabditis elegans (Y37E11AR), Strongyloides ratti (SRAE_2000477000),...”

XP_001638304 UDP-glucuronosyltransferase 2A3 isoform X2 from Nematostella vectensis
29% identity, 36% coverage

• Coral-zooxanthellae meta-transcriptomics reveals integrated response to pollutant stress
  Gust, BMC genomics 2014
  • “...increased expression of potential detoxification mechanisms (i.e. cytochrome P450, XP_001624662, and UDP glucuronosyltransferase 2 family, XP_001638304, Figure 5 ). Carbohydrate metabolism was the most represented second order KEGG term in the 0.5mg/L treatment. All transcripts involved in carbohydrate metabolism had increased expression (Additional file 2 :...”

OGT2_PHACM / A0A0G2EC47 UDP-glycosyltransferase 2; O-galactosyltransferase 2; OGT2; EC 2.4.1.- from Phaeomoniella chlamydospora (Phaeoacremonium chlamydosporum) (see paper)
24% identity, 37% coverage

• function: Catalyzes the second glycosylation step during phaeomoniecin D biosynthesis, the further O-galactosylation of exophillic acid (produced by the O-glycosyltransferase OGT1) to yield the 4-O-beta-D- galactoside phaeomoniecin D.
  catalytic activity: exophillate + UDP-alpha-D-galactose = phaeomoniecin D + UDP + H(+) (RHEA:82203)

ABB29873.1 UDP-Glc: solanidine glucosyltransferase (Sgt2.1) (EC 2.4.1.-) (see protein)
34% identity, 23% coverage

AAL67851.1 Glucuronosyltransferase 1.8 (EC 2.4.1.17) (see protein)
25% identity, 54% coverage

AAB58353.1 UDP-Glc: ecdysteroid glucosyltransferase (Egt;Orf124) (EC 2.4.1.-) (see protein)
31% identity, 26% coverage

Q9XYN3 UDP-glucuronosyltransferase from Drosophila melanogaster
28% identity, 21% coverage

• A First Glimpse of the Mexican Fruit Fly Anastrepha ludens (Diptera: Tephritidae) Antenna Morphology and Proteome in Response to a Proteinaceous Attractant
  Ruiz-May, International journal of molecular sciences 2020
  • “...upregulated: cytochrome Cyp4p1 (Q9V558), Cyp4e1 (Q9V4T5), Cypr (Q8IPJ7), GstO1 (Q9VSL6), AOX3 (Q9VF51), and UDP-glucuronosyltransferase (Ugt35b, Q9XYN3). Furthermore, the Cyp6a9 (Q27594), thioester-containing protein 4 (Tep4, M9PD73), AOX1 (Q9VF53), and GstE9 (Q7K8X7), in the group III, were also upregulated in sexually mature females (24h_15D). Mature male flies treated...”

LOC413043 UDP-glucuronosyltransferase 1-3 from Apis mellifera
29% identity, 21% coverage

• Identification of Multiple Loci Associated with Social Parasitism in Honeybees
  Wallberg, PLoS genetics 2016 (no snippet)
• Developmental regulation of ecdysone receptor (EcR) and EcR-controlled gene expression during pharate-adult development of honeybees (Apis mellifera)
  Mello, Frontiers in genetics 2014
  • “...a common function related to ecdysteroid metabolism (Iida et al., 2007 ). The products of LOC413043 and LOC725997 may regulate ecdysteroid titer and function since the enzymes encoded by these genes catalyze the transfer of glucose from UDP-glucose to ecdysteroids, and thus are possibly related to...”

ATG26_YEAST / Q06321 Sterol 3-beta-glucosyltransferase; Autophagy-related protein 26; UDP-glycosyltransferase 51; EC 2.4.1.-; EC 2.4.1.173 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
Q06321 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Saccharomyces cerevisiae (see 5 papers)
AAB67475.1 UDP-Glc: sterol glucosyltransferase (Atg26;YLR189c;UGT51) (EC 2.4.1.173) (see protein)
NP_013290 sterol 3-beta-glucosyltransferase from Saccharomyces cerevisiae S288C
YLR189C Atg26p from Saccharomyces cerevisiae
22% identity, 32% coverage

• function: Sterol glycosyltransferase responsible for the glycosylation of ergosterol to form ergosterol-glucoside (PubMed:10224056, PubMed:30395931). Also shows activity in vitro on other sterols such as cholesterol, beta-sitosterol, stigmasterol and tomatidine (PubMed:10224056). In contrasts to what is observed in Pichia pastoris and Aspergillus oryzae, is not involved in cytoplasm to vacuole transport (Cvt), pexophagy or nonselective autophagy in Saccharomyces cerevisiae (PubMed:17012830).
  catalytic activity: a sterol + UDP-alpha-D-glucose = a sterol 3-beta-D-glucoside + UDP + H(+) (RHEA:22724)
  catalytic activity: ergosterol + UDP-alpha-D-glucose = ergosteryl 3-beta-D- glucoside + UDP + H(+) (RHEA:61836)
• Insight into vital role of autophagy in sustaining biological control potential of fungal pathogens against pest insects and nematodes
  Ying, Virulence 2019
  • “...OAA71568 OAA64158 EFY91127 KJK79963 EFY99206 OAA40571 OAA63756 EGX43379 KJZ78598 25 ESW97416 26 ESW96191 ANZ76118 CAY71393 Q06321 KZZ90874 KZZ92672 EJP71037 OAA45995 ATY62412 OAA73722 OAA81945 EFY86996 KJK79229 EFY97936 OAA36440 OAA59786 EGX51249 KJZ73456 27 ESW97460 ANZ75892 CAY69817 P46989 KZZ98281 KZZ88672 EJP63614 OAA44065 EGX88907 OAA52851 OAA76046 EFY88154 KJK81470 EFZ02138 OAA41305...”
• Enfumafungin synthase represents a novel lineage of fungal triterpene cyclases
  Kuhnert, Environmental microbiology 2018
  • “...GTs are nested between a cluster containing a functionally characterized sterol GT of Saccharomyces cerevisiae (Q06321) ( Warnecke et al ., 1999 ) and various clades with GTs that show homology to the latter. These data imply that the enfumafungin GT is derived from a sterol...”
• Ordered Coimmobilization of Multimeric Enzyme Arrays with Enhanced Biocatalytic Cascade Performance.
  Ali, ACS applied bio materials 2021 (PubMed)
  • GeneRIF: Ordered Coimmobilization of Multimeric Enzyme Arrays with Enhanced Biocatalytic Cascade Performance.
• Structural dissection of sterol glycosyltransferase UGT51 from Saccharomyces cerevisiae for substrate specificity.
  Chen, Journal of structural biology 2018 (PubMed)
  • GeneRIF: The structural analysis indicate that a long hydrophobic cavity, 9.2A in width and 17.6A in length located at the N-terminal domain of sterol glycosyltransferase UGT51, is suitable for the accommodation of sterol acceptor substrates.
• Functional diversification of two UGT80 enzymes required for steryl glucoside synthesis in Arabidopsis
  Stucky, Journal of experimental botany 2015
  • “...confirmed by sequencing the isolated plasmids. Yeast UGT51 deletion Yeast ( S. cerevisiae ) strain YLR189C (Thermo Scientific USA) contains a KanMX cassette replacing the native UGT51 ( UGT51A1 ) ORF. Genomic DNA was isolated from YLR189C and the KanMX cassette was amplified with primers flanking...”
• High-throughput biochemical fingerprinting of Saccharomyces cerevisiae by Fourier transform infrared spectroscopy
  Kohler, PloS one 2015
  • “..., 2 YLR133W CKI1 26 YDR018C YDR018C 67 WT WT BY4743 27 YDR072C IPT1 68 YLR189C ATG26 28 YDR147W EKI1 69 1 YLR228C ECM22 29 YDR213W UPC2 70 YML059C NTE1 30 2 WT WT BY4743 71 YML008C ERG6 31 1 , 2 YDR294C DPL1 72 1...”
• Autophagy contributes to regulation of nuclear dynamics during vegetative growth and hyphal fusion in Fusarium oxysporum
  Corral-Ramos, Autophagy 2015
  • “...YFR021W YOL082W YDL113C YPL100W YCL038C YLR431C YJL036W YLR189C YJL178C XP_001821228 b YPL166W CCA39286 YDR022C YIL146C YLR356W YOL083W C4QVX6 YJL185C C4R8D7...”
• Widespread reorganization of metabolic enzymes into reversible assemblies upon nutrient starvation
  Narayanaswamy, Proceedings of the National Academy of Sciences of the United States of America 2009
  • “...YNL209W YOR027W YIL078W YDR074W YGR019W YKL035W YLR189C YJL130C YGR094W Purine nucleotide biosynthesis Purine nucleotide biosynthesis Purine nucleotide...”
• Cloning and functional expression of UGT genes encoding sterol glucosyltransferases from Saccharomyces cerevisiae, Candida albicans, Pichia pastoris, and Dictyostelium discoideum
  Warnecke, The Journal of biological chemistry 1999 (PubMed)
  • “...These genes from Saccharomyces cerevisiae (UGT51 5 YLR189C), Pichia pastoris (UGT51B1), Candida albicans (UGT51C1), and Dictyostelium discoideum (ugt52) were...”
  • “...P. pastoris, and D. discoideum TM S. cerevisiae--UGT51 (YLR189C, GenBank accession number U17246) is a gene located on chromosome XII of S. cerevisiae. We...”

Q64634 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 3 papers)
25% identity, 54% coverage

UGT94E5 / F8WKW8 crocetin glucosyl ester glucosyltransferase (EC 2.4.1.330) from Gardenia jasminoides (see paper)
UGT9_GARJA / F8WKW8 Beta-D-glucosyl crocetin beta-1,6-glucosyltransferase; UDP-glucose glucosyltransferase 9; GjUGT9; UDP-glycosyltransferase 94E5; EC 2.4.1.330 from Gardenia jasminoides (Cape jasmine) (Gardenia augusta) (see paper)
F8WKW8 beta-D-glucosyl crocetin beta-1,6-glucosyltransferase (EC 2.4.1.330) from Gardenia jasminoides (see 2 papers)
24% identity, 76% coverage

• function: Glucosyltransferase catalyzing the beta 1-6 glucosylation of the sugar moiety of crocetin glucosyl esters to produce crocetin gentiobiosyl esters. Weak activity toward curcumin glucosides, but no activity with flavonoid glucosides, coumarin glucosides, 4-nitrophenyl glucoside or crocetin. Involved with UGT75L6 in sequential glycosylation of crocetin to crocin (bis(beta-D-gentiobiosyl) crocetin).
  catalytic activity: beta-D-glucosyl crocetin + UDP-alpha-D-glucose = beta-D- gentiobiosyl crocetin + UDP + H(+) (RHEA:42388)
  catalytic activity: bis(beta-D-glucosyl) crocetin + UDP-alpha-D-glucose = beta-D- gentiobiosyl beta-D-glucosyl crocetin + UDP + H(+) (RHEA:30899)
  catalytic activity: beta-D-gentiobiosyl beta-D-glucosyl crocetin + UDP-alpha-D- glucose = bis(beta-D-gentiobiosyl) crocetin + UDP + H(+) (RHEA:38859)
• Complete microbial synthesis of crocetin and crocins from glycerol in Escherichia coli
  Lee, Microbial cell factories 2024
  • “...were investigated using the query amino acid sequence of UGT94E5 (named GjUGT9, GenBank accession number F8WKW8) from G. jasminoides . Three putative UGT-2 amino acid sequences were retrieved: SpUGT(GenBank accession number XP_015057190.1), NsUGT (XP_009793442.1), and CaUGT3 (C5NN14). We used the neighbor-joining method to infer the evolutionary...”
• Prospects and progress on crocin biosynthetic pathway and metabolic engineering
  Liu, Computational and structural biotechnology journal 2020
  • “...MF596166 subcellular localization, transcripts analysis, expression analysis, in vitro functional assays [43] GjUGT75L6 Gardenia jasminoides F8WKW8 expression analysis, bioinformatics analysis, in vitro functional assays [51] GjUGT94E5 Gardenia jasminoides F8WKW0 expression analysis, bioinformatics analysis, in vitro functional assays [51] GjUGT74F8 Gardenia jasminoides MN944054 Genome-wide analysis, bioinformatics analysis,...”

Q6BN88 sterol 3beta-glucosyltransferase (EC 2.4.1.173) from Debaryomyces hansenii (see paper)
22% identity, 24% coverage

M3WVI1 UDP glycosyltransferase 8 from Felis catus
29% identity, 24% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5 Modulation of gGlcT1 activity influences CWP synthesis and ESV biogenesis....”

XP_545033 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Canis lupus familiaris
29% identity, 24% coverage

• Ceramide galactosyltransferase (UGT8) as a molecular marker of canine mammary tumor malignancy.
  Nowak, Folia histochemica et cytobiologica 2013 (PubMed)
  • GeneRIF: The authors propose that UGT8 is associated with malignancy of canine mammary gland cells and may have a potential value as a diagnostic marker.

CGT_TALAM / A0A364KRL8 UDP-glycosyltransferase; 3-C-glucosyltransferase; CGT; EC 2.4.1.- from Talaromyces amestolkiae (see paper)
31% identity, 20% coverage

• function: UDP-glycosyltransferase; part of the gene cluster that mediates the biosynthesis of stromemycin, a depside C-glucoside with two unsaturated C9 side chains belonging to aromatic polyketide glycosides (PubMed:38545685). Acts as the tailoring enzyme responsible for 3-C-glucosylation of bininalkenylresorcylic acid to yield stromemycin (PubMed:38545685).
  catalytic activity: stromemycin aglycone + UDP-alpha-D-glucose = stromemycin + UDP + H(+) (RHEA:81995)

NP_958826 UDP-glucuronosyltransferase 1-2 precursor from Rattus norvegicus
27% identity, 35% coverage

• Transcriptional enhancement of UDP-glucuronosyltransferase form 1A2 (UGT1A2) by nuclear factor I-A (NFI-A) in rat hepatocytes.
  Emi, Journal of biochemistry 2005 (PubMed)
  • GeneRIF: Data suggest that activation of UDP-glucuronosyltransferase 1A2 (UGT1A2) by nuclear factor I (NFI)-A1 is suppressed by NFI-C1 in the liver, and culture-associated expression of UGT1A2 is triggered by disappearance of NFI-C1 in cultured hepatocytes.

AAM81359.1 UDP-Glc: sterol glycosyltransferase (Ugt51;Ugt51E1) (EC 2.4.1.173) (see protein)
24% identity, 10% coverage

AAL67853.1 Glucuronosyltransferase 1A6 (Ugt1a6) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

P41713 Ecdysteroid UDP-glucosyltransferase from Lymantria dispar multicapsid nuclear polyhedrosis virus
38% identity, 17% coverage

• The Factor I and follistatin domain families: the return of a prodigal son
  Ullman, The Biochemical journal 1997
  • “...P23765 P54855 Y08294 X85138 P41713 U41999 X77459 X77462 X92122 D87867 Downloaded from...”
• A classification of nucleotide-diphospho-sugar glycosyltransferases based on amino acid sequence similarities
  Campbell, The Biochemical journal 1997
  • “...P23765 P54855 Y08294 X85138 P41713 U41999 X77459 X77462 X92122 D87867 Downloaded from...”

NP_001034780 UDP-glucuronosyltransferase 1-6 precursor from Rattus norvegicus
Q6T5E9 UDP-glucuronosyltransferase from Rattus norvegicus
27% identity, 35% coverage

• Bile duct ligation elevates 5-HT levels in cerebral cortex of rats partly due to impairment of brain UGT1A6 expression and activity via ammonia accumulation.
  Yang, Redox biology 2024
  • GeneRIF: Bile duct ligation elevates 5-HT levels in cerebral cortex of rats partly due to impairment of brain UGT1A6 expression and activity via ammonia accumulation.
• Effect of status epilepticus on expression of brain UDP-glucuronosyltransferase 1a in rats.
  Asai, Biopharmaceutics & drug disposition 2018 (PubMed)
  • GeneRIF: study indicated that Status Epilepticus altered the expression of brain Ugt1a1 and Ugt1a7, which could alter glucuronidation in the brain.
• Effects of β-Naphthoflavone on Ugt1a6 and Ugt1a7 Expression in Rat Brain.
  Sakakibara, Biological & pharmaceutical bulletin 2016 (PubMed)
  • GeneRIF: This study clarified that Ugt1a6 and Ugt1a7 mRNA expression and their enzyme activities were altered by beta-naphthoflavone, suggesting that these changes may lead to alteration in the pharmacokinetics of UGT substrate in rat brain.
• Effect of adrenalectomy on expression and induction of UDP-glucuronosyltransferase 1A6 and 1A7 in rats.
  Sakakibara, Biological & pharmaceutical bulletin 2014 (PubMed)
  • GeneRIF: results indicate that adrenal-dependent factors such as glucocorticoids are partially involved in the basal regulation of UGT1A6 and UGT1A7 transcription.
• Effect of oxidative stress on UDP-glucuronosyltransferases in rat astrocytes.
  Gradinaru, Toxicology letters 2012 (PubMed)
  • GeneRIF: Catalytic properties/expression of UGT1A6/7 are influenced by the pro-oxidant environment in astrocytes.
• Drug metabolizing enzyme expression in rat choroid plexus: effects of in vivo xenobiotics treatment.
  Gradinaru, Archives of toxicology 2009 (PubMed)
  • GeneRIF: We present for the first time evidences that the choroids plexus express transcripts for both UGT1A6 and NADPH-cytochrome P450 reductase
• Vitamin A modulates the effects of thyroid hormone on UDP-glucuronosyltransferase expression and activity in rat liver.
  Haberkorn, Molecular and cellular endocrinology 2002 (PubMed)
  • GeneRIF: Data suggest that thyroid hormones and vitamin A are co-regulators of UDP-glucuronosyltransferase (UGT) 1 expression, without affecting the UGT2 family.
• Effects on extrahepatic UDP-glucuronosyltransferases in hypophysectomized rat.
  Yokota, Journal of biochemistry 2002 (PubMed)
  • GeneRIF: These results indicate that the expression of extrahepatic UDP-glucuronosyltransferases UGT1a1 and UGT1a6 is isoform-specific and regulated differentially in tissues by the pituitary gland.
• More
• High throughput metabolomics-proteomics investigation on metabolic phenotype changes in rats caused by Radix Scrophulariae using ultra-performance liquid chromatography with mass spectrometry.
  Lu, RSC advances 2019
  • “...Olr796 Olfactory receptor 1.5880 Up* 0.0484 L70 D3ZMQ0 Mga Protein Mga 1.6374 Up* 0.0312 L71 Q6T5E9 Ugt1a6 UDP-glucuronosyltransferase 1.7279 Up** 0.0003 L72 A1XF83 Ugt2b UDP-glucuronosyltransferase 1.8256 Up** 0.0001 L73 D3ZXC8 Ebpl Emopamil binding protein-like (predicted), isoform CRA_a 1.8324 Up** 0.0018 L74 F1LM22 Ugt2b UDP-glucuronosyltransferase 1.8894 Up**...”

AAC70311.1 UDP-Glc: ecdysteroid β-glucosyltransferase (Egt;UGT21A4;LdnVgp126) (EC 2.4.1.-) (see protein)
NP_047762 ecdysteroid UDP-glucosyltransferase from Lymantria dispar multiple nucleopolyhedrovirus
38% identity, 16% coverage

• A gene for an extended phenotype.
  Hoover, Science (New York, N.Y.) 2011 (PubMed)
  • GeneRIF: the viral gene (uridine 5'-diphosphate (UDP)-glucosyltransferase) that manipulates climbing behavior of the Gypsy moth host was identified, providing evidence of a genetic basis for the extended phenotype

UD17_MOUSE / Q6ZQM8 UDP-glucuronosyltransferase 1A7; UGT1A7; UDP-glucuronosyltransferase 1-7C; UDPGT 1-7C; UGT1*7C; UGT1-07C; UGT1.7C; UDP-glucuronosyltransferase 1A7C; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
25% identity, 43% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormone epiestradiol. Involved in the glucuronidation of F2-isoprostane (5-epi-5-F2t-IsoP). Involved in the glucuronidation of the phytochemical ferulic acid at the carboxylic acid group. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10- hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan. Also metabolizes mycophenolate, an immunosuppressive agent.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D- glucuronide + UDP (RHEA:63612)
  catalytic activity: 5-epi-5-F2t-IsoP + UDP-alpha-D-glucuronate = 5-epi-5-F2t-IsoP- glucuronide + UDP + H(+) (RHEA:79911)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  catalytic activity: candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D- glucuronoside + UDP (RHEA:63724)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: mycophenolate + UDP-alpha-D-glucuronate = mycophenolate 7-O- beta-D-glucuronide + UDP + H(+) (RHEA:63704)
  subunit: Homodimer. Homooligomer. Interacts with UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide pool in PC tissue....”
• Proteomic Analysis Identifies Multiple Mechanisms of 5-Fluorouracil-Induced Gut Mucositis in Mice.
  Ivanov, Cancers 2024
  • “...Aldh1a1 2.2 Sulfide:quinone oxidoreductase, mitochondrial Q9R112 Sqor 5.2 UDP-glucose 6-dehydrogenase O70475 Ugdh 12.5 UDP-glucuronosyltransferase 1-7C Q6ZQM8 Ugt1a7 2.4 Proteins up-regulated in the ileum 4-aminobutyrate aminotransferase, mitochondrial P61922 Abat 4.7 Amiloride-sensitive amine oxidase [copper-containing] Q8JZQ5 Aoc1 7.8 Glucose-6-phosphate isomerase P06745 Gpi 12.0 Glutathione peroxidase 1 P11352 Gpx1...”
• Integrated transcriptomic and proteomic analyses uncover regulatory roles of Nrf2 in the kidney.
  Shelton, Kidney international 2015
  • “...03 Q148B6 N.D. N.D. N.D. N.D. Ugt1a10 446962 NM_201641 0.58 9.04 04 1.45 2.12 02 Q6ZQM8 0.25 6.18 05 1.09 5.50 01...”
• Characterization of the proteome of cytoplasmic lipid droplets in mouse enterocytes after a dietary fat challenge.
  D'Aquila, PloS one 2015
  • “...46 ] 19.562 Sulfotransferase family cytosolic 1B member 1 Sult1b1 Q9QWG7 21.097 UDP-glucuronosyltransferase 1-7C Ugt1a7c Q6ZQM8 18.177 Transitional endoplasmic reticulum ATPase Vcp Q8BNF8 [ 45 47 ] Thirty seven proteins associated with known lipid metabolism pathways were identified, of which twenty three proteins have been previously...”

AAR95632.1 Glucuronosyltransferase 1.3 (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

AAL67850.1 Glucuronosyltransferase 1.5 (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

PSPA7_1648 rhamnosyltransferase chain B from Pseudomonas aeruginosa PA7
22% identity, 77% coverage

• Complete genome sequence of the multiresistant taxonomic outlier Pseudomonas aeruginosa PA7
  Roy, PloS one 2010
  • “...encoding phospholipase D and the rhlC gene for rhamnolipid biosynthesis. However, rhlA (PSPA7_1647) and rhlB (PSPA7_1648) genes are present. PA7 is similar to PAO1 and PA14 for most other factors identified in the Virulence Factor Database [27] . The 24 genes for synthesis and regulation of...”

UD16_MOUSE / Q64435 UDP-glucuronosyltransferase 1A6; UGT1A6; Phenol UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UGP1A1; UGT1A7; EC 2.4.1.17 from Mus musculus (Mouse) (see 2 papers)
Q64435 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
AAA65979.1 glucuronosyltransferase 1.6 (Ugt1a6;UGT1*06;UGT1A1) (EC 2.4.1.17) (see protein)
NP_659545 UDP-glucuronosyltransferase 1-6 precursor from Mus musculus
27% identity, 35% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:8068691). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:8068691). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE and 20-HETE (By similarity). Conjugates small planar phenolic molecules such as 4- nitrophenol, 1-naphthol, and 4-methylumbelliferone. The bulky phenol 4- hydroxybiphenyl, androgens and estrogens are not substrates. 2- hydroxybiphenyl is an excellent substrate (PubMed:8068691). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
• Arsenic modifies serotonin metabolism through glucuronidation in pancreatic β-cells
  Carmean, American journal of physiology. Endocrinology and metabolism 2019
  • GeneRIF: This study provides evidence that UGT1A6A, acting on the serotonin pathway, regulates glucose induced insulin secretion under both normal and pathological conditions.
• Comparison of serotonin glucuronidation activity of UDP-glucuronosyltransferase 1a6a (Ugt1a6a) and Ugt1a6b: evidence for the preferential expression of Ugt1a6a in the mouse brain.
  Uchihashi, Drug metabolism and pharmacokinetics 2013 (PubMed)
  • GeneRIF: the difference in expression levels between Ugt1a6a and Ugt1a6b in the hippocampus led us to speculate that Ugt1a6a is likely the predominant catalyst of serotonin glucuronidation in the mouse brain.
• Comparative Analysis of the Total Proteome in Nonalcoholic Steatohepatitis: Identification of Potential Biomarkers
  Ates, Molecular & cellular proteomics : MCP 2025
  • “...Tropomyosin alpha-4 chain 13 56 2.014 P40124 Cap1 Adenylyl cyclase-associated protein 1 12 47 2 Q64435 Ugt1a6 UDP-glucuronosyltransferase 16 13 31 0.494 Q78JT3 Haao 3-hydroxyanthranilate 3,4-dioxygenase 14 57 0.49 Q9DBG1 Cyp27a1 Sterol 26-hydroxylase, mitochondrial 15 37 0.456 Q91VA0 Acsm1 Acyl-coenzyme A synthetase ACSM1, mitochondrial 21 52...”
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...activity was increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide pool in...”
• Interpreting the Molecular Mechanisms of Yinchenhao Decoction on Hepatocellular Carcinoma through Absorbed Components Based on Network Pharmacology.
  Sun, BioMed research international 2021
  • “...P22309 Tar095 UGT1A10 UDP-glucuronosyltransferase 1A10 Q9HAW8 Tar096 UGT1A3 UDP-glucuronosyltransferase 1A3 P35503 Tar097 UGT1A6 UDP-glucuronosyltransferase 1-6 Q64435 Tar098 UGT1A7 UDP-glucuronosyltransferase 1A7 Q9HAW7 Tar099 UGT1A8 UDP-glucuronosyltransferase 1A8 Q9HAW9 Tar100 UGT1A9 UDP-glucuronosyltransferase 1A9 Q62452 Tar101 UGT2B15 UDP-glucuronosyltransferase 2B15 P54855 Tar102 UGT2B17 UDP-glucuronosyltransferase 2B17 O75795 Tar103 VCAM1 Vascular cell adhesion...”
• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...3A13 Q3UW87 - 0.4 0.0121 0.0279 UDP-glucuronosyltransferase 1-1 Q63886 - 1.2 0.0420 0.0185 UDP-glucuronosyltransferase 1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172 0.0126 UDP-glucuronosyltransferase Q8R084 - 3.5 0.0118 0.0119...”
• Reduced mitochondrial mass and function add to age-related susceptibility toward diet-induced fatty liver in C57BL/6J mice.
  Lohr, Physiological reports 2016
• Proteomic analysis reveals down-regulation of surfactant protein B in murine type II pneumocytes infected with influenza A virus.
  Kebaabetswe, Virology 2015
  • “...Polysaccharides Metabolism Q8C166 Copine I 11 0.67 (0.029) P50405 Surfactant-associated protein B 8 0.37 (<0.001) Q64435 UDP glucuronosyltransferase 16 6 0.78 (0.05) Q80UM7 Mannosyl-oligosaccharide glucosidase 2 * (0.014) Other Metabolism P22437 Prostaglandin-endoperoxide synthase 1 2 0.44 (0.007) Miscellaneous Transmembrane Q9DBS1 Transmembrane protein 43 11 0.77 (0.037)...”

P20720 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
27% identity, 35% coverage

• Genetic resources of narrow-leaved lupine (Lupinus angustifolius L.) and their role in its domestication and breeding.
  Vishnyakova, Vavilovskii zhurnal genetiki i selektsii 2021
  • “...et al., 2012a) classifying accessions according to their domestication status and origin. The designated accessions (P20720, P22872, P26167, P26562, P26603, P26668, P27221, and P28221) were used in enriching BC2 crosses with cv. Mandelup (from Berger et al., 2013). Methods for identifying differentiation in the gene pool...”
• Exploring the genetic and adaptive diversity of a pan-Mediterranean crop wild relative: narrow-leafed lupin.
  Mousavi-Derazmahalleh, TAG. Theoretical and applied genetics. Theoretische und angewandte Genetik 2018
  • “...accessions from Italy and one accession from Greece that fell within the western clusters (Accessions P20720, P20724, P25040, P25051, P25052, P26107, P26109 and P26991). Investigating historic population bottlenecks To explore further how genomic diversity differs between the distinct eastern and western Mediterranean population groups and to...”

AAA42312.1 Glucuronosyltransferase 1A2 (Ugt1a2) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

NP_569091 UDP-glucuronosyltransferase 1A7 precursor from Rattus norvegicus
27% identity, 35% coverage

• Effect of adrenalectomy on expression and induction of UDP-glucuronosyltransferase 1A6 and 1A7 in rats.
  Sakakibara, Biological & pharmaceutical bulletin 2014 (PubMed)
  • GeneRIF: results indicate that adrenal-dependent factors such as glucocorticoids are partially involved in the basal regulation of UGT1A6 and UGT1A7 transcription.
• Effect of oxidative stress on UDP-glucuronosyltransferases in rat astrocytes.
  Gradinaru, Toxicology letters 2012 (PubMed)
  • GeneRIF: Catalytic properties/expression of UGT1A6/7 are influenced by the pro-oxidant environment in astrocytes.
• Analysis of substrate specificities and tissue expression of rat UDP-glucuronosyltransferases UGT1A7 and UGT1A8.
  Webb, Drug metabolism and disposition: the biological fate of chemicals 2005 (PubMed)
  • GeneRIF: Studies of their activities and tissue expression suggest complementary functions of UGT1A7 and UGT1A8 isoforms in xenobiotic metabolism.

CCG85331.1 UDP-Glc: flavonol-3-O-glucoside β-1,2-glucosyltransferase (Ugt707b1) (EC 2.4.1.-) (see protein)
34% identity, 20% coverage

AAH78732.1 Glucuronosyltransferase 1.7 (EC 2.4.1.17) (see protein)
27% identity, 34% coverage

UD11_RAT / Q64550 UDP-glucuronosyltransferase 1A1; UGT1A1; B1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; EC 2.4.1.17 from Rattus norvegicus (Rat) (see paper)
Q64550 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 4 papers)
AAC52219.1 glucuronosyltransferase 1.1 (Ugt1a1;Ugt1.1) (EC 2.4.1.17) (see protein)
NP_036815 UDP-glucuronosyltransferase 1A1 precursor from Rattus norvegicus
27% identity, 34% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:8554318). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:8554318). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (By similarity). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (By similarity). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2- isoprostane (8-iso-PGF2alpha). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (By similarity). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (By similarity). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (By similarity). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (By similarity).
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimers. Homooligomer. Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Effect of status epilepticus on expression of brain UDP-glucuronosyltransferase 1a in rats.
  Asai, Biopharmaceutics & drug disposition 2018 (PubMed)
  • GeneRIF: study indicated that Status Epilepticus altered the expression of brain Ugt1a1 and Ugt1a7, which could alter glucuronidation in the brain.
• Disturbance of Mammary UDP-Glucuronosyltransferase Represses Estrogen Metabolism and Exacerbates Experimental Breast Cancer.
  Zhou, Journal of pharmaceutical sciences 2017 (PubMed)
  • GeneRIF: UGT1A1 controls estrogen metabolism.
• Enhanced phase II detoxification contributes to beneficial effects of dietary restriction as revealed by multi-platform metabolomics studies.
  Wen, Molecular & cellular proteomics : MCP 2013
  • GeneRIF: Data indicate that the up-regulation of phase II detoxification in the DR group was confirmed by mRNA and protein expression levels of uridinediphospho-glucuronosyltransferase and glycine-N-acyltransferase in actual liver tissues.
• CYP450-dependent biotransformation of the insecticide fipronil into fipronil sulfone can mediate fipronil-induced thyroid disruption in rats.
  Roques, Toxicological sciences : an official journal of the Society of Toxicology 2012 (PubMed)
  • GeneRIF: Both fipronil and fipronil sulfone treatments induced a 2.5-fold increase in Ugt1a1 and Sult1b1 messenger RNA (mRNA) expressions.
• Ontogenic isoform switching of UDP-glucuronosyltransferase family 1 in rat liver.
  Kishi, Biochemical and biophysical research communications 2008 (PubMed)
  • GeneRIF: Developmental stage-specific switching of regulation of the rat UGT1 gene complex was found.
• Induction of UDP-glucuronosyltransferase 1 (UDP-GT1) gene complex by green tea in male F344 rats.
  Embola, Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2002 (PubMed)
  • GeneRIF: UDP-glucuronosyltransferase (UDP-GT) activities towards p-nitrophenol were markedly increased in rats that consumed tea.Induction of UDP-glucuronosyltransferase activity by tea may involve the UDP-GT1 (UGT1A) gene complex of the UDP-GT multigene family
• Vitamin A modulates the effects of thyroid hormone on UDP-glucuronosyltransferase expression and activity in rat liver.
  Haberkorn, Molecular and cellular endocrinology 2002 (PubMed)
  • GeneRIF: Data suggest that thyroid hormones and vitamin A are co-regulators of UDP-glucuronosyltransferase (UGT) 1 expression, without affecting the UGT2 family
• Effects on extrahepatic UDP-glucuronosyltransferases in hypophysectomized rat.
  Yokota, Journal of biochemistry 2002 (PubMed)
  • GeneRIF: These results indicate that the expression of extrahepatic UDP-glucuronosyltransferases UGT1a1 and UGT1a6 is isoform-specific and regulated differentially in tissues by the pituitary gland.
• More
• Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
  Chen, PloS one 2022
  • “...Retinol metabolic process 0.832 0.0024 Sdhd Q6PCT8 Succinate dehydrogenase [ubiquinone] Carbohydrate metabolism 0.797 0.0424 Ugt1a1 Q64550 UDP-glucuronosyltransferase 11 Glycosyltransferase 0.722 0 Ugt1a5 Q64638 UDP-glucuronosyltransferase 15 Glycosyltransferase 0.694 0.0246 Ugt2b7 Q62789 UDP-glucuronosyltransferase 2B7 Lipid metabolism 0.623 0.0038 As shown in Table 1 , all impact values of...”
• Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
  Ayyar, Journal of proteomics 2017
  • “...MPL-regulated Phase-II enzymes related to drug/xenobiotic/endogenous substrate metabolism. UProt_ID Gene Name Protein Name Function Regulation Q64550 Ugt1a1 UDP-glucuronosyltransferase 1A1 Drugs = opioids, SN-38 (irinotecan); endogenous substrates = bilirubin, ethinylestradiol; polymorphic enzyme DOWN/UP Q62452 Ugt1a9 UDP-glucuronosyltransferase 1A9 Drugs = R-oxepam, mycophenolic acid, SN-38 (irinotecan); halogenated phenols; polymorphic...”
• Improved detection of quantitative differences using a combination of spectral counting and MS/MS total ion current
  Freund, Journal of proteome research 2013
  • “...2B15 P36511 0.00022 6.4 1.8 (1.0) 17.0 (0.7) 1.9E+05 (1.7E+05) 7.0E+04 (2.2E+04) UDP-glucuronosyltransferase 11 (UGT1A1) Q64550 0.00086 4.6 11.0 (1.8) 54.1 (4.5) 6.3E+04 (2.0E+04) 6.8E+04 (4.6E+03) Peroxisomal multifunctional enzyme type 2 (HSD17B4) P97852 0.0018 2.0 48.1 (3.6) 96.3 (6.3) 1.8E+06 (2.8E+04) 1.6E+06 (1.6E+04) Dimethylglycine dehydrogenase. mitochondrial...”
• Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis
  Freund, American journal of physiology. Renal physiology 2013
  • “...Protein Name Gene Mass, kDa P36511 Ugt2b15 61 Q66HG6 Q64240 Q64550 Ca5b Ambp Ugt1a1 37 39 60 G3V7V6 Q6AXT5 D4A0Y1 Retsat Rab21 Cfb 67 24 141 P13264 Gls Q3MIE0...”
• Differential permeabilization effects of Ca2+ and valinomycin on the inner and outer mitochondrial membranes as revealed by proteomics analysis of proteins released from mitochondria
  Yamada, Molecular & cellular proteomics : MCP 2009
  • “...IM M Q9JM53 NP_579829e P10860 P63039 P15999 P04762 Q64550 P19643 P07633 Q6P799 Q64565 Q02253 P11884 P22791 P04785 P50554 O35827 P10719 Q6P6R2 P14408 O08816...”
• The phagosome proteome: insight into phagosome functions.
  Garin, The Journal of cell biology 2001
  • “...54700 4.8 Microtubule proteins. 14% Tubulin -5 P05218 49670.8 4.78 49500 4.5 13/24 38% UDPGT Q64550 59662.7 8.77 27000 ND UDP-glucuronosyltransferase. E.R. protein. 22% VAP33 Q9QY77 27271.5 7.66 83000 ND Vesicle-associated membrane protein, associated protein A. Associated with ER and microtubules. 40% Mol Wt pI Mr...”

P08430 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
27% identity, 35% coverage

• Molecular Insights into the Copper-Sensitive Operon Repressor in Acidithiobacillus caldus.
  Hou, Applied and environmental microbiology 2021
• Proteomic analysis of acetaminophen-induced hepatotoxicity and identification of heme oxygenase 1 as a potential plasma biomarker of liver injury.
  Gao, Proteomics. Clinical applications 2017
  • “...necrosis factor receptor superfamily member 6 FAS 1.41 4.30 10 2 Diagnosis, disease progression, efficacy P08430 UDP-glucuronosyltransferase 16 UGT1A6 1.44 3.33 10 2 Q5I034 Uncharacterized protein C12orf43 homolog RGD1311899 2.04 4.17 10 3 a) Fold change listed was from dataset Dataset 5 (24 h, 1250 mg/kg...”

Q64637 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
27% identity, 35% coverage

Q20CK8 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
27% identity, 37% coverage

AT2G31790 UDP-glucoronosyl/UDP-glucosyl transferase family protein from Arabidopsis thaliana
NP_180738 UDP-Glycosyltransferase superfamily protein from Arabidopsis thaliana
23% identity, 82% coverage

• Arabidopsis Transcriptomics Reveals the Role of Lipoxygenase2 (AtLOX2) in Wound-Induced Responses
  Kaur, International journal of molecular sciences 2024
  • “...), CYP83A1 ( At4g13770 ), SUR1 ( At2g20610 ), UGT74B1 ( At1g24100 ), UGT14C1 ( At2g31790 ), SOT18 ( At1g74090 ), SOT17 ( At1g18590 ), FMO GS-OX1 ( At1g65860 ), FMO GS-OX5 ( At1g12140 ), APO2 ( At5g57930 ), MYB28 ( At5g61420 ), MYB29 ( At5g07690...”
• Identification and Characterization of Two Regiospecific Tricetin UDP-Dependent Glycosyltransferases from Pomegranate (Punica granatum L.)
  Wu, Plants (Basel, Switzerland) 2022
  • “...(AT2G18570), At UGT72E1 (AT3G50740), At UGT73B1 (AT4G34138), At UGT73C1 (AT2G36750), At UGT74B1 (AT1G24100), At UGT74C1 (AT2G31790), At UGT74D1 (AT2G31750), At UGT74E2 (AT1G05680), At UGT74F1 (AT2G43840), At UGT75B1 (AT1G05560), At UGT75C1 (AT4G14090), At UGT75D1 (AT4G15550), At UGT76B1 (AT3G11340), At UGT76C1 (AT5G05870), At UGT76D1 (AT2G26480), At UGT76E1 (AT5G59580),...”
• A Ubiquitously Expressed UDP-Glucosyltransferase, UGT74J1, Controls Basal Salicylic Acid Levels in Rice
  Tezuka, Plants (Basel, Switzerland) 2021
  • “...of Arabidopsis and rice UGT genes in this study are shown below: UGT74B1 (At1g24100), UGT74C1 (At2g31790), UGT74D1 (At2g31750), UGT74E2 (At1g05680), UGT74F1 (At2g43840), UGT74F2 (At2g43820), UGT75B1 (At1g05560), UGT75B2 (At1g05530), UGT75C1 (At4g14090), UGT84A1 (At4g15480), UGT84A2 (At3g21560), UGT84A3 (At4g15490), UGT84A4 (At4g15500), UGT84B1 (At2g23260), UGT84B2 (At2g23250), UGT74A2 (LOC_Os03g48740, Os03g0693600), UGT74J1...”
• Effective genome editing and identification of a regiospecific gallic acid 4-O-glycosyltransferase in pomegranate (Punica granatum L.)
  Chang, Horticulture research 2019
  • “...(AT2G18570), At UGT72E1 (AT3G50740), At UGT73B1 (AT4G34138), At UGT73C1 (AT2G36750), At UGT74B1 (AT1G24100), At UGT74C1 (AT2G31790), At UGT74D1 (AT2G31750), At UGT74E2 (AT1G05680), At UGT74F1 (AT2G43840), At UGT75B1 (AT1G05560), At UGT75C1 (AT4G14090), At UGT75D1 (AT4G15550), At UGT76B1 (AT3G11340), At UGT76C1 (AT5G05870), At UGT76D1 (AT2G26480), At UGT76E1 (AT5G59580),...”
• Comparison of the Relative Potential for Epigenetic and Genetic Variation To Contribute to Trait Stability
  Aller, G3 (Bethesda, Md.) 2018
  • “...FMO GS-OX1 . G, AT1G74100 SOT16 and AT1G74090 SOT18 . H, AT2G20610 SUR1 . I, AT2G31790 UGT74C1 . J, AT3G19710 BCAT4 . K, AT3G49680 BCAT3 . L, AT4G03060 AOP2 and AT4G03050 AOP3 . M, AT4G13770 CYP83A1 . N: AT4G30530 GGP1 . O, AT4G39950 CYP79B2 and AT2G22330...”
• Overexpression of ginseng UGT72AL1 causes organ fusion in the axillary leaf branch of Arabidopsis
  Nguyen, Journal of ginseng research 2017
  • “...was constructed using the ClustalX program (neighbor-joining method). The GenBank accession numbers are: UGT74C1 ( AT2G31790 ), UGT74D1 ( AT2G31750 ), UGT74B1 ( AT1G24100 ), UGT74F2 ( AT2G43820 ), UGT74F1 ( AT2G43840 ), UGT73C7 ( AT3G53160 ), UGT73B4 ( AT2G15490 ), UGT73B2 ( AT4G34135 ), UGT73B1...”
• CB5C affects the glucosinolate profile in Arabidopsis thaliana
  Vik, Plant signaling & behavior 2016
  • “...GS-OX3 aliphatic 14 At1g65860 FMO GS-OX1 aliphatic 14.4 At1g74100 SOT16 indolyl 14.8 At4g14680 APS3 15 At2g31790 transferase 16.9 At5g23010 MAM1 aliphatic 17.1 At5g01500 TAAC 17.2 At1g78370 GSTU20 aliphatic 17.3 At4g31500 SUR2 indolyl 17.7 At5g60890 MYB34 Indolyl 17.7 The top 31 genes co-expressing with CB5C . MR...”
• Proteasome targeting of proteins in Arabidopsis leaf mesophyll, epidermal and vascular tissues
  Svozil, Frontiers in plant science 2015
  • “...1 47 33 AT2G20610 SUR1 Tyrosine transaminase family protein, superroot 1 182 x 60 x AT2G31790 UGT74C1 UDP-Glycosyltransferase superfamily protein 38 x 11 x AT1G74090 ST5b, SOT18 Desulfo-glucosinolate sulfotransferase 18 37 x 20 x AT1G18590 ST5c, SOT17 Sulfotransferase 17 61 x 14 x AT1G65860 FMO GSOX1...”
• More
• Comparative analysis of Arabidopsis UGT74 glucosyltransferases reveals a special role of UGT74C1 in glucosinolate biosynthesis.
  Grubb, The Plant journal : for cell and molecular biology 2014 (PubMed)
  • GeneRIF: UGT74C1 is an accessory enzyme in glucosinolate biosynthesis with a potential function during plant adaptation to environmental challenge. [UGT74C1]

Q64638 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see paper)
27% identity, 35% coverage

• Investigation into potential mechanisms of metabolic syndrome by integrative analysis of metabolomics and proteomics.
  Chen, PloS one 2022
  • “...Succinate dehydrogenase [ubiquinone] Carbohydrate metabolism 0.797 0.0424 Ugt1a1 Q64550 UDP-glucuronosyltransferase 11 Glycosyltransferase 0.722 0 Ugt1a5 Q64638 UDP-glucuronosyltransferase 15 Glycosyltransferase 0.694 0.0246 Ugt2b7 Q62789 UDP-glucuronosyltransferase 2B7 Lipid metabolism 0.623 0.0038 As shown in Table 1 , all impact values of these pathways were greater than 0.2. Generally,...”

mtmGII / Q194P6 3A-deolivosylpremithramycin B:dTDP-D-olivose D-olivosyltransferase from Streptomyces argillaceus (see paper)
AAC64927.1 3A-Deolivosylpremithramycin B D-olivosyltransferase (premithramycin B synthase) (MtmGII) (EC 2.4.1.-) (see protein)
24% identity, 89% coverage

B5X180 UDP-glucuronosyltransferase from Salmo salar
24% identity, 55% coverage

• Liver proteome response of pre-harvest Atlantic salmon following exposure to elevated temperature
  Nuez-Ortín, BMC genomics 2018
  • “...bco2 BCO2 28 Apolipoprotein B (Fragment) (Q91480) 2.05 8 0.016 APOB 29 UDP-glucuronosyltransferase (EC 2.4.1.17) (B5X180) 2.16 4 0.014 UD2A2 UGT2A1 30 15-hydroxyprostaglandin dehydrogenase (B9EPG3) 2.19 11 <0.001 PGDH HPGD 31 Phenazine biosynthesis-like domain-containing protein 2 (C0H855) 2.33 11 <0.001 PBLD2 PBLD 32 Metallothionein B (MT-B)...”
• Preliminary Validation of a High Docosahexaenoic Acid (DHA) and α-Linolenic Acid (ALA) Dietary Oil Blend: Tissue Fatty Acid Composition and Liver Proteome Response in Atlantic Salmon (Salmo salar) Smolts
  Nuez-Ortín, PloS one 2016
  • “...11 0.001 0.094 7 B5DG71 H33 Histone H3 4.69E+07 7.14E+07 1.5 2 0.001 0.094 8 B5X180 UD2A2 UDP-glucuronosyltransferase 2A2 1.23E+06 2.43E+06 2 5 0.000 0.025 9 B5X1I8 STT3A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit STT3A 7.64E+05 1.76E+06 2.3 5 0.000 0.089 10 B5X322 S61A1 Transport protein Sec61 subunit alpha...”

Q64633 glucuronosyltransferase (EC 2.4.1.17) from Rattus norvegicus (see 2 papers)
27% identity, 35% coverage

CAA59174.1 UDP-Glc: ecdysteroid β-glucosyltransferase (SlsnVgp116) (EC 2.4.1.-) (see protein)
29% identity, 26% coverage

LOC109408672 UDP-glycosyltransferase UGT5 from Aedes albopictus
31% identity, 18% coverage

• Insecticide resistance in the field populations of the Asian tiger mosquito Aedes albopictus in Beijing: resistance status and associated detoxification genes
  Zhou, Frontiers in physiology 2024
  • “...5.73* 5.52E-10 UGT49C1b LOC109426260 12.43 58.15 4.56* 1.65E-02 18.99 1.37 4.81E-01 34.03 2.22* 5.97E-11 UGT5 LOC109408672 3.87 17.61 4.40* 4.60E-03 10.07 2.38* 1.87E-02 16.88 3.59* 4.69E-13 ABCs ABCG1 LOC109428250 16.05 46.11 2.63* 6.16E-03 22.86 1.29 5.84E-01 52.64 2.68* 3.31E-19 ABCG1-X1 LOC109429973 6.41 16.74 2.34* 6.77E-03 12.10...”

AAB96668.1 glucuronosyltransferase (UGT1A) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

5tmbA / Q7XT97 Crystal structure of os79 from o. Sativa in complex with udp. (see paper)
34% identity, 24% coverage

• Ligand: uridine-5'-diphosphate (5tmbA)

Q9TSL7 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see 2 papers)
AAF15549.1 UDP-glucuronosyltransferase UGT1A01 (EC 2.4.1.17) (see protein)
26% identity, 35% coverage

Q20CL5 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 34% coverage

LOC116253945 anthocyanidin 3-O-glucosyltransferase 7-like from Nymphaea colorata
36% identity, 21% coverage

• Integrative analysis of transcriptome and target metabolites uncovering flavonoid biosynthesis regulation of changing petal colors in Nymphaea 'Feitian 2'
  Zhou, BMC plant biology 2024
  • “...of UFGT s was higher at D4 than at D1, wherein LOC116247679 ( UFGT- 2), LOC116253945 ( UFGT- 4), and LOC116257005 ( UFGT- 8) possessed higher FPKM values, and may represent the key unigenes related to anthocyanin modification. These suggested that the color alteration of waterlily...”
  • “...( DFR ), LOC116249327 ( ANS -1), LOC116260841 ( ANS -2), LOC116247679 ( UFGT -2), LOC116253945 ( UFGT -4), and LOC116257005 ( UFGT -8). Fig. 5 Co-expression network of DEGs in structure genes and flavonoid metabolism. The dark gray edges indicate a positive correlation, and the...”

A4IFB0 UDP glycosyltransferase 8 from Bos taurus
29% identity, 24% coverage

• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...shows homology with vertebrate CGalT sequences in an alignment with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane...”

Q20CL3 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 34% coverage

LOC128919756 UDP-glycosyltransferase UGT5-like from Zeugodacus cucurbitae
35% identity, 17% coverage

• Identification of testis development-related genes by combining Iso-Seq and RNA-Seq in Zeugodacus tau
  Liu, Frontiers in cell and developmental biology 2024
  • “...developments (T1T11). With the development of testis (from T1 to T11), only one UGT gene (LOC128919756) was continuously downregulated. Seven genes (1 RDH (LOC105212701), 3 SDR16C (LOC105209516, LOC105209517, and LOC105213735) and 3 UGT (LOC105209919, LOC105210791, and LOC105218578)) were significantly continuously upregulated. Additionally, the expression level of...”
  • “...no * LOC105209517 0.256519 0.672628 1.740267 no * LOC105213735 13.17173 51.44456 63.12685 * * UGT LOC128919756 8.726864 5.028652 0.848712 * * LOC105209919 12.46673 21.09953 26.58083 no * LOC105210436 0.416249 1.227206 1.176597 no * LOC105210791 2.563174 6.072815 8.231448 * * LOC105218578 0.473939 3.880796 11.32484 * * LOC105218581...”

LOC103328991 UDP-glycosyltransferase 71A16-like from Prunus mume
35% identity, 26% coverage

• Genome-wide discovery and characterization of flower development related long non-coding RNAs in Prunus mume
  Wu, BMC plant biology 2019
  • “...own both trend, e.g., XR_001677731.1 - XM_008231505.1 (LOC103329075) showed same trend while XR_001677731.1 - XM_008231419.2 (LOC103328991) showed the opposite trend. For trans -target genes, the three DEKL-DEG pairs were shown the same trend (Fig. 5 b). Different expression relationships between DEKLs and their potential target genes...”

Q20CL6 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

UGT79_ORYSJ / Q7XT97 UDP-glycosyltransferase 79; OsUGT79; Deoxynivalenol-UDP-glucosyltransferase; EC 2.4.1.- from Oryza sativa subsp. japonica (Rice) (see 3 papers)
34% identity, 23% coverage

• function: Involved in the detoxification of the Fusarium mycotoxin deoxynivalenol by the transfer of glucose from UDP-D-glucose to the hydroxyl group at C-3, forming deoxynivalenol-3-O-beta-D-glucoside.
• Transcriptome Analysis Identifies Candidate Target Genes Involved in Glyphosate-Resistance Mechanism in Lolium multiflorum.
  Cechin, Plants (Basel, Switzerland) 2020
  • “...plasma membrane 3.7 2.3 1.6 DN130084_c1_g4 M0Y4P1 Glycosyltransferase UDP UGT13248 Intracellular-membrane-bound 3.5 2.7 1.3 DN125138_c7_g3 Q7XT97 Glycosyltransferase UDP 79 UGT79 Intracellular-membrane-bound 3.8 2.9 1.3 DN123097_c0_g1 A0A3B6PNF9 Glycosyltransferase Unknown 4.8 2.7 1.8 DN111587_c0_g1 P82977 Subtilisin-chymotrypsin inhibitor-WSCI Extracellular region or secreted 5.9 3.7 1.6 DN135754_c1_g1 Q9MAX3 Sulfate transporter...”

XP_013840053 UDP glucuronosyltransferase 1 family, polypeptide A6 isoform X3 from Sus scrofa
28% identity, 37% coverage

• Molecular cloning and functional analysis of minipig UDP-glucuronosyltransferase 1A6.
  Miyake, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: Minipig UGT1A6 was cloned and compared to human UGT1A6. The results suggest that the enzymatic properties of UGT1A6 enzymes are moderately different between humans and minipigs.

FLRT_CITMA / Q8GVE3 Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase; 1,2 rhamnosyltransferase; EC 2.4.1.236 from Citrus maxima (Pomelo) (Citrus grandis) (see 2 papers)
Q8GVE3 flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase (EC 2.4.1.236) from Citrus maxima (see paper)
24% identity, 85% coverage

• function: Involved in the production of the bitter neohesperidosides in citrus. Shows a strict specificity for UDP-rhamnose as donor.
  catalytic activity: flavanone 7-O-beta-D-glucoside + UDP-beta-L-rhamnose = flavanone 7-O-[alpha-L-rhamnosyl-(1->2)-beta-D-glucoside] + UDP + H(+) (RHEA:15473)
  subunit: Monomer.
• The Sweet Side of Plant-Specialized Metabolism
  Louveau, Cold Spring Harbor perspectives in biology 2019 (secret)

F7GW14 glucuronosyltransferase from Macaca mulatta
26% identity, 34% coverage

• Proteomic Evaluation of the Natural History of the Acute Radiation Syndrome of the Gastrointestinal Tract in a Non-human Primate Model of Partial-body Irradiation with Minimal Bone Marrow Sparing Includes Dysregulation of the Retinoid Pathway
  Huang, Health physics 2020
  • “...DHDH 0.61 0.00016 A0A1D5RDA4 NAT8 0.61 0.00019 A0A1D5QYQ4 A0A1D5QYQ4 0.6 0.00024 F7HAW1 UGT2B15 0.59 0.00033 F7GW14 UGT1A1 0.55 0.00089 Table 4. Proteins that were observed as changed by radiation in both the NHP and murine small intestine. Murine data from Huang et al. 2019 . Genes...”

Q20CL2 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 34% coverage

Q20CK6 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

Q20CL4 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 34% coverage

Q20CL1 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

AT5G14860 transferase, transferring glycosyl groups from Arabidopsis thaliana
37% identity, 22% coverage

• Integrating transcriptomic network reconstruction and eQTL analyses reveals mechanistic connections between genomic architecture and Brassica rapa development
  Baker, PLoS genetics 2019
  • “...COBL4;IRX6 Bra008711 50 10 r, Hmax 24.58 AT5G15250 ATFTSH6;FTSH6 Bra008734 30 10 r, Hmax 41.79 AT5G14860 NA Bra008750 30 10 r, Hmax 15.37 AT5G14600 NA Bra008840 20 10 r, Hmax 22.52 AT5G13280 AK;AK-LYS1;AK1 Bra008859 20 10 r, Hmax 41.59 AT5G13070 NA Bra008931 50 10 Hmax 8.51...”
• The Histone Deacetylase Inhibitor Suberoylanilide Hydroxamic Acid Alleviates Salinity Stress in Cassava
  Patanun, Frontiers in plant science 2016
  • “...ARM repeat superfamily protein 2.669 3.46E-05 RknMes02_046170 AT2G43870 Pectin lyase-like superfamily protein 2.653 1.88E-05 RknMes02_009426 AT5G14860 UDP-Glycosyltransferase superfamily protein 2.641 5.69E-05 RknMes02_025204 AT1G09960 Sucrose transporter 4 2.611 9.43E-05 a AGI code is shown if proteins encoded in each cassava gene (probe ID) have high amino acid...”
  • “...domain protein 31 1.903 2.312 2.343 RknMes02_049529 AT3G54420 Chitinase class IV 1.733 3.678 5.653 RknMes02_009426 AT5G14860 UDP-Glycosyltransferase superfamily protein 1.668 2.277 2.641 RknMes02_004082 AT1G17840 ATP-binding cassette G11 1.617 1.030 1.541 RknMes02_057376 1.616 2.369 1.867 RknMes02_029383 AT2G41190 Transmembrane amino acid transporter family protein 1.580 2.052 2.285 RknMes02_023158...”
• Two plastid DNA lineages--Rapa/Oleracea and Nigra--within the tribe Brassiceae can be best explained by reciprocal crosses at hexaploidy: evidence from divergence times of the plastid genomes and R-block genes of the A and B genomes of Brassica juncea
  Sharma, PloS one 2014
  • “...fragment or as a sequence showing only low-level of identity. In particular, A. thaliana At5g14720, At5g14860 and At5g15260 orthologues were observed in the A genome, while their homoeologues showing low-identity were observed at collinear positions in the B genome. Likewise, At5g14880 and At5g15240 orthologues were observed...”

Q9TSL9 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
AAF15547.1 UDP-glucuronosyltransferase UGT1A06 (EC 2.4.1.17) (see protein)
26% identity, 35% coverage

LOC4327545 UDP-glycosyltransferase 87A1 from Oryza sativa Japonica Group
26% identity, 71% coverage

• G protein γ subunit qPE9-1 is involved in rice adaptation under elevated CO₂ concentration by regulating leaf photosynthesis
  Wang, Rice (New York, N.Y.) 2021
  • “...to WT under eCO 2 (Fig. 6 A, Table S 3 ). For example, UDP-glycosyltransferase (LOC4327545) and magnesium-chelatase subunit (chloroplastic) (LOC4344148), which are involved in photosynthetic light reaction, were expressed higher in WT than in RNAi3 after exposure to eCO 2 . (Fig. 6 A, Table...”
• Alteration of resveratrol-dependent glycosyltransferase activity by elicitation in DJ-526 rice
  Kantayos, GM crops & food 2021
  • “...(flowers, leaves, roots) 17 R17 LOC4348729 UDP-glycosyltransferase 86A1 (roots, seeds, leaves) UDP-glycosyltransferase 86A2 18 R18 LOC4327545 UDP-glycosyltransferase 87A1(seeds, leaves, roots) UDP-glucose:salicylic acid glucosyltransferase 19 R19 LOC4327546 UDP-glycosyltransferase 87A2 (seeds, all organs) 20 R20 LOC4339389 UDP-glycosyltransferase 88B1 (flower buds) UDP-glycosyltransferase 88F3 21 R21 LOC4339394 UDP-glycosyltransferase 88F5 (leaves,...”

XP_003581017 UDP-glycosyltransferase 79 isoform X1 from Brachypodium distachyon
33% identity, 24% coverage

• Effective genome editing and identification of a regiospecific gallic acid 4-O-glycosyltransferase in pomegranate (Punica granatum L.)
  Chang, Horticulture research 2019
  • “...(AT5G03490), At UGT89B1 (AT1G73880), At UGT89C1 (AT1G06000), At UGT90A1 (AT2G16890), At UGT92A1 (AT5G12890), Bd UGT74J7 (XP_003581017), Bv UGT71F1 (AY526081), Bv UGT73A4 (AY526080), Ca UGT73AH1 (AUR26623), Co UGT78B3 (AEB61484), Co UGT85N1 (AEB61489), Cp PGT2 (AIS39471), Cp PGT4 (AIS39473), Cp PGT11 (AIS39477), Cs UGT76F1 (KDO69246), Cte UGT78K6 (BAF49297),...”

LOC101247047 UDP-glycosyltransferase 74F2 from Solanum lycopersicum
32% identity, 30% coverage

• Transcriptome Analysis of Tomato Leaves Reveals Candidate Genes Responsive to Tomato Brown Rugose Fruit Virus Infection
  Wang, International journal of molecular sciences 2024
  • “...the up-regulated genes, GA2ox4 was consistent with the transcriptome data, and LOC101261464 , LOC101249297 , LOC101247047 , and LOC101262227 were also induced by ToBRFV, although to a slightly lesser extent than that in the transcriptome data ( Figure 5 ). Among the down-regulated genes, the quantitative...”
  • “...up LOC101249297 Solanum lycopersicum cytochrome P450 94A1-like 46.971 19.38786 81.38199 162.6701 461.2333 308.0879 2.655824219 up LOC101247047 Solanum lycopersicum UDP-glycosyltransferase 74F2 154.4824 432.9955 631.483 1804.076 2948.067 1294.837 2.310442285 up LOC101262227 Solanum lycopersicum benzyl alcohol O-benzoyltransferase 472.8414 610.7175 539.7995 2297.601 1775.855 3771.69 2.273012285 up LOC101254060 Solanum lycopersicum fasciclin-like...”
• A metabolome and transcriptome survey to tap the dynamics of fruit prolonged shelf-life and improved quality within Greek tomato germplasm
  Mellidou, Frontiers in plant science 2023
  • “...VOCs, three genes were up-regulated in SSL and suppressed in LSL, including an UDP-glycosyltransferase 74F2 (LOC101247047) and two flavin-containing monooxygenases ( FMO s; LOC101254042, LOC101254343). Several transcription factors (TFs) were identified as DEGs between TRTH1620 and TRTH2510 ( Figure5 ; Supplementary Table10 ). Among them, a...”

B2RT14 UDP-glucuronosyltransferase from Mus musculus
26% identity, 35% coverage

• Proteomic Identification and Quantification of Snake Venom Biomarkers in Venom and Plasma Extracellular Vesicles
  Willard, Toxins 2021
  • “...VV region >100 G3UXX3 Sepiapterin reductase >100 A0A1W2P7F1 Complement component 1, s subcomponent 2 >100 B2RT14 UDP-glucuronosyltransferase >100 Q01279 Epidermal growth factor receptor >100 Q8R0Y6 Cytosolic 10-formyltetrahydrofolate dehydrogenase >100 P55258 Ras-related protein Rab-8A >100 Q9D1D4 Transmembrane emp24 domain-containing protein 10 >100 Q9QXF8 Glycine N-methyltransferase >100 Q3TNA1...”
• Nanoparticle exposure driven circulating bioactive peptidome causes systemic inflammation and vascular dysfunction.
  Mostovenko, Particle and fibre toxicology 2019
  • “...Matrin-3 Matr3 Q8K310 MEROPS 6642.0386 6661.0724 41.86 53.01 2.32 11.24 7.078 0.000 ELFQREVSSVELFSYA UDP-glucuronosyltransferase Ugt1a5 B2RT14 SignalP 1884.9258 1903.9390 30.24 88.84 2.73 11.73 7.071 0.000 RPCPTEQLSPSHPPLATCFGSDVDLQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQ Laminin subunit alpha-5 Lama5 Q61001 MEROPS 6608.1184 6627.1148 39.56 58.20 3.33 12.10 7.065 0.000 YLPSGQQLYMSKEM MCG3425 Vmn2r75 G5E8Z7 SignalP 1655.7688...”

NP_001336952 UDP glucuronosyltransferase 1 family, polypeptide A8 precursor from Macaca fascicularis
26% identity, 35% coverage

• Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
  Kishi, Xenobiotica; the fate of foreign compounds in biological systems 2016 (PubMed)
  • GeneRIF: the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).

Q20CK7 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

AAB96667.1 glucuronosyltransferase (UGT1A) (EC 2.4.1.17) (see protein)
27% identity, 35% coverage

GTFB_AMYOR / P96559 Vancomycin aglycone glucosyltransferase; Glycosyltransferase GtfB; EC 2.4.1.310 from Amycolatopsis orientalis (Nocardia orientalis) (see 4 papers)
P96559 vancomycin aglycone glucosyltransferase (EC 2.4.1.310) from Amycolatopsis orientalis (see 2 papers)
AAB49293.1 TDP/UDP-Glc: aglycosyl-vancomycin: glucosyltransferase (GtfB;PCZA361.20) (EC 2.4.1.-) (see protein)
30% identity, 43% coverage

• function: Glucosyltransferase that transfers glucose to the 4-OH- Phegly(4) residue of vancomycin aglycone (AGV) to produce devancoaminyl-vancomycin (DVV) in the biosynthesis of glycopeptide antibiotic chloroeremomycin, a member of the vancomycin group of antibiotics.
  catalytic activity: vancomycin aglycone + UDP-alpha-D-glucose = devancoaminyl- vancomycin + UDP (RHEA:38587)

AAF15548.1 UDP-glucuronosyltransferase UGT1A08 (EC 2.4.1.17) (see protein)
26% identity, 35% coverage

UD12_MOUSE / P70691 UDP-glucuronosyltransferase 1-2; UDPGT 1-2; UGT1*2; UGT1-02; UGT1.2; Bilirubin-specific UDPGT; UDP-glucuronosyltransferase 1A2; UGT1A2; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
BAA13482.1 Glucuronosyltransferase 1.2 (Ugt1a2) (EC 2.4.1.17) (see protein)
NP_038729 UDP-glucuronosyltransferase 1-2 precursor from Mus musculus
26% identity, 35% coverage

• function: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
• A role for UDP-glucose glycoprotein glucosyltransferase in expression and quality control of MHC class I molecules.
  Zhang, Proceedings of the National Academy of Sciences of the United States of America 2011
  • GeneRIF: in addition to the extensively studied tapasin-mediated quality control mechanism, UGT1 adds a new level of control in the MHC class I antigen presentation pathway.
• Control of steroid, heme, and carcinogen metabolism by nuclear pregnane X receptor and constitutive androstane receptor.
  Xie, Proceedings of the National Academy of Sciences of the United States of America 2003
  • GeneRIF: induced in transgenic mice, functions to eliminate steroids, heme metabolites and environmental toxins

CAA63090.1 UDP-Gal: ceramide 1-β-galactosyltransferase (EC 2.4.1.45) (see protein)
29% identity, 24% coverage

LOC107783555 beta-D-glucosyl crocetin beta-1,6-glucosyltransferase from Nicotiana tabacum
22% identity, 79% coverage

• Plant Soft Rot Development and Regulation from the Viewpoint of Transcriptomic Profiling
  Tsers, Plants (Basel, Switzerland) 2020
  • “...related to flavonoid and carotenoid modification were revealed. A strong upregulation was observed for genes (LOC107783555, LOC107761722, LOC107820493. LOC107778878, LOC107790993, LOC107827640, LOC107820494, LOC107763569, LOC107767710, and LOC107780597) encoding biosynthetic enzymes of crocina water-soluble apocarotenoid with high antioxidant activity [ 65 ]. Genes encoding isoflavone 2-hydroxylases (yielding different...”

AAC50565.1 UDP-galactose:ceramide 1-β-galactosyltransferase (CGalT) (EC 2.4.1.45) (see protein)
29% identity, 24% coverage

LOC107820493 beta-D-glucosyl crocetin beta-1,6-glucosyltransferase from Nicotiana tabacum
31% identity, 25% coverage

• Plant Soft Rot Development and Regulation from the Viewpoint of Transcriptomic Profiling
  Tsers, Plants (Basel, Switzerland) 2020
  • “...flavonoid and carotenoid modification were revealed. A strong upregulation was observed for genes (LOC107783555, LOC107761722, LOC107820493. LOC107778878, LOC107790993, LOC107827640, LOC107820494, LOC107763569, LOC107767710, and LOC107780597) encoding biosynthetic enzymes of crocina water-soluble apocarotenoid with high antioxidant activity [ 65 ]. Genes encoding isoflavone 2-hydroxylases (yielding different compounds with...”

UGT48_CAEEL / Q18081 Putative UDP-glucuronosyltransferase ugt-48; UDPGT 48; EC 2.4.1.17 from Caenorhabditis elegans (see paper)
34% identity, 23% coverage

• catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  subunit: Interacts with cmd-1 in the presence of Ca(2+).

Q20CL0 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

UGT74AC1 / K7NBW3 mogroside IE synthase (EC 2.4.1.350) from Siraitia grosvenorii (see 2 papers)
74AC1_SIRGR / K7NBW3 Mogroside I-E synthase; UDP-glycosyltransferase 74-359-2; UGT74-359-2; UDP-glycosyltransferase 74AC1; SgUGT74AC1; EC 2.4.1.350 from Siraitia grosvenorii (Monk's fruit) (Luo han guo) (see 3 papers)
22% identity, 85% coverage

• function: UDP-glycosyltransferase involved in the biosynthesis of cucurbitacin and mogroside tetracyclic triterpene natural products (e.g. siamenoside I and mogrosides IV, V and VI) (PubMed:25759326, Ref.5). Cucurbitacins have cytotoxic properties and exhibit deterrent taste as a defense barrier against herbivores (PubMed:25759326, Ref.5). Mogrosides are nonsugar highly oxygenated compounds used as high- intensity zero-calorie sweeteners; they also possess pharmacological properties such as regulating immunity, lowering blood sugar and lipid levels, protecting the liver, and acting as antioxidants and antitumor agents (PubMed:25759326, Ref.5). Catalyzes the transfer of a glucose moiety to the C-3 hydroxyl of mogrol to form mogroside I-E (PubMed:25759326, Ref.5). Besides mogrol, UGT74AC1 also shows activity in vitro with quercetin and naringenin as substrate (PubMed:25759326).
  catalytic activity: mogrol + UDP-alpha-D-glucose = mogroside IE + UDP + H(+) (RHEA:52044)

NP_258389 ecdysteroid UDP-glucosyltransferase from Spodoptera litura NPV
33% identity, 22% coverage

• Origin of Ecdysosteroid UDP-glycosyltransferases of Baculoviruses through Horizontal Gene Transfer from Lepidoptera
  Hughes, Coevolution 2013
  • “...residues that were conserved in all baculovirus EGTs analyzed. These conserved positions (numbered as in NP_258389, Spodoptera litura NPV EGT) were G179, N185, and Q280 ( Figure 3 ). In addition to these conserved baculovirus-specific amino acid replacements, baculovirus EGTs differed from lepidopteran UGT33 and UGT34...”
  • “...acid residues conserved in all baculovirus EGTs analyzed: G179, N185, and Q280 (numbered as in NP_258389). Based on the alignment of Ahn et al. (2012) , the G179 and N185 are located in the N-terminal domain of the protein, not far from the catalytic residues. Q280...”

GTFE_AMYOR / Q9AFC6 Glycosyltransferase GtfE; EC 2.4.1.- from Amycolatopsis orientalis (Nocardia orientalis) (see 2 papers)
AAK31353.1 TDB/UDP-Glc: aglycosyl-vancomycin glucosyltransferase (GtfE) (EC 2.4.1.-) (see protein)
32% identity, 34% coverage

• function: D-glucosyltransferase that acts on the aglycone core, transferring D-glucose to the phenolic hydroxyl of OH-Phegly(4) to form a devancoaminyl-vancomycin (DVV) intermediate in the biosynthesis of glycopeptide antibiotic vancomycin. Also able to glycosylate A47934, an antibiotic with a teicoplanin-like heptapeptide, but lacking sugar residues.

UGT3 / C5NN14 flavonoid glucoside 1,6-glucosyltransferase from Catharanthus roseus (see paper)
BAH80312.1 UDP-Glc: flavonoid glucoside β-1,6-glucosyltransferase (CaUGT3) (EC 2.4.1.-) (see protein)
C5NN14 Glycosyltransferase from Catharanthus roseus
22% identity, 79% coverage

• Complete microbial synthesis of crocetin and crocins from glycerol in Escherichia coli
  Lee, Microbial cell factories 2024
  • “...putative UGT-2 amino acid sequences were retrieved: SpUGT(GenBank accession number XP_015057190.1), NsUGT (XP_009793442.1), and CaUGT3 (C5NN14). We used the neighbor-joining method to infer the evolutionary relationships of the nine UGTs (including GjUGT1 and GjUGT9) and constructed a phylogenetic tree using the MEGA-X program [ 43 ]....”
• Genome-wide microarray analysis of tomato roots showed defined responses to iron deficiency
  Zamboni, BMC genomics 2012
  • “...TC197109 2.56 0.024 82 TC198786_1057_37_S UDP-glucose:glucosyltransferase B6EWY6 TC198786 2.19 0.022 83 TC203267_704_38_S UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase C5NN14 TC203267 2.76 0.013 84 TC212095_566_35_S UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase C5NN14 TC212095 3.69 0.018 Response to stimulus GO:0050896 85 TC193192_66_41_X2 Peroxidase 4 B7UCP4 TC193192 -3.86 0.029 86 TC208216_282_40_S Pit1 protein Q40539 TC208216...”

CGT_TALPI / A0A478EC03 UDP-glycosyltransferase; 3-C-glucosyltransferase; CGT; EC 2.4.1.- from Talaromyces pinophilus (Penicillium pinophilum) (see paper)
33% identity, 20% coverage

• function: UDP-glycosyltransferase; part of the gene cluster that mediates the biosynthesis of stromemycin, a depside C-glucoside with two unsaturated C9 side chains belonging to aromatic polyketide glycosides (PubMed:38545685). Acts as the tailoring enzyme responsible for 3-C-glucosylation of bininalkenylresorcylic acid to yield stromemycin (PubMed:38545685).
  catalytic activity: stromemycin aglycone + UDP-alpha-D-glucose = stromemycin + UDP + H(+) (RHEA:81995)

Q9TSM0 glucuronosyltransferase (EC 2.4.1.17) from Macaca fascicularis (see paper)
AAF15546.1 UDP-glucuronosyltransferase UGT1A09 (EC 2.4.1.17) (see protein)
26% identity, 35% coverage

Q20CK9 glucuronosyltransferase (EC 2.4.1.17) from Papio anubis (see paper)
26% identity, 35% coverage

CGT_RAT / Q09426 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; CGalT; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase; EC 2.4.1.47 from Rattus norvegicus (Rat) (see 2 papers)
AAA16108.1 Ceramide 1-β-galactosyltransferase (EC 2.4.1.45) (see protein)
29% identity, 24% coverage

• function: Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides (PubMed:8713090).
  catalytic activity: an N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D- galactosyl-(1<->1')-N-acylsphing-4-enine + UDP + H(+) (RHEA:13093)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphing-4-enine + UDP-alpha-D-galactose = N-(2-hydroxy-hexanoyl)-beta-D-galactosyl-sphing-4-enine + UDP + H(+) (RHEA:43400)
  catalytic activity: N-(2-hydroxy-hexanoyl)-sphinganine + UDP-alpha-D-galactose = N-(2-hydroxyhexanoyl)-beta-D-galactosylsphinganine + UDP + H(+) (RHEA:43404)
  catalytic activity: an N-acyl-sphingoid base + UDP-alpha-D-galactose = a D- galactosylceramide + UDP + H(+) (RHEA:48344)
• Identification of protein targets for the antidepressant effects of Kai-Xin-San in Chinese medicine using isobaric tags for relative and absolute quantitation.
  Dong, Neural regeneration research 2020
  • “...Q6IFW6, D3ZDA6, Q4FZU2, Q6IMF3, Q5U2Y6, P84087, D3ZDE4, Q6IG04, D3ZS28, E9PU01, Q64598, F1LNE8, Q6IG02, Q05140, G3V9B3, Q09426, D3ZAW2, Q3KRE8, P51907, Q6P6Q2, P10688, Q6IRG7, D3ZY19, Q924S1, F1LX47, Q5BK56, D4AA63, Q5FVF3, Q3SWT4, F1LN57, Q6IFU7, D3ZK01, G3V8E8, Q6PDW6, D3ZK70, Q5U2Q7, D4AAZ9, D3ZBE6, Q5FVQ2, F1LPT0, Q5I034, Q5I0K3, G3V7C4, B2RZ66, P68255, G3V6X7,...”
• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval sequence. Fig. 5...”

Sgt2 / Q2Q478 solanidine glucosyltransferase from Solanum tuberosum (see paper)
ABB29874.1 UDP-Glc: solanidine glucosyltransferase (Sgt2.2) (EC 2.4.1.-) (see protein)
34% identity, 23% coverage

UD11_MOUSE / Q63886 UDP-glucuronosyltransferase 1A1; UGT1A1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UGTBR1; EC 2.4.1.17 from Mus musculus (Mouse) (see paper)
Q63886 glucuronosyltransferase (EC 2.4.1.17) from Mus musculus (see paper)
AAH93516.1 glucuronosyltransferase 1A1 (Ugt1a1) (EC 2.4.1.17) (see protein)
NP_964007 UDP-glucuronosyltransferase 1A1 precursor from Mus musculus
26% identity, 34% coverage

• function: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2- isoprostane (8-iso-PGF2alpha). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.
  catalytic activity: glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+) (RHEA:21032)
  catalytic activity: 17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52460)
  catalytic activity: 2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53048)
  catalytic activity: 2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53004)
  catalytic activity: 2-methoxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2- methoxy-17beta-estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:53072)
  catalytic activity: 17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha- estradiol 3-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52868)
  catalytic activity: 16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + UDP + H(+) (RHEA:52880)
  catalytic activity: losartan + UDP-alpha-D-glucuronate = losartan-2-N-beta-D- glucuronide + UDP (RHEA:63720)
  catalytic activity: prunetin + UDP-alpha-D-glucuronate = prunetin-4'-O-beta-D- glucuronide + UDP (RHEA:63588)
  catalytic activity: SN-38 + UDP-alpha-D-glucuronate = SN-38 O-beta-D-glucuronide + UDP + H(+) (RHEA:63696)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP (RHEA:75099)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha + UDP-alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP (RHEA:79067)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C8-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79071)
  catalytic activity: (4Z,15Z)-bilirubin IXalpha C12-beta-D-glucuronoside + UDP- alpha-D-glucuronate = (4Z,15Z)-bilirubin IXalpha C8,C12-beta-D- bisglucuronoside + UDP (RHEA:79075)
  catalytic activity: 8-iso-prostaglandin F2alpha + UDP-alpha-D-glucuronate = 8-iso- prostaglandin F2alpha-glucuronide + UDP + H(+) (RHEA:79907)
  catalytic activity: (5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D-glucuronate = O-[(5Z),(8Z),(11Z),(14Z)-eicosatetraenoyl]-beta-D-glucuronate + UDP (RHEA:79915)
  catalytic activity: 15-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + UDP-alpha-D- glucuronate = 15-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79919)
  catalytic activity: 20-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + UDP-alpha-D- glucuronate = 20-O-(beta-D-glucuronosyl)-(5Z,8Z,11Z,14Z)- eicosatetraenoate + UDP + H(+) (RHEA:79927)
  catalytic activity: prostaglandin B1 + UDP-alpha-D-glucuronate = 15-O-(beta-D- glucuronosyl)-prostaglandin B1 + UDP + H(+) (RHEA:79935)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-4-O-(beta-D- glucuronosyl)-ferulate + UDP + H(+) (RHEA:79951)
  catalytic activity: (E)-ferulate + UDP-alpha-D-glucuronate = (E)-ferulic acid beta-D-glucuronate ester + UDP (RHEA:79955)
  subunit: Homodimers. Homooligomer. Interacts with UGT1A3, UGT1A4, UGT1A6, UGT1A7, UGT1A8, UGT1A9 and UGT1A10 to form heterodimers.
• Development of a Global Metabo-Lipid-Prote-omics Workflow to Compare Healthy Proximal and Distal Colonic Epithelium in Mice
  Hemmati, Journal of proteome research 2024
  • “...GO-term GO:0015020_F:glucuronosyltransferase activity was increased in PC tissue which represents 5 UDP-glucuronosyltransferases [Ugt2b17 (P17717), Ugt1a1 (Q63886), Ugt1a6 (Q64435), Ugt1a7c (Q6ZQM8), and Ugt2a3 (Q8BWQ1, 2.4.1.17)]. Higher levels of the substrate UDP-glucuronide and its precursor UDP-glucose were observed in the DC tissue, indicating the usage of the UDP-glucuronide...”
• Sortilin 1 Loss-of-Function Protects Against Cholestatic Liver Injury by Attenuating Hepatic Bile Acid Accumulation in Bile Duct Ligated Mice.
  Li, Toxicological sciences : an official journal of the Society of Toxicology 2018
• Comparative and integrative metabolomics reveal that S-nitrosation inhibits physiologically relevant metabolic enzymes.
  Bruegger, The Journal of biological chemistry 2018
• Re-adaption on Earth after Spaceflights Affects the Mouse Liver Proteome.
  Anselm, International journal of molecular sciences 2017
  • “...Q3UEP4 - 2.1 0.0167 0.0132 Cytochrome P450 3A13 Q3UW87 - 0.4 0.0121 0.0279 UDP-glucuronosyltransferase 1-1 Q63886 - 1.2 0.0420 0.0185 UDP-glucuronosyltransferase 1-6 Q64435 - 2.0 0.0179 0.0410 Cytochrome P450 2C54 Q6XVG2 * >0.05 0.0476 UDP-glucuronosyltransferase 2A3 Q8BWQ1 - 1.9 0.0109 0.0132 UDP-glucuronosyltransferase Q8K154 - 1.9 0.0172...”
• Gene expression profiling to identify eggshell proteins involved in physical defense of the chicken egg.
  Jonchère, BMC genomics 2010
  • “...Contains CD80-like C2-set immunoglobulin domain, B302 (SPRY) domain and Ig-like V-type (immunoglobulin-like) domain UDP-glucuronosyltransferase 1-1 (Q63886) UDP-glucoronosyl and UDP-glucosyl transferase family. Involved in detoxication and elimination of toxics Mannose-binding protein C (Q66S61) Binds mannose and N-acetylglucosamine in a calcium-dependent manner. Is capable of host defense. Contains...”
  • “...6.5 2.8 6.9 Glioma pathogenesis-related protein 1 P48060 8.7 5.7 2 4.1 6.1 UDP-glucuronosyltransferase 1-1 Q63886 8.87 3.8 5.1 4.3 6.3 Glutamate [NMDA] receptor subunit zeta-1 Q5R1P0 8.92 4.8 6.1 6.1 6.1 Avian Beta defensin-9 Q6QLR1 8.94 4.8 0 7.1 7.1 Glycine receptor subunit beta P48167...”
• Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
  Jiang, World journal of gastroenterology 2024
  • GeneRIF: Uridine diphosphate glucuronosyltransferase 1A1 prevents the progression of liver injury.
• Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.
  Yang, The Journal of biological chemistry 2023
  • GeneRIF: Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.
• Suppressing Hepatic UGT1A1 Increases Plasma Bilirubin, Lowers Plasma Urobilin, Reorganizes Kinase Signaling Pathways and Lipid Species and Improves Fatty Liver Disease.
  Bates, Biomolecules 2023
  • GeneRIF: Suppressing Hepatic UGT1A1 Increases Plasma Bilirubin, Lowers Plasma Urobilin, Reorganizes Kinase Signaling Pathways and Lipid Species and Improves Fatty Liver Disease.
• UGT1A1 dysfunction increases liver burden and aggravates hepatocyte damage caused by long-term bilirubin metabolism disorder.
  Liu, Biochemical pharmacology 2021 (PubMed)
  • GeneRIF: UGT1A1 dysfunction increases liver burden and aggravates hepatocyte damage caused by long-term bilirubin metabolism disorder.
• Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
  Miyauchi, Biochemical and biophysical research communications 2020 (PubMed)
  • GeneRIF: Hetero-oligomer formation of mouse UDP-glucuronosyltransferase (UGT) 2b1 and 1a1 results in the gain of glucuronidation activity towards morphine, an activity which is absent in homo-oligomers of either UGT.
• Coupling AAV-mediated promoterless gene targeting to SaCas9 nuclease to efficiently correct liver metabolic diseases.
  De, JCI insight 2019
  • GeneRIF: Coupling AAV-mediated promoterless gene targeting to SaCas9 nuclease to efficiently correct liver metabolic diseases.
• AAV8 Gene Therapy Rescues the Newborn Phenotype of a Mouse Model of Crigler-Najjar.
  Greig, Human gene therapy 2018 (PubMed)
  • GeneRIF: An AAV8 vector was developed expressing a codon-optimized human version of UGT1A1 from a liver-specific promoter. High doses of the vector rescued neonatal lethality in newborn UGT1 knockout (KO) mice, which serve as a model of Crigler-Najjar syndrome, and significantly increased survival from 5 to 270 days.
• UDP-glucuronosyltransferase 1a enzymes are present and active in the mouse blastocyst.
  Collier, Drug metabolism and disposition: the biological fate of chemicals 2014
  • GeneRIF: data confirm that Ugt1a proteins are present and active in preimplantation murine embryos and point to a potential role for these proteins in implantation and early embryonic and fetal development
• More

Q64676 2-hydroxyacylsphingosine 1-beta-galactosyltransferase from Mus musculus
29% identity, 24% coverage

• Study on the underlying molecular mechanism of benzene-induced nervous system damage in mice based on tandem mass tag (TMT) proteomics.
  Zheng, Toxicology research 2024
• Metabolic Enzyme Alterations and Astrocyte Dysfunction in a Murine Model of Alexander Disease With Severe Reactive Gliosis
  Heaven, Molecular & cellular proteomics : MCP 2022
  • “...( GFAP Tg ;Gfap +/R236H /wild type) RNA-seq ( GFAP Tg ;Gfap +/R236H /wild type) Q64676 Ugt8 2-hydroxyacylsphingosine 1-beta-galactosyltransferase 4.28 1.72 P16330 Cnp 2,3-cyclic-nucleotide 3-phosphodiesterase 1.31 1.55 Q61885 Mog Myelin-oligodendrocyte glycoprotein 1.21 1.45 P04370 Mbp Myelin basic protein 1.46 1.40 Q9D2P8 Mobp Myelin-associated oligodendrocyte basic protein...”
• Glucosylceramide transferase in Giardia preferentially catalyzes the synthesis of galactosylceramide during encystation
  Robles-Martinez, Molecular and biochemical parasitology 2017
  • “...in an alignment with the following taxa: Bos Taurus (A4IFB0), Homo sapiens (Q16880), Mus musculus (Q64676), Rattus norvegicus (Q09426), Gallus gallus (Q98TB5), Canis lupus familiaris (E2RA42), Felis catus (M3WVI1), Xenopus tropicalis (F6W899). Like CGalT, CGlcT has a predicted C-terminal transmembrane domain and a conserved ER retrieval...”
• RNA sequencing and proteomics approaches reveal novel deficits in the cortex of Mecp2-deficient mice, a model for Rett syndrome.
  Pacheco, Molecular autism 2017
  • “...Yes 2 Retinal dehydrogenase Slc9a3r1 /NHERF1(P)* P70441 0.74 1.79 Yes 3 Scaffold protein Ugt8a /UGT8 Q64676 0.79 1.76 --- Sphingolipid metabolism Qdpr /QDPR (or DHPR)* Q8BVI4 0.74 1.68 Yes 2 Monoamine metabolism (tetrahydrobiopterin biosynthesis) Ugp2 /UGP2* Q91ZJ5 0.73 1.67 Yes 2 Glycogen synthesis Car2 /Ca2 P00920...”

U5DCP2 Glycosyltransferase from Amborella trichopoda
23% identity, 76% coverage

• Exploring the Phytochemical Landscape of the Early-Diverging Flowering Plant Amborella trichopoda Baill
  Wu, Molecules (Basel, Switzerland) 2019
  • “...(490), U5D817 (481), U5DB27 (427), U5DB32 (469), U5DBW3 (470), U5DBY1 (482), U5DBY4 (478), U5DCN3 (473), U5DCP2 (463), U5DDJ3 (467), U5DDK2 (467), U5DFQ3 (467), U5DFQ6 (467), U5DI88 (510), U5DI92 (419), U5DI97 (469), W1NFL7 (481), W1NFN9 (481), W1NHX5 (466), W1NIK4 (481), W1NU70 (500), W1NUG7 (539), W1NUV1 (607), W1NV64...”

XP_011512261 UDP-glucuronosyltransferase 3A1 isoform X4 from Homo sapiens
30% identity, 32% coverage

• UDP-Glycosyltransferase 3A Metabolism of Polycyclic Aromatic Hydrocarbons: Potential Importance in Aerodigestive Tract Tissues.
  Vergara, Drug metabolism and disposition: the biological fate of chemicals 2020
  • GeneRIF: UDP-Glycosyltransferase 3A Metabolism of Polycyclic Aromatic Hydrocarbons: Potential Importance in Aerodigestive Tract Tissues.
• Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
  Meech, The Journal of biological chemistry 2012
  • GeneRIF: An asparagine (Asn-391) in the UGT signature sequence of UGT3A1 is necessary for utilization of UDP-GlcNAc.
• UGT3A: novel UDP-glycosyltransferases of the UGT superfamily.
  Meech, Drug metabolism reviews 2010 (PubMed)
  • GeneRIF: UGT3A1 is involved in drug metabolism and uses UDP N-acetylglucosamine as a sugar donor
• Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
  Flachsbart, Mutation research 2010 (PubMed)
  • GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
• Identification of UDP glycosyltransferase 3A1 as a UDP N-acetylglucosaminyltransferase.
  Mackenzie, The Journal of biological chemistry 2008
  • GeneRIF: UDP glycosyltransferase 3A1 is a UDP N-acetylglucosaminyltransferase
• Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
  Rose, Molecular medicine (Cambridge, Mass.)
  • GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

LOC656120 UDP-glycosyltransferase UGT5 from Tribolium castaneum
31% identity, 18% coverage

• Insecticidal Activity of Artemisia vulgaris Essential Oil and Transcriptome Analysis of Tribolium castaneum in Response to Oil Exposure
  Gao, Frontiers in genetics 2020
  • “...I LOC657454 1.27 Up 2.98E-30 CYP9AC1 Phase I LOC661469 1.24 Up 0.000982 CSP17 Phase 0 LOC656120 1.22 Up 1.19E-27 Ugt2B16 Phase II LOC659847 1.15 Up 4.96E-63 MRP49 Phase III LOC659009 1.13 Up 4.50E-45 GSTs7 Phase II LOC656770 1.12 Up 6.93E-55 CYP6BK11 Phase I LOC661219 1.12 Up...”

LOC109746039 UDP-glucosyltransferase UGT13248 from Aegilops tauschii subsp. strangulata
35% identity, 23% coverage

• Identification of a UDP-glucosyltransferase conferring deoxynivalenol resistance in Aegilops tauschii and wheat
  Kirana, Plant biotechnology journal 2023
  • “...two gene classes wellknown as key players in DON resistance: a UDPglucosyltransferase ( AET5Gv20385300 , LOC109746039, at 250.105Mb) and two ABC transporters (ABC transporter G family member 41like isoform X1, AET5Gv20401700 : LOC109787618, at 261.730Mb; AET5Gv20401700 : LOC109787645 at 262.022Mb) (Table S7 ). Figure 3 k...”
  • “...contigs of the 5D AL8/78 reference sequence comprising the candidate genes UGT ( AET5Gv20385300 : LOC109746039) and two ABC transporters G family member ( AET5Gv20401700 : LOC109787618, AET5Gv20401700 : LOC109787645). Sequence alignments were generated with Geneious version 8.1 ( https://www.geneious.com ). The diversity analysis of the...”

WP_030163570 glycosyltransferase from Spirillospora albida
29% identity, 28% coverage

• Three enzymes involved in the N-methylation and incorporation of the pradimicin sugar moieties
  Napan, Bioorganic & medicinal chemistry letters 2015
  • “...The closest homologs found in GenBank are two GTs from Spirillospora albida (GenBank accession number WP_030163570, 414 aa, 61% identity) and Thermomonospora curvata (GenBank accession number WP_012855060, 418 aa, 62% identity), respectively. Again, none of these homologs are identified. Using a similar double crossover approach (...”

XP_002518725 scopoletin glucosyltransferase from Ricinus communis
24% identity, 76% coverage

• A genomic approach to study anthocyanin synthesis and flower pigmentation in passionflowers
  Aizza, Journal of nucleic acids 2011
  • “...1 e 95 82/94 GT PACEPE3030G03.g XP_002532899 UFGT Ricinus communis 6 e 31 53/70 PACEPS7021H07.g XP_002518725 UFGT Ricinus communis 8 e 57 56/72 GST PACEPE3013H01.g AF048978 GST Glycine Max 7 e 52 79/90 PACEPE3007A05.g XM_002519342 GST theta Ricinus communis 4 e 52 77/89 PACEPE3018F08.g ADB11335 GSTF7...”

U71C3_ARATH / Q9LML7 UDP-glycosyltransferase 71C3; EC 2.4.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
Q9LML7 scopoletin glucosyltransferase (EC 2.4.1.128) from Arabidopsis thaliana (see paper)
AAF82195.1 UDP-Glc: indole-3-carboxylic acid-, sinapoyl-alcohol-glucosyltransferase (UGT71C3;At1g07260/F10K1.3) (EC 2.4.1.-) (see protein)
AT1G07260 UGT71C3 (UDP-GLUCOSYL TRANSFERASE 71C3); UDP-glycosyltransferase/ quercetin 3-O-glucosyltransferase/ transferase, transferring glycosyl groups from Arabidopsis thaliana
36% identity, 24% coverage

• function: Possesses low quercetin 3-O-glucosyltransferase activity in vitro.
• Salicylic acid carboxyl glucosyltransferase UGT87E7 regulates disease resistance in Camellia sinensis
  Hu, Plant physiology 2022
  • “...UGT75B1 (At1g05560), CsUGT78A14 (ALO19888.1), CsUGT78A15 (ALO01989.1), CsUGT75L12 (ALO19892.1), CsUGT84A22 (ALO19890), UGT89A2 (At5g03490), UGT76D1 (At2g26480), UGT71C3 (At1g07260), UGT71C5 (OAP14418.1), UGT84A13 (AHA54051.1), UGT84B1 (At2g23260), UGT74E2 (At1g05680), UGT78K1 (ADC96620.1), UGT73C6 (OAP07438.1), UGT79B2 (At4g25750), and UGT79B3 (At4g27560). Supplemental data The following materials are available in the online version of this...”
• Development of dual reporter vector system for estimating translational activity of regulatory elements
  Suhorukova, BMC plant biology 2022
  • “...plant enhancers contrasting in their expression levels (deletion variants AT30, AT65, AT100, and AT208: AT5G46430, AT1G07260, AT1G67090, AT1G58420 of A. thaliana , respectively [ 7 ]), one long plant enhancer (GGR, geranyl-geranyl reductase enhanser) [ 5 ], and two synthetic enhancers (SynJ and SynM (MsynJ and...”
• UGT74AF3 enzymes specifically catalyze the glucosylation of 4-hydroxy-2,5-dimethylfuran-3(2H)-one, an important volatile compound in Camellia sinensis
  Chen, Horticulture research 2020
  • “...(ALO19888.1), CsUGT78A15 (ALO1989.1), CsUGT84A22 (ALO19890), FaGT2 (AY663785), CsUGT73A20 (ALO19886.1), UGT94P1 (ABB847093), UGT71K3 (XP 004294260.1), UGT71C3 (At1g07260), UGT74F1 (At2g43840), UGT74F2 (At2g43820), UGT74D1 (At2g31750), and UGT74E2 (At1g05680). Results Identification of HDMF glucoside in tea plants To study whether HDMF glycosides were present in tea plants, the metabolites in...”
  • “...CsUGT78A15 (ALO1989.1), CsUGT84A22 (ALO19890), FaGT2 (AY663785), CsUGT73A20 (ALO19886.1), UGT94P1 (ABB847093), UGT71K3 (XP 004294260.1), and UGT71C3 (At1g07260). The bar indicates a 0.1 amino acid substitution/site Residue 456 determines sugar-donor preference of UGT74AF3 Diversity in nucleotide sequences of glycosyltransferases leads to diversity in their functions 41 . The...”
• GbMYBR1 from Ginkgo biloba represses phenylpropanoid biosynthesis and trichome development in Arabidopsis
  Su, Planta 2020
  • “...synthase (ANS) AT5G61160 18.8 5.00E-05 Anthocyanin 5-aromatic acyltransferase 1 AT4G15280 13.7 0.0079 UDP-glucosyl transferase 71B5 AT1G07260 12.5 5.00E-05 UDP-glucosyl transferase 71C3 AT1G66390 9.1 5.00E-05 Production of anthocyanin pigment 2 protein (PAP2) AT1G33030 8.5 0.0006 O-methyltransferase family protein AT4G14090 6.4 5.00E-05 UDP-Glycosyltransferase superfamily protein AT1G56650 5.7 5.00E-05...”
• The dynamic response of the Arabidopsis root metabolome to auxin and ethylene is not predicted by changes in the transcriptome
  Hildreth, Scientific reports 2020
  • “...1.03 0.02 0.60 F3H* AT5G07990 250558_at 0.31 0.54 0.50 0.58 0.34 0.55 0.07 0.54 UGT71C3* AT1G07260 256053_at 0.01 0.36 0.43 0.30 0.11 0.43 0.64 0.65 Lipid Metabolism Fatty acid metabolism FAH1 AT2G34770 267318_at 0.23 0.16 0.55 0.92 0.88 0.56 0.37 0.48 ACC2* AT1G36180 256459_at 0.13 0.29...”
  • “...0.65 0.46 1.15 FLS1 AT5G08640 250533_at 0.60 0.48 0.23 0.07 0.08 0.03 0.18 0.67 UGT71C3* AT1G07260 256053_at 0.02 0.16 0.14 0.18 0.38 0.79 1.16 0.88 Lipid Metabolism Fatty acid metabolism ACC2* AT1G36180 256459_at 0.41 0.13 0.20 0.19 0.52 0.57 0.75 0.62 Phosphatidylcholine metabolism PLDEPSILON AT1G55180 259657_at...”
• Functional characterization of genes mediating cell wall metabolism and responses to plant cell wall integrity impairment
  Engelsdorf, BMC plant biology 2019
  • “..., SQP2 , [ 59 ]) and At5g49360 ( BETA-XYLOSIDASE1, ATBXL1 , [ 60 ]), At1g07260 ( UGT71C3 , [ 61 ]), At1g74440 [ 62 ], At2g35730 [ 55 , 63 ] , At3g13650 (DIRIGENT PROTEIN 7 , DIR7 , [ 54 ] ) and At4g33300...”
• Key Components of Different Plant Defense Pathways Are Dispensable for Powdery Mildew Resistance of the Arabidopsis mlo2 mlo6 mlo12 Triple Mutant
  Kuhn, Frontiers in plant science 2017
  • “...- 3.8 - yes AT1G30135 JAZ8 (Jasmonate-Zim-domain protein 8) - 2.7 yes b - b AT1G07260 UGT71C3 (UDP-glycosyltransferase 71C3) 1.3 2.6 - yes AT4G08770 Peroxidase, putative 1.7 2.6 yes yes AT4G24350 Phosphorylase family protein - 2.3 yes yes AT1G51760 JR3 (Jasmonic Acid Responsive 3) - 2.3...”
• A hydrophobic proline-rich motif is involved in the intracellular targeting of temperature-induced lipocalin
  Hernández-Gras, Plant molecular biology 2015
  • “...(PPPP). In addition to AtTIL, the list includes six members of the UDPG-glucosyltransferase family (At1g07250, At1g07260, At1g22380, At2g29740, At3g21790, and At4g01070), one member of the hydroxyproline-rich glycoprotein family protein (At1g14710), one splicing factor-PWI domain-containing protein (At1g60200), one member of the galactose oxidase/kelch repeat superfamily protein (At1g55270)...”
• More

LOC115065792 UDP-glucosyltransferase 2 from Bactrocera dorsalis
27% identity, 24% coverage

• AANAT1 regulates insect midgut detoxification through the ROS/CncC pathway
  Zeng, Communications biology 2024
  • “...(GstE4) , LOC105229682 (GstE7) , LOC105229681 (GstE9) , LOC105233810 (Cyp6g2) , LOC105224660 (UGT36-D1) , and LOC115065792 (UGT49-C1) to vitamin C treatment. l Effect of vitamin C treatment on flies to trichlorphon. SS, sensitive strain, VC, vitamin C. Ten-day old adults mixed with the same number of...”

AAB19791.1 Glucuronosyltransferase 1A2 (Ugt1a2) (EC 2.4.1.17) (see protein)
28% identity, 30% coverage

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.