PaperBLAST

PaperBLAST Hits for biolip::3mp8A Crystal structure of sgf29 tudor domain () (513 a.a., MKIEEGKLVI...)

Show query sequence

>biolip::3mp8A Crystal structure of sgf29 tudor domain ()
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDE
ALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGT
RFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVI
GTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP

Running BLASTp...

Found 253 similar proteins in the literature:

3mp8A / P0AEX9,P25554 Crystal structure of sgf29 tudor domain (see paper)
100% identity, 100% coverage

• Ligands: alpha-d-glucopyranose; 4-(hydroxymethyl)benzamidine (3mp8A)

1hsjA / P0AEX9,Q9F0R1 Sarr mbp fusion structure (see paper)
100% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (1hsjA)

4xajB / P0AEX9,Q9Y466 Crystal structure of human nr2e1/tlx (see paper)
98% identity, 66% coverage

• Ligand: alpha-d-glucopyranose (4xajB)

4xaiA / P0AEY0,Q9NCL0 Crystal structure of red flour beetle nr2e1/tlx (see paper)
98% identity, 67% coverage

• Ligands: peptide; alpha-d-glucopyranose (4xaiA)

4h1gA / C4YKK8,P0AEX9 Structure of candida albicans kar3 motor domain fused to maltose- binding protein (see paper)
99% identity, 56% coverage

• Ligands: alpha-d-glucopyranose; adenosine-5'-diphosphate (4h1gA)

4ozqB / L0N7N1 Crystal structure of the mouse kif14 motor domain (see paper)
100% identity, 54% coverage

• Ligand: adenosine-5'-diphosphate (4ozqB)

4my2A / P0AEX9,Q00604 Crystal structure of norrin in fusion with maltose binding protein (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (4my2A)

4kegA / P0AEX9,Q9NP55 Crystal structure of mbp fused human splunc1
100% identity, 69% coverage

• Ligand: magnesium ion (4kegA)

4qszA / P0AEX9,P0C872 Crystal structure of mouse jmjd7 fused with maltose-binding protein
99% identity, 55% coverage

• Ligand: alpha-d-glucopyranose (4qszA)

9dh3A / P0AEX9,Q96P20 9dh3A (see paper)
99% identity, 31% coverage

• Ligands: adenosine-5'-diphosphate; 2-[(4s)-5-ethyl-8-oxothieno[2',3':4,5]pyrrolo[1,2-d][1,2,4]triazin-7(8h)-yl]-n-(pyrimidin-4-yl)acetamide (9dh3A)

5fsgA / P05133,P0AEX9 Structure of the hantavirus nucleoprotein provides insights into the mechanism of RNA encapsidation and a template for drug design (see paper)
97% identity, 57% coverage

• Ligand: alpha-d-glucopyranose (5fsgA)

8h68A / P0AEX9,Q8MNT9 Crystal structure of caenorhabditis elegans nmad-1 in complex with nog and mg(ii) (see paper)
98% identity, 60% coverage

• Ligands: alpha-d-glucopyranose; glycine; magnesium ion (8h68A)

4rwfA / O60895,P0AEX9,Q16602 Crystal structure of the clr:ramp2 extracellular domain heterodimer with bound adrenomedullin (see paper)
99% identity, 68% coverage

• Ligands: peptide; alpha-d-glucopyranose (4rwfA)

6zhoA / O60894,P0AEX9,Q16602 Crystal structure of a cgrp receptor ectodomain heterodimer with bound high affinity inhibitor (see paper)
97% identity, 66% coverage

• Ligands: alpha-d-glucopyranose; ~{n}-[(2~{r})-3-(7-methyl-2~{h}-indazol-5-yl)-1-oxidanylidene-1-[[(2~{s})-1-oxidanylidene-3-piperidin-4-yl-1-(4-pyridin-4-ylpiperazin-1-yl)propan-2-yl]amino]propan-2-yl]-2-oxidanylidene-spiro[1~{h}-pyrido[2,3-d][1,3]oxazine-4,4'-piperidine]-1'-carboxamide (6zhoA)

7e29A / P0AEX9,Q04213 Crystal structure of saccharomyces cerevisiae ioc4 pwwp domain fused with mbp (see paper)
99% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (7e29A)

5c7rA / P0AEX9 Revealing surface waters on an antifreeze protein by fusion protein crystallography (see paper)
99% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (5c7rA)

7b01A / P0AEX9,Q76LX8 Adamts13-cub12 (see paper)
99% identity, 63% coverage

• Ligand: alpha-d-glucopyranose (7b01A)

3f5fA / P0AEX9,Q76KB1 Crystal structure of heparan sulfate 2-o-sulfotransferase from gallus gallus as a maltose binding protein fusion. (see paper)
99% identity, 57% coverage

• Ligands: alpha-d-glucopyranose; adenosine-3'-5'-diphosphate (3f5fA)

5eduB / P0AEX9,Q9UBN7 Crystal structure of human histone deacetylase 6 catalytic domain 2 in complex with trichostatin a (see paper)
100% identity, 51% coverage

• Ligands: alpha-d-glucopyranose; trichostatin a; zinc ion (5eduB)

7kd4A / P0AEX9,Q91MK1 Structure of thE C-terminal domain of the menangle virus phosphoprotein (residues 329 -388), fused to mbp. Space group p21. (see paper)
99% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (7kd4A)

6dd5A / F2K1V9,P0AEX9 Crystal structure of the cas6 domain of marinomonas mediterranea mmb-1 cas6-rt-cas1 fusion protein (see paper)
98% identity, 58% coverage

• Ligand: alpha-d-glucopyranose (6dd5A)

1r6zZ / P0AEX9,Q9VUQ5 The crystal structure of the argonaute2 paz domain (as a mbp fusion) (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (1r6zZ)

6gfjA / O43353 Structure of rip2 card domain fused to crystallisable mbp tag (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6gfjA)

7wr3A / A0A0H2US87,P0AEX9 Crystal structure of mbp-fused ospc3 in complex with calmodulin (see paper)
98% identity, 47% coverage

• Ligands: alpha-d-glucopyranose; nicotinamide (7wr3A)

5jonA / O88703,P0AEY0 Crystal structure of the unliganded form of hcn2 cnbd (see paper)
89% identity, 83% coverage

• Ligand: alpha-d-glucopyranose (5jonA)

8r2oB / A0A4P1LXE0,P42858 Huntingtin-q17, 1-66, n-mbp fusion
100% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (8r2oB)

6anvA / L7P7M1,P0AEX9 Crystal structure of anti-crispr protein acrf1 (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6anvA)

4edqA / O70468,P0AEX9 Mbp-fusion protein of myosin-binding protein c residues 149-269
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (4edqA)

3n96A / P0AEX9,Q13324 Crystal structure of human crfr2 alpha extracellular domain in complex with urocortin 1
99% identity, 73% coverage

• Ligands: peptide; alpha-d-glucopyranose (3n96A)

2xz3A / P0AEX9,Q90M13 Blv tm hairpin (see paper)
100% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (2xz3A)

4nufA / P0AEX9,Q62227 Crystal structure of shp/eid1 (see paper)
87% identity, 78% coverage

• Ligands: peptide; alpha-d-glucopyranose (4nufA)

3d4gE / P0AEX9,P10761 Zp-n domain of mammalian sperm receptor zp3 (crystal form ii) (see paper)
100% identity, 72% coverage

• Ligands: alpha-d-glucopyranose; calcium ion (3d4gE)

4bl8B / P0AEX9,Q9UMX1 Crystal structure of full-length human suppressor of fused (sufu) (see paper)
99% identity, 51% coverage

• Ligand: alpha-d-glucopyranose (4bl8B)

7uajB / P03126,P0AEX9 Crystal structure of apo hpv16 e6
99% identity, 72% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (7uajB)

3dm0A / O24456,P0AEX9 Maltose binding protein fusion with rack1 from a. Thaliana (see paper)
99% identity, 55% coverage

• Ligand: alpha-d-glucopyranose (3dm0A)

1y4cA / P0AEX9 Designed helical protein fusion mbp (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (1y4cA)

3o3uN / P0AEX9,Q15109 Crystal structure of human receptor for advanced glycation endproducts (rage) (see paper)
100% identity, 64% coverage

• Ligand: alpha-d-glucopyranose (3o3uN)

4pqkB / B1B3N6,P0AEX9 C-terminal domain of DNA binding protein (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (4pqkB)

3l2jA / P0AEX9,Q03431 Dimeric structure of the ligand-free extracellular domain of the human parathyroid hormone receptor (pth1r) (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (3l2jA)

3n94A / P0AEX9,P41586 Crystal structure of human pituitary adenylate cyclase 1 receptor- short n-terminal extracellular domain (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (3n94A)

6pfoA / P30988 Crystal structure of n-glycosylated human calcitonin receptor extracellular domain in complex with salmon calcitonin (16-32) (see paper)
99% identity, 73% coverage

• Ligands: peptide; alpha-d-glucopyranose (6pfoA)

6sjvA / P06463,Q05086 Structure of hpv18 e6 oncoprotein in complex with mutant e6ap lxxll motif
99% identity, 70% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (6sjvA)

5jstB / A6ZQL5,P0AEX9 Mbp fused mdv1 coiled coil (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (5jstB)

6k7fA / P0AEX9,P53220 Crystal structure of mbpholo-tim21 fusion protein with a 17-residue helical linker (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6k7fA)

5cfvA / P0AEX9 Fusion of maltose-binding protein and pila from acinetobacter nosocomialis m2 (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (5cfvA)

6smvA / P0AEX9,P36813,Q92585 Structure of hpv49 e6 protein in complex with maml1 lxxll motif
99% identity, 71% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (6smvA)

8c5lB / P0AEX9,P10588 Nr2f6 ligand binding domain in complex with nsd1 peptide
98% identity, 67% coverage

• Ligands: peptide; alpha-d-glucopyranose (8c5lB)

6slmA / P0AEX9,P17386,Q05086 Crystal structure of full-length hpv31 e6 oncoprotein in complex with lxxll peptide of ubiquitin ligase e6ap (see paper)
99% identity, 69% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (6slmA)

2vgqA / P0AEX9,Q7Z434 Crystal structure of human ips-1 card (see paper)
98% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (2vgqA)

4egcA / P0AEX9,Q15475 Crystal structure of mbp-fused human six1 bound to human eya2 eya domain (see paper)
99% identity, 69% coverage

• Ligand: alpha-d-glucopyranose (4egcA)

3woaA / P03034,P0AEX9 Crystal structure of lambda repressor (1-45) fused with maltose- binding protein (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (3woaA)

1mg1A / P0AEX9 Htlv-1 gp21 ectodomain/maltose-binding protein chimera (see paper)
100% identity, 71% coverage

• Ligand: alpha-d-glucopyranose (1mg1A)

3h4zA / P0AEX9,P49273 Crystal structure of an mbp-der p 7 fusion protein (see paper)
98% identity, 65% coverage

• Ligand: alpha-d-glucopyranose (3h4zA)

5azaA / I6V0B8,P0AEX9 Crystal structure of mbp-saglb fusion protein with a 20-residue spacer in the connector helix (see paper)
99% identity, 44% coverage

• Ligands: alpha-d-glucopyranose; calcium ion (5azaA)

5tj4E / Q8TAX9 Gasdermin-b c-terminal domain containing the polymorphism residues gly299:pro306 fused to maltose binding protein (see paper)
98% identity, 67% coverage

• Ligand: alpha-d-glucopyranose (5tj4E)

8g3sA / Q07820 Mbp-mcl1 in complex with ligand 11 (see paper)
99% identity, 71% coverage

• Ligands: alpha-d-glucopyranose; (1's,3as,5r,16r,17s,19e,21s,21ar)-6'-chloro-21-methoxy-16,17-dimethyl-2,3,3',3a,4',16,17,18,21,21a-decahydro-2'h,6h,8h-15lambda~6~-spiro[10,12-etheno-15lambda~6~-furo[3,2-i][1,4]oxazepino[3,4-f][1,2,7]thiadiazacyclohexadecine-7,1'-naphthalene]-13,15,15(4h,14h)-trione (8g3sA)

9gekA / Q969Z0 Structure of the fast1-fast2-rap module from human fastkd4 by carrier- driven crystallisation with maltose binding protein from e. Coli. (see paper)
88% identity, 62% coverage

• Ligands: beta-d-fructofuranose; alpha-d-glucopyranose (9gekA)

4kv3A / P0AEX9 Ubiquitin-like domain of the mycobacterium tuberculosis type vii secretion system protein eccd1 as maltose-binding protein fusion (see paper)
100% identity, 71% coverage

• Ligand: alpha-d-glucopyranose (4kv3A)

6x91A / P0AEX9,P41238 Crystal structure of mbp-fused human apobec1 (see paper)
98% identity, 63% coverage

• Ligand: alpha-d-glucopyranose (6x91A)

5t05B / P0AEX9 Crystal structure of heparan sulfate 6-o-sulfotransferase with bound pap and idoa2s containing hexasaccharide substrate (see paper)
98% identity, 55% coverage

• Ligands: 2-deoxy-2-(sulfoamino)-alpha-d-glucopyranose; beta-d-glucopyranuronic acid; alpha-d-glucopyranose; adenosine-3'-5'-diphosphate (5t05B)

MalE / b4034 maltose ABC transporter periplasmic binding protein (EC 7.5.2.1) from Escherichia coli K-12 substr. MG1655 (see 50 papers)
MalE / P0AEX9 maltose ABC transporter periplasmic binding protein (EC 7.5.2.1) from Escherichia coli (strain K12) (see 74 papers)
MALE_ECOLI / P0AEX9 Maltose/maltodextrin-binding periplasmic protein; MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP from Escherichia coli (strain K12) (see 5 papers)
P0AEX9 ABC-type maltose transporter (subunit 1/4) (EC 7.5.2.1) from Escherichia coli (see paper)
P0AEY0 single-stranded DNA cytosine deaminase (EC 3.5.4.38) from Escherichia coli O157:H7 (see paper)
TC 3.A.1.1.1 / P0AEX9 Maltose-binding periplasmic protein MalE aka B4034, component of Maltooligosaccharide porter. The 3-D structure has been reported by Oldham et al. (2007). An altering access mechanism has been suggested for the maltose transporter resulting from rigid-body rotations (Khare et al., 2009). Bordignon et al. (2010) and Schneider et al. (2012) have reviewed the extensive knowledge available on MalEFGK2, its mode of action and its regulatory interactions from Escherichia coli (see 12 papers)
malE / RF|NP_418458 maltose-binding periplasmic protein from Escherichia coli K12 (see 14 papers)
b4034 maltose ABC transporter periplasmic protein from Escherichia coli str. K-12 substr. MG1655
NP_418458 maltose ABC transporter periplasmic binding protein from Escherichia coli str. K-12 substr. MG1655
Z5632 periplasmic maltose-binding protein; substrate recognition for transport and chemotaxis from Escherichia coli O157:H7 EDL933
99% identity, 71% coverage

• function: Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Binds maltose and higher maltodextrins such as maltotriose.
  subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE).
• substrates: Maltooligosaccharides, Maltose
  tcdb comment: The transporter sequesters the MalT transcriptional activator at the cytoplasmic surface of the membrane in the absence of the transport substrate (Richet et al. 2012). The crystal structures of the transporter complex MBP-MalFGK2 bound with large malto-oligosaccharide in two different conformational states have also been determined. In the pretranslocation structure,Oldham et al. 2013 found that the transmembrane subunit MalG forms two hydrogen bonds with malto-oligosaccharide at the reducing end. In the outward-facing conformation, the transmrembrane subunit MalF binds three glucosyl units from the nonreducing end. These structural features explain why large modified malto-oligosaccharides are not transported by MalFGK2 despite their high binding affinity to MBP. In the transport cycle, substrate is channeled from MBP into the transmembrane pathway with a polarity such that both MBP and MalFGK2 contribute to the overall substrate selectivity of the system (Oldham et al. 2013). Stabilization of the semi-open MalK2 conformation by maltose-bound MBP is key to the coupling of maltose transport to ATP hydrolysis in vivo, because it facilitates the progression of the MalK dimer from the open to the semi-open conformation, from which it can proceed to hydrolyze ATP (Alvarez et al. 2015). Both the binding of MalE to the periplasmic side of the transmembrane complex and binding of ATP to MalK2 are necessary to facilitate the conformational change from the inward-facing state to the occluded state, in which MalK2 is completely dimerized (Hsu et al. 2017). An integrated transport mechanism of the maltose ABC importer has been proposed (Mächtel et al. 2019)
• CyuR is a dual regulator for L-cysteine dependent antimicrobial resistance in Escherichia coli
  Rodionova, Communications biology 2024
  • “...GtATAAAaTaCcGCcATTTggCC 2.2 3.7 22 argC b3958 Arginine biosynthesis 182 4.76 cGATAAATgGCgGtAATTTgTTt - 1.9 23 malE b4034 Maltose ABC transporter 178 4.93 GcAaAAATcGTgGCgATTTtaTg 1.4 1.8 24 malK b4035 Maltose ABC transporter 209 4.93 cAtaAAATcGCcACgATTTtTgC 2.7 3.9 25 prfC b4375 Peptide chain release factor 3 71 5.53 GGtaAAATaGCcGCAATTTtTCg...”
• A systems approach discovers the role and characteristics of seven LysR type transcription factors in Escherichia coli
  Rodionova, Scientific reports 2022
  • “...5.8 b2971 yghG Lipoprotein YghG 3.4 5.8 b4380 yjjI DUF3029 domain-containing protein YjjI 128.5 5.7 b4034 malE Maltose ABC transporter periplasmic binding protein 402.0 5.7 b2997 hybO Hydrogenase 2 small subunit 245.6 5.7 b1241 adhE aldehyde-alcohol dehydrogenase 8441.5 5.7 b1925 fliS Flagellar biosynthesis protein FliS 134.0...”
• Chaperonin Abundance Enhances Bacterial Fitness
  Kumar, Frontiers in molecular biosciences 2021
  • “...MMBP, Maltodextrin-binding protein 43.3 5.22 13 51.77 Five Hetero-pentamer G c.94.1.1 18.23 (Stable) Periplasmic malE (b4034) 0 LACI_ECOLI (P03023) Lactose operon repressor (LacI) 38.5 6.39 24 80.28 Five Homo-tetramer K c.93.1.1; a.35.1.5 37.37 (Stable) Cytoplasm lacI (b0345) 0 5.7 MANA_ECOLI (P00946) Mannose-6-phosphate isomerase (EC:5.3.1.8), Phosphohexomutase, Phosphomannose...”
• Construction of an Escherichia coli Strain Lacking Fimbriae by Deleting 64 Genes and Its Application for Efficient Production of Poly(3-Hydroxybutyrate) and l-Threonine
  Qiao, Applied and environmental microbiology 2021
  • “...gatD 6.542079 Galactitol metabolic process b4665 ibsC 6.528019 Toxic peptide b4245 pyrB 6.523107 UMP biosynthesis b4034 malE 6.452172 Maltose ABC transporter protein b1153 ymfQ 6.209994 Uncharacterized protein b1977 asnT 6.209994 tRNA-Asn b3882 yihU 6.209994 NAD binding Downregulated b4009 rrlE 15.6541 23S ribosomal RNA b1544 ydfK 9.85026...”
• Tracing the phylogenetic history of the Crl regulon through the Bacteria and Archaea genomes
  Santos-Zavaleta, BMC genomics 2019
  • “...IMP cell-cell signaling involved in quorum sensing, L-methionine biosynthetic process from S-adenosylmethionine, quorum sensing malE b4034 malE FG CRP(+), CreB(), Fis(+), MalT(+) + GEA, IMP [ 11 ] cellular response to DNA damage stimulus, carbohydrate transport, maltose transport, detection of maltose stimulus, maltodextrin transport, cell chemotaxis...”
• Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
  Franchini, PloS one 2015
  • “...b4033 part of maltose permease, periplasmic 6.9 malE c , f , g , i b4034 periplasmic maltose-binding protein 7.5 malK c , f , g , i b4035 ATP-binding component of transport system for maltose 4.2 lamB c , f , g , i b4036...”
• Global transcriptomic analysis of an engineered Escherichia coli strain lacking the phosphoenolpyruvate: carbohydrate phosphotransferase system during shikimic acid production in rich culture medium
  Cortés-Tolalpa, Microbial cell factories 2014
  • “...receptor Transport 18.0411 livK b3458 Leucine ABC transporter - periplasmic binding protein Transport 6.0726 malE b4034 Maltose ABC transporter - periplasmic binding protein Transport 174.0512 malF b4033 Maltose ABC transporter - membrane subunit Transport 19.1719 malK b4035 Maltose ABC transporter - ATP binding subunit Transport 14.8026...”
  • “...ABC binding subunit Transport 32.6107 fecA b4291 Polypeptide: ferric citrate OMP FecA Transport 23.6130 malE b4034 Maltose ABC transporter - periplasmic binding protein Transport 230.4651 ompC b2215 Transporter: OMP C Transport 61.2832 oppB b1244 Polypeptide: murein tripeptide ABC transporter/peptide ABC transporter - putative membrane subunit Transport...”
• Enhancing E. coli tolerance towards oxidative stress via engineering its global regulator cAMP receptor protein (CRP)
  Basak, PloS one 2012
  • “...2 Fold Change>2.0). Regulator b number Gene Log 2 Fold Change CRP b4036 lamB 4.780 b4034 malE * 4.257 b0598 cstA * 5.093 RpoS b3517 gadA * 7.766 b1493 gadB 7.096 b1492 gadC 7.024 b1732 katE * 3.801 b1482 osmC 2.755 b4376 osmY 3.062 b1896 otsA...”
  • “...2 Fold Change>2.0). Regulator b number Gene Log 2 Fold Change CRP b4036 lamB 8.997 b4034 malE * 8.930 b4035 malK 8.502 RpoS b3517 gadA * 4.517 b1493 gadB 4.571 b1732 katE * 2.701 b1896 otsA * 2.581 * - Analyzed by qRT-PCR ( Table S4...”
• More
• A useful epitope tag derived from maltose binding protein.
  Lénon, Protein science : a publication of the Protein Society 2021
  • GeneRIF: A useful epitope tag derived from maltose binding protein.
• Stability of Ligand-induced Protein Conformation Influences Affinity in Maltose-binding Protein.
  van, Journal of molecular biology 2021 (PubMed)
  • GeneRIF: Stability of Ligand-induced Protein Conformation Influences Affinity in Maltose-binding Protein.
• Folding of maltose binding protein outside of and in GroEL.
  Ye, Proceedings of the National Academy of Sciences of the United States of America 2018
  • GeneRIF: Upon refolding, MBP initially collapses into a dynamic molten globule-like ensemble, then forms an obligatory on-pathway native-like folding intermediate that brings together sequentially remote segments and then folds globally after a long delay.
• Full engagement of liganded maltose-binding protein stabilizes a semi-open ATP-binding cassette dimer in the maltose transporter.
  Alvarez, Molecular microbiology 2015
  • GeneRIF: Maltose Binding Protein is key to the coupling of maltose transport to ATP hydrolysis in vivo, because it facilitates the progression of the MalK dimer from the open to the semi-open conformation, from which it can proceed to hydrolyze ATP
• Escherichia coli maltose-binding protein activates mouse peritoneal macrophages and induces M1 polarization via TLR2/4 in vivo and in vitro.
  Ni, International immunopharmacology 2014 (PubMed)
  • GeneRIF: activates mouse macrophages and polarizes them into M1 macrophages
• Kinetics and energetics of the translocation of maltose binding protein folding mutants.
  Tomkiewicz, Journal of molecular biology 2008 (PubMed)
  • GeneRIF: These data indicate that unfolding of the mature domain of preMBP is likely not a rate-determining step in translocation when the protein is targeted to the translocase via SecB.
• Escherichia coli tat mutant strains are able to transport maltose in the absence of an active malE gene.
  Caldelari, Archives of microbiology 2008 (PubMed)
  • GeneRIF: tat mutants are able to transport maltose in the absence of malE.
• Maltose binding protein (MalE) interacts with periplasmic loops P2 and P1 respectively of the MalFG subunits of the maltose ATP binding cassette transporter (MalFGK(2)) from Escherichia coli/Salmonella during the transport cycle.
  Daus, Molecular microbiology 2007 (PubMed)
  • GeneRIF: substrate availability is communicated from MalE to the MalK dimer via extracytoplasmic loops of MalFG
• More
• Expression, purification, and characterization of diacylated Lipo-YcjN from Escherichia coli
  Treviño, The Journal of biological chemistry 2024
  • “...amino acid sequence of MBP was obtained from E.coli K-12 (gene ID 948538; UniProt ID P0AEX9). In this construct, residues 1 to 26 encoding the SP were replaced with a 6H. All proteins were expressed in E.coli BL21 (DE3) gold cells (Agilent Technologies) using ZYM-5052 autoinduction...”
• Synthetic intrinsically disordered protein fusion tags that enhance protein solubility
  Tang, Nature communications 2024
  • “...of MBP-mTdT and SUMO-mTdT genes Genes from MBP and SUMO were identified from UniProt (Accession: P0AEX9 and B7G0R2, respectively) and codon optimized for E . coli expression with a His 6 tag at the N-terminus. The resulting genes were cloned into a pET-24a vector via Gibson...”
• Expression, purification, and characterization of diacylated Lipo-YcjN from Escherichia coli.
  Treviño, bioRxiv : the preprint server for biology 2024
  • “...acid sequence of MBP was obtained from E. coli K-12 (gene ID 948538; UniProt ID P0AEX9). In this construct, residues 1-26 encoding the SP were replaced with a 6H. All proteins were expressed in E. coli BL21 (DE3) gold cells (Agilent, USA) using ZYM-5052 autoinduction media...”
• Optimized Signal Peptide for Secretory Expression of Human Recombinant Somatropin in E. coli
  Ahmadi, Advanced pharmaceutical bulletin 2023
  • “...Escherichia coli (strain K12) P0ADV1 MKFKTNKLSLNLVLASSLLAASIPAFA Maltose-binding periplasmic protein malE 26 Escherichia coli (strain K12) P0AEX9 MKIKTGARILALSALTTMMFSASALA Penicillin-insensitive murein endopeptidase mepA 19 Escherichia coli O157:H7 Q8XCQ5 MNKTAIALLALLASSVSLA Nickel-binding periplasmic protein nikA 22 Escherichia coli (strain K12) P33590 MLSTLRRTLFALLACASFIVHA Cytochrome c-552 nrfA 26 Escherichia coli (strain K12...”
• Iron-sulfur clusters are involved in post-translational arginylation
  Van, Nature communications 2023
  • “...additionally engineered DNA sequence encoding for an N-terminal maltose-binding protein sequence (based on Uniprot ID P0AEX9 : Escherichia coli (K-12) malE gene product) followed by a Tobacco Etch Virus (TEV)-protease cleavage site, was synthesized. For the former approach, the gene was subcloned into the pET-21a(+) expression...”
  • “...; Caenorhabditis elegans ATE1, P90914 ; S. cerevisiae ATE1, P16639 ; Escherichia coli maltose-binding protein, P0AEX9 ; and Escherichia coli ArgRS, P11875 . All unique biological materials (e.g., expression plasmids) are readily available from the authors upon request. Competing interests The authors declare no competing interests....”
• Biodistribution of ⁸⁹Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
  Li, Poultry science 2023
  • “...biogenesis Periplasm 24 P45565 AIS Function unknown Periplasm 25 P28249 ASMA Function unknown Periplasm 26 P0AEX9 MALE Carbohydrate transport and metabolism Periplasm 27 P0AFK9 POTD Amino acid transport and metabolism Periplasm 28 P0AFL3 PPIA Posttranslational modification, protein turnover, chaperones Periplasm 29 P21170 SPEA Amino acid transport...”
• Different Strategies Affect Enzyme Packaging into Bacterial Outer Membrane Vesicles.
  Dean, Bioengineering (Basel, Switzerland) 2023
  • “...protein for the vitamin B12 transporter BtuCD P37028 No [ 26 ] MBP Maltose-binding protein P0AEX9 No [ 25 ] SLP Outer membrane lipoprotein; SLP may help to stabilize the outer membrane in stationary phase P37194 Yes [ 24 ] SlyB Small outer membrane lipoprotein conserved...”
• Experimental Investigations on the Structure of Yeast Mitochondrial Pyruvate Carriers
  Li, Membranes 2022
  • “...methionine residues of MBP, all of the methionine residues in the MBP sequence (K27-T392, Uniprot: P0AEX9) were modified to leucine (MBP) ( Figure 1 ). Meanwhile, the methionine residue M42 in ScMPC2 was mutated to alanine. In addition, the adjacent amino acid S2 in ScMPC2 to...”
• More
• FG/FxFG as well as GLFG repeats form a selective permeability barrier with self-healing properties
  Frey, The EMBO journal 2009
  • “...To address these questions, we chose MBP-mCherry, a 70-kDa fusion between the maltose-binding protein (SwissProt P0AEY0) and the monomeric red fluorescent protein mCherry ( Shaner et al , 2004 ) as an inert permeation probe, and the FG/FxFG repeat domain from Nsp1p ( Hurt, 1988 )...”
• Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
  Segura, BMC genomics 2018
  • “...2.00 7.53E-03 Z4347 hybD Hydrogenase maturation protease 3.39 1.11E-06 2.33 1.68E-03 2.22 2.74E-03 NDE NDE Z5632 malE Maltose/maltodextrin transport system (substrate-binding protein) NDE 3.22 4.60E-05 NDE 2.41 3.70E-03 NDE Z5631 malF Maltose/maltodextrin transport system (permease protein) NDE 2.71 9.82E-06 NDE NDE NDE Z5630 malG Maltose/maltodextrin transport...”

8tlxA / P0AEX9,P42568 Crystal structure of mbp and af9 ahd fusion protein 3aqa in complex with peptidomimetic inhibitor 21a (see paper)
99% identity, 72% coverage

• Ligands: peptide; alpha-d-glucopyranose (8tlxA)

3ob4A / A5Z1Q8,P0AEX9 Mbp-fusion protein of the major peanut allergen ara h 2 (see paper)
97% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (3ob4A)

7cy6A / A0A2K3D5Z7,P0AEX9 Crystal structure of cmd1 in complex with 5mc-DNA (see paper)
96% identity, 44% coverage

• Ligands: dna; fe (ii) ion (7cy6A)

5w0rA / P0AEX9,Q9GZX7 Crystal structure of mbp fused activation-induced cytidine deaminase (aid) in complex with cacodylic acid (see paper)
98% identity, 68% coverage

• Ligands: zinc ion; calcium ion (5w0rA)

5hz7A / P0AEX9 High-resolution crystal structure of the minor DNA-binding pilin comp from neisseria meningitidis in fusion with mbp (see paper)
98% identity, 72% coverage

• Ligands: alpha-d-glucopyranose; beta-d-glucopyranose (5hz7A)

4ikmA / P0AEX9,Q9Y2G2 X-ray structure of card8 card domain (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (4ikmA)

3oaiA / P0AEX9,P25189 Crystal structure of the extra-cellular domain of human myelin protein zero (see paper)
93% identity, 74% coverage

• Ligand: alpha-d-glucopyranose (3oaiA)

5y2gA / P09879,P0AEX9 Structure of mbp tagged gbs camp (see paper)
98% identity, 63% coverage

• Ligand: alpha-d-glucopyranose (5y2gA)

5ygsD / P0AEX9,Q93038 Human tnfrsf25 death domain (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (5ygsD)

3py7A / P06931,P0AEX9 Crystal structure of full-length bovine papillomavirus oncoprotein e6 in complex with ld1 motif of paxillin at 2.3a resolution (see paper)
99% identity, 72% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (3py7A)

EcolC_3995 extracellular solute-binding protein from Escherichia coli C str. ATCC 8739
99% identity, 71% coverage

• A novel point mutation in RpoB improves osmotolerance and succinic acid production in Escherichia coli
  Xiao, BMC biotechnology 2017
  • “...in RpoBD645Y, their expression maintained stable under osmotic stress. For example, transcript levels of malE (EcolC_3995), malF (EcolC_3996), malG (EcolC_3997) malK (EcolC_3994), and lamB (EcolC_3993), which encode individual subunits of the maltose ABC (ATP-binding cassette) transporter, decreased 10- to 14- fold in Suc-T110 compared to the...”

5z0rB / P0AEX9,Q32ZE1 Structural insight into the zika virus capsid encapsulating the viral genome (see paper)
99% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (5z0rB)

6d67A / P0AEX9,P28562 Crystal structure of the human dual specificity phosphatase 1 catalytic domain (c258s) as a maltose binding protein fusion (maltose bound form) in complex with the designed ar protein mbp3_16 (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6d67A)

5az7A / P0AEX9,Q62760 Crystal structure of mbp-tom20 fusion protein with a 4-residue spacer in the connector helix (see paper)
99% identity, 71% coverage

• Ligand: alpha-d-glucopyranose (5az7A)

3vd8A / O14862,P0AEY0 Crystal structure of human aim2 pyd domain with mbp fusion (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (3vd8A)

3a3cA / P0AEX9,P36046 Crystal structure of tim40/mia40 fusing mbp, c296s and c298s mutant (see paper)
93% identity, 76% coverage

• Ligand: alpha-d-glucopyranose (3a3cA)

8jyxA / P0AEX9,Q7SBA0 Crystal structure of the gasdermin-like protein rcd-1-1 from neurospora crassa (see paper)
98% identity, 65% coverage

• Ligand: alpha-d-glucopyranose (8jyxA)

4exkA / A0A0F6B1U8,P0AEX9 A chimera protein containing mbp fused to thE C-terminal domain of the uncharacterized protein stm14_2015 from salmonella enterica
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (4exkA)

7vn2C / P0AEX9,Q8S307 Crystal structure of mbp-fused bil1/bzr1 (21-90) in complex with double-stranded DNA contaning atcacgtgat (see paper)
98% identity, 72% coverage

• Ligands: dna; alpha-d-glucopyranose (7vn2C)

6xdjA / P22579 Crystal structure analysis of mbp-sin3
98% identity, 72% coverage

• Ligands: beta-d-glucopyranose; alpha-d-glucopyranose (6xdjA)

6xrxA / P0AEX9,Q8T5C5 Crystal structure of the mosquito protein az1 as an mbp fusion (see paper)
97% identity, 68% coverage

• Ligand: alpha-d-glucopyranose (6xrxA)

E2348C_4349 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Escherichia coli O127:H6 str. E2348/69
98% identity, 71% coverage

• Microarray analysis of the Ler regulon in enteropathogenic and enterohaemorrhagic Escherichia coli strains
  Bingle, PloS one 2014
  • “...rorf1 hypothetical protein LEE E2348C_4274 2 - predicted transporter E2348C_4348 2 malF maltose transporter subunit E2348C_4349 2 malE maltose transporter subunit E2348C_4350 3 malK maltose transporter subunit E2348C_4351 3 lamB maltose outer membrane porin (maltoporin) E2348C_4442 3 eptA predicted metal dependent hydrolase EptA pMAR2_096 3 -...”

6i4yA / O43715,P0AEX9 X-ray structure of the human mitochondrial prelid3b-triap1 complex (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6i4yA)

6ki0A / P0AEX9,Q9ULZ3 Crystal structure of human asc-card (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6ki0A)

5h7nB / P0AEX9,P59046 Crystal structure of human nlrp12-pyd with a mbp tag (see paper)
98% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (5h7nB)

3csbA / P0AEX9 Crystal structure of monobody ysx1/maltose binding protein fusion complex (see paper)
99% identity, 71% coverage

• Ligand: manganese (ii) ion (3csbA)

6wh0A / A7LM80,C3SHQ8 Crystal structure of hybcl-2-4 with hybax bh3 (see paper)
77% identity, 95% coverage

• Ligands: peptide; alpha-d-glucopyranose (6wh0A)

5ttdA / D2KPJ6,P0AEX9 Minor pilin fctb from s. Pyogenes with engineered intramolecular isopeptide bond (see paper)
97% identity, 73% coverage

• Ligand: alpha-d-glucopyranose (5ttdA)

4b3nA / P0AEX9,Q0PF16 Crystal structure of rhesus trim5alpha pry/spry domain (see paper)
99% identity, 65% coverage

• Ligand: alpha-d-glucopyranose (4b3nA)

8iiyA / O95619,P0AEX9 Crystal structure of mbp fused gas41 yeats domain in complex with h3k14ac peptide (see paper)
90% identity, 80% coverage

• Ligands: peptide; alpha-d-glucopyranose (8iiyA)

7omtA / P0AEX9 Crystal structure of promacrobody 21 with bound maltose (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (7omtA)

4xa2A / P0AEX9 Structure of the major type iv pilin of acinetobacter baumannii
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (4xa2A)

4tsmB / P0AEX9 Mbp-fusion protein of pila1 from c. Difficile r20291 residues 26-166 (see paper)
99% identity, 70% coverage

• Ligands: alpha-d-glucopyranose; trimethylamine oxide (4tsmB)

4irlB / B0V1H4,P0AEX9 X-ray structure of the card domain of zebrafish gbp-nlrp1 like protein (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (4irlB)

3ehuA / P0AEX9,P34998 Crystal structure of the extracellular domain of human corticotropin releasing factor receptor type 1 (crfr1) in complex with crf (see paper)
97% identity, 73% coverage

• Ligands: peptide; alpha-d-glucopyranose (3ehuA)

6eg2A / P0AEX9,P51531 Crystal structure of human brm in complex with compound 16 (see paper)
98% identity, 59% coverage

• Ligand: n-(5-amino-2-chloropyridin-4-yl)-n'-(4-bromo-3-{[3-(hydroxymethyl)phenyl]ethynyl}-1,2-thiazol-5-yl)urea (6eg2A)

8vxmA / P0AEX9,P10415,Q07817 Human bcl-2/bcl-xl chimera fused to mbp in complex with inhibitor s55746
99% identity, 70% coverage

• Ligand: ~{n}-(4-hydroxyphenyl)-3-[6-[[(3~{s})-3-(morpholin-4-ylmethyl)-3,4-dihydro-1~{h}-isoquinolin-2-yl]carbonyl]-1,3-benzodioxol-5-yl]-~{n}-phenyl-5,6,7,8-tetrahydroindolizine-1-carboxamide (8vxmA)

5h7qA / P0AEX9,P41218 Crystal structure of human mnda pyd domain with mbp tag (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (5h7qA)

5gppB / P0AEX9,Q9I9N6 Crystal structure of zebrafish asc pyd domain (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (5gppB)

5dfmA / P0AEX9 Structure of tetrahymena telomerase p19 fused to mbp (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (5dfmA)

5hzvA / P0AEX9,P17813 Crystal structure of the zona pellucida module of human endoglin/cd105 (see paper)
97% identity, 60% coverage

• Ligand: alpha-d-glucopyranose (5hzvA)

4wrnA / P07911,P0AEY0 Crystal structure of the polymerization region of human uromodulin/tamm-horsfall protein (see paper)
97% identity, 52% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (4wrnA)

4wrnB / P07911,P0AEY0 Crystal structure of the polymerization region of human uromodulin/tamm-horsfall protein (see paper)
97% identity, 54% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (4wrnB)

5gpqA / P0AEX9,Q9I9N6 Crystal structure of zebrafish asc card domain (see paper)
99% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (5gpqA)

4qvhA / O33336,P0AEX9 Crystal structure of the essential mycobacterium tuberculosis phosphopantetheinyl transferase pptt, solved as a fusion protein with maltose binding protein (see paper)
99% identity, 60% coverage

• Ligands: alpha-d-glucopyranose; coenzyme a; magnesium ion (4qvhA)

KP1_0275 maltose transport system periplasmic maltose-binding component from Klebsiella pneumoniae NTUH-K2044
95% identity, 71% coverage

• Reduced virulence in tigecycline-resistant Klebsiella pneumoniae caused by overexpression of ompR and down-regulation of ompK35
  Park, Journal of biomedical science 2023
  • “...1138.272 Down-regulated genes KP1_0274 Maltose ABC transporter permease MalF 25.282 474.168 18.524 6.668 25.631 4.157 KP1_0275 Maltose/maltodextrin ABC transporter substrate-binding protein MalE 17.645 1277.184 73.022 15.171 88.873 6.814 KP1_0276 maltose/maltodextrin ABC transporter ATP-binding protein MalK 35.866 1394.194 39.551 57.555 75.753 0.572 KP1_0277 Maltoporin 40.647 1240.421 30.963...”

4wviA / P0AEX9,Q5HHB9 Crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with a substrate peptide (pep2). (see paper)
98% identity, 70% coverage

• Ligands: peptide; alpha-d-glucopyranose (4wviA)

NP_463094, STM4229 maltose ABC transporter periplasmic protein from Salmonella typhimurium LT2
94% identity, 71% coverage

• Identification of immunogenic proteins and generation of antibodies against Salmonella Typhimurium using phage display
  Meyer, BMC biotechnology 2012
  • “...pHORF3 Protein pHORF3 insert size [bp] NCBI reference sequence maltose ABC transporter periplasmic protein 260 NP_463094 Table 3 Selected immunogenic Salmonella Typhimurium proteins Protein pHORF3 insert size [bp] NCBI reference sequence Molecular mass complete protein [kDa] putative dihydroxyacid dehydratase 118 NP_462432 62 putative electron transfer protein...”
• Effect of iacP mutation on flagellar phase variation in Salmonella enterica serovar typhimurium strain UK-1
  Eom, Journal of bacteriology 2012
  • “...STM4348 STM4437 STM1911 STM4258 STM0486 STM4229 Mannose-1-phosphate guanylyltransferase Sugar-specific enzyme IIB Pyruvate formate-lyase 4/2-ketobutyrate...”
• Genome expression analyses revealing the modulation of the Salmonella Rcs regulon by the attenuator IgaA
  Mariscotti, Journal of bacteriology 2009
  • “...STM2284 glpA STM2771 STM3274 STM3474 fljB yhbU nirB STM4229 malE STM4231 lamB Hydrophilic protein Outer membrane protein Nitrogen regulatory protein P-II 2...”

NP_463094 maltose transport protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
94% identity, 71% coverage

• Crystal structure of the domain-swapped dimeric maltodextrin-binding protein MalE from Salmonella enterica.
  Wang, Acta crystallographica. Section D, Structural biology 2022 (PubMed)
  • GeneRIF: Crystal structure of the domain-swapped dimeric maltodextrin-binding protein MalE from Salmonella enterica.

8sbuA / P0AEX9,Q59028 Crystal structure of mbp fusion with hppk from methanocaldococcus jannaschii
99% identity, 61% coverage

• Ligand: alpha-d-glucopyranose (8sbuA)

5hzwA / P0AEX9,P17813 Crystal structure of the orphan region of human endoglin/cd105 in complex with bmp9 (see paper)
97% identity, 53% coverage

• Ligand: alpha-d-glucopyranose (5hzwA)

5iicA / P0AEX9,Q8WR62 Crystal structure of red abalone verl repeat 3 at 2.9 a resolution (see paper)
97% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (5iicA)

5ii4A / P0AEY0,Q8WR62 Crystal structure of red abalone verl repeat 1 with linker at 2.0 a resolution (see paper)
97% identity, 69% coverage

• Ligand: alpha-d-glucopyranose (5ii4A)

8e0pB / C3SHQ8,Q3U128 8e0pB (see paper)
97% identity, 45% coverage

• Ligands: beta-d-glucopyranose; alpha-d-glucopyranose (8e0pB)

GM298_21870 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Enterobacter sp. HSTU-ASh6
93% identity, 71% coverage

• Unveiling chlorpyrifos mineralizing and tomato plant-growth activities of Enterobacter sp. strain HSTU-ASh6 using biochemical tests, field experiments, genomics, and in silico analyses
  Haque, Frontiers in microbiology 2022
  • “...W GM298_03310 204215.204718 Chemotaxis protein CheW che A GM298_02505 60099.62018 Chemotaxis protein CheA mal E GM298_21870 9111.10301 Maltose/maltodextrin ABC transporter substrate-binding protein MalE rbs B GM298_22990 3204.4094 Ribose ABC transporter substrate-binding protein RbsB Motility fli Z GM298_02790 121304.121855 Flagella biosynthesis regulatory protein FliZ Fli D GM298_02755...”

6xdsA / P0AEX9,Q9NZC2 Crystal structure of mbp-trem2 ig domain fusion with fragment, 2-((4- bromophenyl)amino)ethan-1-ol (see paper)
97% identity, 71% coverage

• Ligand: alpha-d-glucopyranose (6xdsA)

6wbjA / P0AEX9,Q9Z0J1 High resolution crystal structure of mreck(cc4) in fusion with engineered mbp (see paper)
97% identity, 69% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (6wbjA)

BWI76_RS01830 maltose ABC transporter, substrate-binding component MalE from Klebsiella michiganensis M5al
93% identity, 71% coverage

• mutant phenotype: Specifically important for utilizing D-Maltose monohydrate.

5vawA / A0A0D5YCX7,P0AEX9 Fusion of maltose-binding protein and pila from acinetobacter baumannii ab5075 (see paper)
95% identity, 71% coverage

• Ligands: glutamic acid; lysine; serine (5vawA)

2nvuB / Q8TBC4 Structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex (see paper)
97% identity, 45% coverage

• Ligands: zinc ion; adenosine-5'-triphosphate (2nvuB)

7rxcB / P06654,P99134 Cryoem structure of kdelr with legobody (see paper)
95% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (7rxcB)

V5YV29 Maltodextrin-binding protein from Serratia marcescens
86% identity, 71% coverage

• Microbial Reduction of Fumonisin B1 by the New Isolate Serratia marcescens 329-2
  Keawmanee, Toxins 2021
  • “...isomerase, 3.58), the protein synthesis protein A0A6M5HVT2 (4-hydroxy-tetrahydrodipicolinate synthase, 5.33), and the cell metabolism protein V5YV29 (maltodextrin-binding protein, 6.89). ABC transporter, cellular process, transcription, nucleic acid proteins were also induced, which means that cellular processes were also activated for the degradation response. Proteins that were downregulated...”
  • “...8.20 A0A6N0D898 Porin OmpC ompC 7.94 A0A3E2ENK9 Amino acid ABC transporter substrate-binding protein gltI 7.12 V5YV29 Maltodextrin-binding protein malE 6.89 A0A080V044 Universal stress protein uspA 5.42 A0A6M5HVT2 4-hydroxy-tetrahydrodipicolinate synthase dapA 5.33 A0A6G9UQE2 ABC transporter substrate-binding protein HCG50_08880 5.33 A0A1Q4NZ53 Superoxide dismutase BHU62_14220 4.99 A0A6G9UU24 Phosphate-binding protein...”

y0028 periplasmic maltose-binding protein from Yersinia pestis KIM
YPK_0378 extracellular solute-binding protein from Yersinia pseudotuberculosis YPIII
85% identity, 71% coverage

• Physiological levels of glucose induce membrane vesicle secretion and affect the lipid and protein composition of Yersinia pestis cell surfaces
  Kolodziejek, Applied and environmental microbiology 2013
  • “...supplemental material). Notably, 44% of proteins (encoded by y0028, y2662, y1189, and y1607) found in the cultures grown without glucose and only one protein...”
• Proteomic analysis of iron acquisition, metabolic and regulatory responses of Yersinia pestis to iron starvation
  Pieper, BMC microbiology 2010
  • “...g) 26C, Vs (+Fe) h) 26-ratio -Fe/+Fe i) 26C P-value j) 37-ratio -Fe/+Fe k) 53 y0028 malE periplasmic maltose-binding protein PP 2150 43937 5.53 0.72 5.98 0.121 0.000 0.760 54 y0137 degQ serine endoprotease PP 1077 55588 6.43 0.39 0.11 2.41 0.0177 0.900 55 y0291 -...”
• Functional versatility of Zur in metal homeostasis, motility, biofilm formation, and stress resistance in Yersinia pseudotuberculosis
  Gu, Microbiology spectrum 2024
  • “...various nutrient transport systems, including the xylose (YPK_00570059), ribose (YPK_1161 and YPK_1162), erythritol (YPK_19611963), maltose (YPK_0378 and YPK_0382), simple sugar (YPK_24082411), glutamate/aspartate (YPK_3010), oligopeptide (YPK_2067 and YPK_2068), and nucleoside (YPK_1438 and YPK_3628) transport systems were upregulated by Zur. This suggests Zurs role in nutrient acquisition in...”

4dxbA / P0AEX9,P62593 2.29a structure of the engineered mbp tem-1 fusion protein rg13 in complex with zinc, p1 space group (see paper)
86% identity, 59% coverage

• Ligand: zinc ion (4dxbA)

3osrA / P0AEY0,P42212 Maltose-bound maltose sensor engineered by insertion of circularly permuted green fluorescent protein into e. Coli maltose binding protein at position 311 (see paper)
95% identity, 55% coverage

• Ligand: alpha-d-glucopyranose (3osrA)

6x91H / P0AEX9,P41238 Crystal structure of mbp-fused human apobec1 (see paper)
89% identity, 66% coverage

• Ligands: alpha-d-glucopyranose; zinc ion (6x91H)

7mk7A / P0AEX9,Q6UXT8 Augmentor domain of augmentor-beta (see paper)
90% identity, 68% coverage

• Ligand: alpha-d-glucopyranose (7mk7A)

N646_3116 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Vibrio alginolyticus NBRC 15630 = ATCC 17749
70% identity, 71% coverage

• Identification of Antibacterial Components in the Methanol-Phase Extract from Edible Herbaceous Plant Rumex madaio Makino and Their Antibacterial Action Modes
  Liu, Molecules (Basel, Switzerland) 2022
  • “...Amino acid ABC transporter%2C permease protein N646_3145 2.064 Rubredoxin/rubredoxin reductase N646_2209 2.122 Acetyl-CoA C-acyltransferase FadA N646_3116 2.163 Maltose ABC transporter periplasmic protein N646_3117 2.319 Maltose/maltodextrin ABC transporter%2C ATP-binding protein N646_3389 2.793 Putative ferrichrome ABC transporter (permease) N646_1395 2.879 Acyl-CoA dehydrogenase N646_4429 3.400 Nitrate ABC transporter nitrate-binding...”

WU75_03180 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Vibrio parahaemolyticus
Q87GB6 Maltodextrin-binding protein from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
VPA1401 maltose ABC transporter, periplasmic maltose-binding protein from Vibrio parahaemolyticus RIMD 2210633
70% identity, 71% coverage

• Identification of Antibacterial Components and Modes in the Methanol-Phase Extract from a Herbal Plant Potentilla kleiniana Wight et Arn
  Tang, Foods (Basel, Switzerland) 2023
  • “...proV 0.343 Glycine/betaine ABC transporter ATP-binding protein WU75_14765 aapQ 0.377 Amino acid ABC transporter permease WU75_03180 malE 0.4 Sugar ABC transporter substrate-binding protein WU75_14775 aapP 0.405 ABC transporter ATP-binding protein WU75_04605 vcaM 0.406 Multidrug ABC transporter ATP-binding protein WU75_14055 mdlB 0.411 Multidrug ABC transporter ATP-binding protein...”
• Comparative secretomics reveals novel virulence-associated factors of Vibrio parahaemolyticus
  He, Frontiers in microbiology 2015
  • “...membrane vps11 W6DWX7 Transaldolase tal 35012 4.86 69 6% Catalytic activity, transferase activity, cytoplasm vps12 Q87GB6 Maltose ABC transporter Vpa1401 42114 4.84 1489 51% Transporter activity, maltose transmembrane transporter activity vps13 W6DWX7 Transaldolase tal 35012 4.86 999 56% Catalytic activity, transferase activity, cytoplasm vps14 W6DHT7 Phosphoglycerate...”
• Comparative secretomics reveals novel virulence-associated factors of Vibrio parahaemolyticus
  He, Frontiers in microbiology 2015
  • “...tal 35012 4.86 69 6% Catalytic activity, transferase activity, cytoplasm vps12 Q87GB6 Maltose ABC transporter Vpa1401 42114 4.84 1489 51% Transporter activity, maltose transmembrane transporter activity vps13 W6DWX7 Transaldolase tal 35012 4.86 999 56% Catalytic activity, transferase activity, cytoplasm vps14 W6DHT7 Phosphoglycerate kinase pgk 41049 4.9...”
• Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
  Sun, International journal of molecular sciences 2014
  • “...Chn25A_1076 2.0352 Maltose transporter permease VPA1400 ( malF ) Chn25A_1077 2.8009 Maltose transporter membrane protein VPA1401( malE ) Chn25A_1078 3.0226 Maltose ABC transporter periplasmic protein VPA1402 Chn25A_1079 2.561 Maltose/maltodextrin transporter ATP-binding protein VPA1644 ( lamB ) Chn25A_1532 3.35 Maltoporin SGP cells Pyrimidine and purine metabolism VPA1243...”

APL_1237 maltose-binding periplasmic protein precursor from Actinobacillus pleuropneumoniae L20
APPSER1_RS06730 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Actinobacillus pleuropneumoniae serovar 1 str. 4074
70% identity, 71% coverage

• Comparative profiling of the transcriptional response to iron restriction in six serotypes of Actinobacillus pleuropneumoniae with different virulence potential
  Klitgaard, BMC genomics 2010
  • “...transporter P -0.83 APL_1216 luxS S-ribosylhomocysteine lyase T -0.39 APL_1213 - Predicted phosphatase/phosphohexomutase R -1.21 APL_1237 - Possible integral membrane sulfate transporter P -0.64 APL_1162 - Predicted iron-dependent peroxidase P -0.41 APL_1156 citT Di-and tricarboxylate transporter P -1.20 APL_1129 cytB562 Soluble cytochrome b562 C -0.48 APL_1124...”
• The morphology and metabolic changes of Actinobacillus pleuropneumoniae during its growth as a biofilm
  Zhang, Veterinary research 2023
  • “...APPSER1_RS09115-APPSER1_RS09120 manYZ mannose PTS system APPSER1_RS09135 idnK gluconokinase APPSER1_RS06715-APPSER1_RS06725 malM- APPSER1_RS06720- malK maltose/maltodextrin ABC transporter APPSER1_RS06730, APPSER1_RS06740 malE-malG maltose/maltodextrin ABC transporter APPSER1_RS05415 APPSER1_RS05415 glycosyltransferase APPSER1_RS09220 fucRIKU L-fucose isomerase; L-fuculokinase; L-fucose mutarotase APPSER1_RS09580-APPSER1_RS09605 APPSER1_RS09580- nanEKA-nagBA N-acetylmannosamine kinase; N-acetylneuraminate lyase; glucosamine-6-phosphate deaminase; N-acetylglucosamine-6-phosphate deacetylase Fermentation APPSER1_RS02385-APPSER1_RS02390 lldEF L-lactate...”

VCA0945 maltose ABC transporter, periplasmic maltose-binding protein from Vibrio cholerae O1 biovar eltor str. N16961
68% identity, 71% coverage

• Transcriptional profiling of Vibrio cholerae O1 following exposure to human anti- lipopolysaccharide monoclonal antibodies
  Baranova, Pathogens and disease 2020
  • “...log2a VCA1028 VC0911 VCA0247 VC1649 VC0910 VCA0860 VCA0945 VCA0908 VCA0944 VC0606 VCA0136 VCA0137 VC0089 VC1778 VC0795 VC0797 VC0796 VCA0684 VCA0685 VCA0687...”
• Utilization of Small RNA Genes to Distinguish Vibrio cholerae Biotypes via Multiplex Polymerase Chain Reaction
  Ahmed, The American journal of tropical medicine and hygiene 2019 (secret)
• Gluconeogenic growth of Vibrio cholerae is important for competing with host gut microbiota
  Wang, Journal of medical microbiology 2018 (secret)
• Transcriptomics reveals a cross-modulatory effect between riboflavin and iron and outlines responses to riboflavin biosynthesis and uptake in Vibrio cholerae
  Sepúlveda-Cisternas, Scientific reports 2018
  • “...hemin ABC transporter%2C permease protein%2C putative 1.808 VCA0944 malF maltose ABC transporter permease protein 1.853 VCA0945 malE maltose ABC transporter periplasmic maltose-binding protein 1.986 VCA0954 cheV chemotaxis protein CheV putative 1.029 VCA0965 GGDEF family protein 1.396 VCA0966 hypothetical protein 1.335 VCA0967 hypothetical protein 1.507 1.135 VCA0968...”
• The LonA Protease Regulates Biofilm Formation, Motility, Virulence, and the Type VI Secretion System in Vibrio cholerae
  Rogers, Journal of bacteriology 2016
  • “...and binding proteins VC1927 VC2081 VCA0943 VCA0945 VCA1028 C4-dicarboxylate transport protein, dctM Zinc ABC transporter, periplasmic zinc-binding protein,...”
• Characterization of Vibrio cholerae RyhB: the RyhB regulon and role of ryhB in biofilm formation
  Mey, Infection and immunity 2005
  • “...................................................................................................VCA0944 (4.4), VCA0945 (2.5) Maltose operon periplasmic...”

8g8wB / P0AEX9 Molecular mechanism of nucleotide inhibition of human uncoupling protein 1 (see paper)
81% identity, 66% coverage

• Ligand: alpha-d-glucopyranose (8g8wB)

8jxrC / P06654,P0A015,P0AEX9 Structure of nanobody-bound drd1_lsd complex (see paper)
79% identity, 64% coverage

• Ligand: alpha-d-glucopyranose (8jxrC)

U876_14480 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Aeromonas hydrophila NJ-35
A0KIV2 Maltodextrin-binding protein from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
AHA_1667 maltose-binding periplasmic protein from Aeromonas hydrophila subsp. hydrophila ATCC 7966
63% identity, 71% coverage

• Tetrahymena thermophila Predation Enhances Environmental Adaptation of the Carp Pathogenic Strain Aeromonas hydrophila NJ-35
  Liu, Frontiers in cellular and infection microbiology 2018
  • “...Beta-1,4-galactosyltransferase LPS and lipooligoaccharide biosynthesis protein 2.497 U876_13435 SurA Surface antigen (outer membrane lipoprotein) 2.024 U876_14480 MalE Sugar ABC transporter 3.046 U876_15120 LrgB Murein hydrolase effector 2.565 U876_21525 LpoB Outer membrane lipoprotein LpoB 4.748 U876_06385 Hypothetical protein 3.243 U876_18495 Lipo Lipoprotein 2.291 DOWN-REGULATED PROTEINS U876_04930 RbfA...”
• Comprehensive analysis of the lysine acetylome in Aeromonas hydrophila reveals cross-talk between lysine acetylation and succinylation in LuxS
  Sun, Emerging microbes & infections 2019
  • “...with Western blotting analysis To confirm the lysine acetylome results, seven acetylated proteins (LuxS, A0KHH2, A0KIV2, DnaK, A0KGN7, Tig, and AccD) were examined using Co-IP with Western blotting. The target proteins were enriched using custom specific antibodies and visualized via Western blotting using anti-target proteins or...”
• Integrated Succinylome and Metabolome Profiling Reveals Crucial Role of S-Ribosylhomocysteine Lyase in Quorum Sensing and Metabolism of Aeromonas hydrophila
  Yao, Molecular & cellular proteomics : MCP 2019 (secret)
• Comparative Extracellular Proteomics of Aeromonas hydrophila Reveals Iron-Regulated Secreted Proteins as Potential Vaccine Candidates
  Wang, Frontiers in immunology 2019
  • “...0.58 3.44E-03 AHA_0517 ORF02720 Substrate binding periplasmic protein MalE 63 66.16 0.43 4.95E-04 0.34 2.03E-02 AHA_1667 ORF03869 Type II secretory pathway, pullulanase 118 58.08 0.20 3.02E-03 0.49 7.19E-03 AHA_0628 ORF01696 Alanine racemase 11 33.09 0.13 8.19E-03 0.44 2.38E-02 alr-3 ORF02315 6-phosphofructokinase 9 29.1 0.10 4.93E-03 0.45...”

VS_II0220 maltose ABC transporter periplasmic protein from Vibrio splendidus LGP32
61% identity, 71% coverage

• Differential Exoproteome and Biochemical Characterisation of Neoparamoeba perurans
  Ní, Microorganisms 2021
  • “...3 ST37_14230 A0A1X1MR06 ABC transporter substrate-binding protein Vibrio sp. qd031 47.26 3.18528 6 0 + VS_II0220 B7VQI9 Maltodextrin-binding protein Vibrio tasmaniensis (strain LGP32 42.39 4.90439 13 4 + VS_0355 B7VIC7 Immunogenic protein Vibrio tasmaniensis (strain LGP32) 34.44 5.20998 11 1 + ahpCB Q3IE21 Peroxiredoxin 2 (TSA)...”

Psest_0863 maltose ABC transporter, substrate-binding component MalE from Pseudomonas stutzeri RCH2
58% identity, 69% coverage

• mutant phenotype: Specifically important for utilizing D-Maltose monohydrate.

3osqA / P0AEY0,P42212 Maltose-bound maltose sensor engineered by insertion of circularly permuted green fluorescent protein into e. Coli maltose binding protein at position 175 (see paper)
95% identity, 33% coverage

• Ligand: alpha-d-glucopyranose (3osqA)

SGF29_YEAST / P25554 SAGA-associated factor 29; 29 kDa SAGA-associated factor; SAGA histone acetyltransferase complex 29 kDa subunit from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
NP_009917 Sgf29p from Saccharomyces cerevisiae S288C
YCL010C SaGa associated Factor 29kDa; Probable 29kKDa Subunit of SAGA histone acetyltransferase complex from Saccharomyces cerevisiae
67% identity, 44% coverage

• function: Chromatin reader component of the transcription regulatory histone acetylation (HAT) complexes SAGA and SLIK (PubMed:10026213, PubMed:15647753, PubMed:21685874, PubMed:24307402). In the SAGA complex, SGF29 specifically recognizes and binds methylated 'Lys-4' of histone H3 (H3K4me), with a preference for trimethylated form (H3K4me3) (PubMed:21685874). SGF29 is also required for heterochromatin boundary formation function (PubMed:24307402). SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes At the promoters, SAGA is required for recruitment of the basal transcription machinery (PubMed:10026213). It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8) (PubMed:10026213). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs) (PubMed:10026213). SLIK is proposed to have partly overlapping functions with SAGA (PubMed:15647753). It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus (PubMed:15647753).
  subunit: Component of the 1.8 MDa SAGA complex, which consists of at least of TRA1, CHD1, SPT7, TAF5, ADA3, SGF73, SPT20/ADA5, SPT8, TAF12, TAF6, HFI1/ADA1, UBP8, GCN5, ADA2, SPT3, SGF29, TAF10, TAF9, SGF11 and SUS1. TAF5, TAF6, TAF9, TAF19, TAF12 and ADA1 seem to be present in 2 copies. SAGA is built of 5 distinct domains with specialized functions. Domain I (containing TRA1) probably represents the activator interaction surface. Domain II (containing TAF5 and TAF6, and probably TAF9 and TAF10), domain III (containing GCN5, TAF10, SPT7, TAF5 and ADA1, and probably ADA2, ADA3 and TAF12), and domain IV (containing HFI1/ADA1 and TAF6, and probably TAF9) are believed to play primarily an architectural role. Domain III also harbors the HAT activity. Domain V (containing SPT3 and SPT20, and probably SPT8) represents the TBP- interacting module, which may be associated transiently with SAGA. Interacts with dimethylated and trimethylated 'Lys-4' of histone H3 (H3K4me2 and H3K4me3), with a preference for the trimethylated form (H3K4me3). Component of the SLIK complex, which consists of at least TRA1, CHD1, SPT7, TAF5, ADA3, SPT20, RTG2, TAF12, TAF6, HFI1, UBP8, GCN5, ADA2, SPT3, SGF29, TAF10 and TAF9.
• Cloning, purification, crystallization and preliminary crystallographic analysis of the tandem tudor domain of Sgf29 from Saccharomyces cerevisiae.
  Li, Acta crystallographica. Section F, Structural biology and crystallization communications 2010
  • GeneRIF: tandem tudor domain at the C-terminus of Sgf29 was crystallized using the hanging-drop vapour-diffusion method and the crystals diffracted to 1.92 A resolution
• Genome-wide identification of resistance genes and transcriptome regulation in yeast to accommodate ammonium toxicity
  Fu, BMC genomics 2022
  • “...TPS1 0.7275 0.00308 0.3579 0.00003 0.3630 0.00002 YBL007C SLA1 0.5340 0.00002 0.2500 0.00003 0.4729 0.00042 YCL010C SGF29 0.3755 0 0.2031 0.00001 0.2475 0.00011 YCR077C PAT1 0.3581 0.00001 0.3037 0.00001 0.4301 0.00004 YDR245W MNN10 0.5099 0.00003 0.2407 0.0001 0.3961 0.00001 YDR289C RTT103 0.5253 0.0002 0.3517 0 0.2833...”
• HKC: an algorithm to predict protein complexes in protein-protein interaction networks
  Wang, Journal of biomedicine & biotechnology 2011
  • “...(catalog 510.190.10.20.10 in the complexcat benchmark), and their overlap ratio is 0.93. The two proteins YCL010c and YGL066w that are not recovered by cluster 12 have only one interaction with the cluster and do not exhibit good graph theoretic property. Actually, based on the available information...”
  • “...with the SAGA complex (size 16), and their overlap ratio is 0.93. The two proteins YCL010c and YGL066w that are not contained in the predicted cluster are isolated nodes with only one edge connecting with the cluster. (c) An example of a well-matched cluster, involving 7...”
• Comparative functional genomic analysis identifies distinct and overlapping sets of genes required for resistance to monomethylarsonous acid (MMAIII) and arsenite (AsIII) in yeast
  Jo, Toxicological sciences : an official journal of the Society of Toxicology 2009
  • “...YNL025C YCR081W YLR006C YJL128C YOL081W YCR068W YGR133W YGR057C YCL010C YML041C YNL329C YDL082W 50% IC20 Standard name 75lM 150lM PFD1 SAS4 SAS5 SAS2 CIN2 ARR1...”
• A genome-wide screen in Saccharomyces cerevisiae reveals pathways affected by arsenic toxicity
  Zhou, Genomics 2009
  • “...0.5181 Q9NQY0 Bridging integrator 3 YGL012W ERG4 Sterol C-24 (28) reductase 0.5262 Q14739 Lamin-B receptor YCL010C SGF29 SaGa associated Factor 29kDa; Probable 29kKDa Subunit of SAGA histone acetyltransferase complex 0.527 Q96ES7 SAGA-associated factor 29 homolog YNR031C SSK2 Map kinase kinase kinase (MAPKKK) of the high- osmolarity...”
• Genome-wide mapping of the coactivator Ada2p yields insight into the functional roles of SAGA/ADA complex in Candida albicans
  Sellam, Molecular biology of the cell 2009
  • “...orf19.3035 0 Rtg2 Other Sgf29 Tra1 YGL252C -- -- YCL010C YHR099W orf19.7074 orf19.139 8.8e-58 0 S. cerevisiae protein HAT Gcn5 (Ada4) Ada Ada1 Ada2 Ada3 Spt...”
• A core-attachment based method to detect protein complexes in PPI networks
  Wu, BMC bioinformatics 2009
  • “...YNL232W YOL021C YOL142W YOR001W YOR076C exosome (RNase complex) 0.805 13 4 5.00e-24 YBR081C YBR198C YBR253W YCL010C YDR167W YDR176W YDR216W YDR448W YGL112C YGR252W YHR099W YMR236W YPL254W SAGA complex 0.452 11 5 9.90e-23 YBR081C YBR198C YDR167W YDR176W YDR392W YDR448W YEL009C YER148W YGL112C YGR274C YHR099W YMR236W YOL148C YPL254W YPR086W...”
• Chemogenetic fingerprinting by analysis of cellular growth dynamics
  Warringer, BMC chemical biology 2008
  • “...assumption). Genes included in the screen were: FLO1, PIM1, TAT1, YBR074w, PHO3, YBR099c, APE3, APM3, YCL010C, YCL047C, CVT17, YCR073W, SRB8, YCR101C, YCR106W, YCR195C, YDL109c, YDL124w, DLD1, YDL175c, UGA4, GDH2, RRI1, SHS1, YDR026c, YDR101c, YDR132c, SWM1, GLO2, SUM1, YDR384c, HAT2, PRB1, CAN1, VTC1, DOT6, FTR1, YGL010w, ATE1,...”
• The Ama1-directed anaphase-promoting complex regulates the Smk1 mitogen-activated protein kinase during meiosis in yeast
  McDonald, Genetics 2005
  • “...rim11 sac7 slg1 spo1 spo19 spt3 ubc8 vac8 vam7 vps30 ycl010c ydr126w yhl0232c ypt7 Class II (wild type) bub3 dmc1 doa1 fks1 gip1 ids2 isc1 mck1 mei5 mpc54 pcl1...”
• More

CTN_1367 Extracellular solute-binding protein family 1 precursor from Thermotoga neapolitana DSM 4359
35% identity, 72% coverage

• Hyperthermophilic Thermotoga species differ with respect to specific carbohydrate transporters and glycoside hydrolases
  Frock, Applied and environmental microbiology 2012
  • “...TM0418 TM0432 TM0958 CTN_0408 CTN_0664 CTN_1767 CTN_1367 CTN_0765 CTN_1348 CTN_1502-3 CTN_0780 CTN_0638 CTN_0622 CTN_0576 CTN_0378-9 CTN_1337 CTN_0067 CTN_1375...”

6dtuA / Q9X0T1 Maltotetraose bound t. Maritima male1 (see paper)
35% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6dtuA)

TC 3.A.1.1.22 / Q9X0T1 MalE1; aka Maltose ABC transporter, periplasmic maltose-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins from Thermotoga maritima (see paper)
TM_1204 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Thermotoga maritima MSB8
TM1204 maltose ABC transporter, periplasmic maltose-binding protein from Thermotoga maritima MSB8
35% identity, 72% coverage

• substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
• The role of solute binding proteins in signal transduction
  Matilla, Computational and structural biotechnology journal 2021
  • “...vs no maltose 25 d [191] 12.5 mM maltotriose vs no maltotriose 57 d MalE1 TM_1204 /T a SBP_bac_8/PF13416 T. maritima Maltose, maltotriose, -(1-4)-mannotetraose 5 g/l trehalose vs 5 g/l glucose q Increased expression in trehalose f [192] 5 g/l lactose vs 5 g/l glucose q...”
• Hyperthermophilic Thermotoga species differ with respect to specific carbohydrate transporters and glycoside hydrolases
  Frock, Applied and environmental microbiology 2012
  • “...Unknown monosaccharides Unknown monosaccharides TM0277 TM0031 TM0810 TM1204 TM1839 TM1223 TM1067 treE TM0056 TM0071 TM0114 TM0309 TM1235 TM0595 TM1199 xylE2...”
• Carbohydrate utilization patterns for the extremely thermophilic bacterium Caldicellulosiruptor saccharolyticus reveal broad growth substrate preferences
  Vanfossen, Applied and environmental microbiology 2009
  • “...TM1120 (glycerol-3-phosphate) TM0102 (CUT2 unknown) TM1204 (maltose, maltotriose, mannotetraose) TM1839 (maltose, maltotriose, trehalose) None TM0114...”
• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...among the mal1 and mal2 genes in the Thermotogales , we used the MalE1 Ttm (TM1204) sequence as a query and selected from that dataset sequences from those genes that are arranged in three-gene operons as described previously. Those sequences were concatenated with their MalF and...”
  • “...homologs found in some members of the Thermotogales . Homologs of the Tt. maritima MalE1 (TM1204) were gathered using that sequence as query in BLASTP. Concatenated sequences of these SBP homologs and their cognate MSP and ABP from each operon were prepared, aligned and analyzed. A...”
• Several archaeal homologs of putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugars
  Nanavati, Applied and environmental microbiology 2006
  • “...d -N-Acetylglucosaminidase (cytoplasmic) TM0958 (rbsB) Ribose TM1204 (malE1) f Maltose Maltotriose -1,4-Mannotetraose TM1839 (malE2) f Maltose Maltotriose...”
  • “...by TIGR (34) rbsC1 rbsA1 rbsB1 rbsD TM1202 TM1203 TM1204 MSP MSP SBP 1 malG1 malF1 malE1 Maltose transportc Annotated by TIGR (34) malG1 malF1 malE1 TM1219...”
• Substrate specificities and expression patterns reflect the evolutionary divergence of maltose ABC transporters in Thermotoga maritima
  Nanavati, Journal of bacteriology 2005
  • “...gene. The periplasmic binding protein homologs MalE1 (TM1204) and MalE2 (TM1839) are 80% identical (91% similar), the inner membrane protein homologs...”
  • “...were TM0060, TM0061, TM0070, TM0071, TM0110, TM0309, TM1199, TM1204, and TM1839. The starch group included TM0364, TM1069, TM1835, TM1839, TM1840, and TM1845....”
• An expression-driven approach to the prediction of carbohydrate transport and utilization regulons in the hyperthermophilic bacterium Thermotoga maritima
  Conners, Journal of bacteriology 2005
  • “...transporter subunits (TM1836 and TM1839 and TM1202 to TM1204) recently shown to have different expression patterns and varied transport capabilities (47, 51,...”
• Gene transfer and genome plasticity in Thermotoga maritima, a model hyperthermophilic species
  Mongodin, Journal of bacteriology 2005
  • “...TM1196 to TM1199), a maltose transporter (TM1202 to TM1204), and 6 putative NADH dehydrogenases (TM1211 to TM1216). The transcripts for the oligopeptide ABC...”
• Whole-genome expression profiling of Thermotoga maritima in response to growth on sugars in a chemostat
  Nguyen, Journal of bacteriology 2004
  • “...of the genes in the cluster TM1190 to TM1204 was of particular interest because of their apparent operon structure yet varied encoded functions. Qualitative...”
  • “...higher levels of expression in lactose of malEFG1 (TM1204 to TM1202), lacZ2 (TM1195), a lacI homolog (TM1200), the genes encoding the arabinogalactan...”

CTN_0765 Maltose ABC transporter, periplasmic maltose-binding protein from Thermotoga neapolitana DSM 4359
34% identity, 72% coverage

• Hyperthermophilic Thermotoga species differ with respect to specific carbohydrate transporters and glycoside hydrolases
  Frock, Applied and environmental microbiology 2012
  • “...TM0432 TM0958 CTN_0408 CTN_0664 CTN_1767 CTN_1367 CTN_0765 CTN_1348 CTN_1502-3 CTN_0780 CTN_0638 CTN_0622 CTN_0576 CTN_0378-9 CTN_1337 CTN_0067 CTN_1375...”

6dtsA / Q9S5Y1 Maltotetraose bound t. Maritima male2 (see paper)
34% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (6dtsA)

TC 3.A.1.1.22 / Q9S5Y1 MalE2; aka Maltose ABC transporter, periplasmic maltose-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins from Thermotoga maritima (see paper)
TM1839 maltose ABC transporter, periplasmic maltose-binding protein from Thermotoga maritima MSB8
34% identity, 72% coverage

• substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
• Hyperthermophilic Thermotoga species differ with respect to specific carbohydrate transporters and glycoside hydrolases
  Frock, Applied and environmental microbiology 2012
  • “...monosaccharides Unknown monosaccharides TM0277 TM0031 TM0810 TM1204 TM1839 TM1223 TM1067 treE TM0056 TM0071 TM0114 TM0309 TM1235 TM0595 TM1199 xylE2 TM1855...”
  • “...to the polysaccharide mix (Tables 3 and 4): TM1839, TM0031, TRQ2_0973, and TRQ2_0970 (note that TRQ2_0973 and TRQ2_0970 are homologous to CTN_0777 and CTN_0780,...”
• Carbohydrate utilization patterns for the extremely thermophilic bacterium Caldicellulosiruptor saccharolyticus reveal broad growth substrate preferences
  Vanfossen, Applied and environmental microbiology 2009
  • “...two xylose isomerase-like TIM barrel proteins TM1839 (maltose, maltotriose, trehalose) TM1220 (cellobiose, barley) TM0810 (N-acetylglucosamine or GlcNAc...”
  • “...unknown) TM1204 (maltose, maltotriose, mannotetraose) TM1839 (maltose, maltotriose, trehalose) None TM0114 (monosaccharides) TM0595 (N-acetylglucosamine or...”
• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...TM0009 TM1875 TM1208 TM1220 TM1208 TM1851 TM1581 TM1209 TM1221 TM1209 TM1836 TM1836 TM1203 TM1203 TM1204 TM1839 mal2 TM1829 TM1681 TM1391 TM1830 TM1678 X TM0781 TM1831 2 TM1679 X X TM1832 2 TM1677 2 TM1826 TM1816 X TM1833 TM1832 2 TM1827 TM1416 X TM1834 TM1833 TM1828 TM1417...”
  • “...TM1103 TM1835 TM1834 TM1834 TM0690 TM1836 TM1835 TM1835 TM1837 TM1836 TM1836 TM1838 TM1203 TM1203 TM1839 TM1839 TM1839 TM1840 TM1840 TM1840 TM1841 TM1841(split?) TM1841 TM1842 X TM1842 TM1843 X TM1843 TM1844 TM1844 TM1844 TM1845 TM1845 TM1845 Bold, transporter ORFs; Italics, has at least one homolog in this...”
• Several archaeal homologs of putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugars
  Nanavati, Applied and environmental microbiology 2006
  • “...Ribose TM1204 (malE1) f Maltose Maltotriose -1,4-Mannotetraose TM1839 (malE2) f Maltose Maltotriose Trehalose TM1855 No tested sugars bind (xanthan gum) TM0031...”
  • “...substrate cbtF cbtD cbtC cbtB cbtA mbtA TM1836 TM1837d TM1839 MSP MSP SBP 1 malG2 malF2 malE2 Maltose transport Annotated by TIGR (34) malF2 Unnamed malE2 bglK...”
• The Thermotoga maritima phenotype is impacted by syntrophic interaction with Methanococcus jannaschii in hyperthermophilic coculture
  Johnson, Applied and environmental microbiology 2006
  • “...TM1650 TM1746-49 TM1751 TM1752 TM1834 TM1835 TM1836 TM1839 TM1840 TM1848 TM1851 TM1853-55 Annotation Laminarinase -Glucan ABC transporter subunits Xylanase...”
• Substrate specificities and expression patterns reflect the evolutionary divergence of maltose ABC transporters in Thermotoga maritima
  Nanavati, Journal of bacteriology 2005
  • “...periplasmic binding protein homologs MalE1 (TM1204) and MalE2 (TM1839) are 80% identical (91% similar), the inner membrane protein homologs MalF1 (TM1203) and...”
  • “...TM0061, TM0070, TM0071, TM0110, TM0309, TM1199, TM1204, and TM1839. The starch group included TM0364, TM1069, TM1835, TM1839, TM1840, and TM1845. The genes in...”
• An expression-driven approach to the prediction of carbohydrate transport and utilization regulons in the hyperthermophilic bacterium Thermotoga maritima
  Conners, Journal of bacteriology 2005
  • “...proteins include maltose transporter subunits (TM1836 and TM1839 and TM1202 to TM1204) recently shown to have different expression patterns and varied...”
  • “...TM0596, TM0598 TM0810-TM0812 TM1202-TM1204 TM1232-TM1235 TM1276 TM1836, TM1839 TM1853-TM1855 Unknown This study Unknown This study 47 Unknown This study 47, 80...”
• Whole-genome expression profiling of Thermotoga maritima in response to growth on sugars in a chemostat
  Nguyen, Journal of bacteriology 2004
  • “...observed in cells grown on lactose, while malE2 (TM1839) expression increased in both lactose- and maltose-grown cells, but to a lesser extent than expression...”
  • “...TM1199 TM1200 TM1201 TM1202, TM1203, TM1204, TM1216 TM1837, TM1839, TM1840, Maltose vs glucose VOL. 186, 2004 4827 In aerobes and facultative anaerobes this...”
• More

TM_1839 maltose/maltodextrin ABC transporter substrate-binding protein MalE from Thermotoga maritima MSB8
34% identity, 72% coverage

• The role of solute binding proteins in signal transduction
  Matilla, Computational and structural biotechnology journal 2021
  • “...[192] 5 g/l lactose vs 5 g/l glucose q Increased expression in lactose f MalE2 TM_1839 /T a SBP_bac_8/PF13416 T. maritima Maltose, maltotriose, trehalose 5 g/l trehalose vs 5 g/l glucose Increased expression in trehalose f , h [192] 5 g/l maltose vs 5 g/l glucose...”

GK0704 maltose/maltodextrin transport system (subsrate-binding protein) from Geobacillus kaustophilus HTA426
34% identity, 71% coverage

• Polysaccharide-degrading thermophiles generated by heterologous gene expression in Geobacillus kaustophilus HTA426
  Suzuki, Applied and environmental microbiology 2013
  • “...G. kaustophilus HTA426. (A) Organization of the gene cluster (GK0704 to GK0708) and the Pgk704 region. The GK0704, GK0705, and GK0706 genes encode components of...”
  • “...gene cluster in the HTA426 genome and identified genes GK0704 to GK0708 (Fig. 2A). Northern blotting showed that GK0707 was transcribed in strain HTA426 when...”

ACPL_6402 maltose ABC transporter substrate-binding protein from Actinoplanes sp. SE50/110
33% identity, 71% coverage

• Reconstruction and in silico analysis of an Actinoplanes sp. SE50/110 genome-scale metabolic model for acarbose production
  Wang, Frontiers in microbiology 2015
  • “...of acarbose in Actinoplanes sp. SE50/110 . The genes mal EFG in the pathway were ACPL_6402, ACPL_3200, ACPL_4618, ACPL_5585, ACPL_6401, ACPL_6726, ACPL_3782, ACPL_5386, and ACPL_6400. Figure 6 Chemical structure for acarbose . The essential genes for acarbose production were studied in acarbose synthesis medium. One hundred...”

EP10_002265 extracellular solute-binding protein from Geobacillus icigianus
33% identity, 71% coverage

• The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
  Peltek, International journal of molecular sciences 2024
  • “...for xylose metabolism (EP10_002609), lactic acid synthesis (EP10_003019), and transport of oligosaccharides (EP10_002195) and cyclodextrins (EP10_002265) may be a cell response to THz irradiation in conjunction with the general inhibition of metabolism that is observed during this period at the proteomic level [ 12 ] and...”
  • “...synthase subunit HisH, step 5/9, histidine biosynthesis EP10_002195 1.213861 0.014874 Oligosaccharide import ATP-binding protein MsmX EP10_002265 1.492904 0.046696 Cyclodextrin-binding protein EP10_002551 3.56812 2.92 10 16 PTS system fructose-specific EIIABC component, EC 2.7.1.69 EP10_002552 3.419195 4.25 10 12 Phosphofructokinase-1, EC 2.7.1.56 Fru-6-P + ATP = fructose-1,6-bisphosphate +...”

1urgA / Q9RHZ6 X-ray structures from the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius (see paper)
33% identity, 63% coverage

• Ligand: alpha-d-glucopyranose (1urgA)

CPF_2652 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Clostridium perfringens ATCC 13124
34% identity, 63% coverage

• Molecular identification of hyaluronate lyase, not hyaluronidase, as an intrinsic hyaluronan-degrading enzyme in Clostridium perfringens strain ATCC 13124
  Kumon, Scientific reports 2024
  • “...involved in the degradation of amino acids (CPF_1245 for l -serine dehydratase), transport of sugar (CPF_2652 for maltose/maltodextrin-binding protein and CPF_1113 for sugar-binding protein), and utilization of mucin [ gngC (CPF_1119) for endo--galactosidase, nanA (CPF_0178) for N -acetylneuraminate lyase, and fucP (CPF_1052) for l -fucose: H...”
• Global Phenotypic Characterization of Effects of Fluoroquinolone Resistance Selection on the Metabolic Activities and Drug Susceptibilities of Clostridium perfringens Strains
  Park, International journal of microbiology 2014
  • “...the sucrose and trehalose-specific phosphotransferase (PTS) systems CPF_1785 and CPF_0541 , the maltose ABC transporter CPF_2652 , and a putative maltose transporter CPF_2654 in the gatifloxacin-resistant strain 13124 GR was observed, which may have resulted in the lack of growth of 13124 GR on sucrose and...”
• Comparative transcription analysis and toxin production of two fluoroquinolone-resistant mutants of Clostridium perfringens
  Park, BMC microbiology 2013
  • “...CPE2084 CPF_2341 ( modB ) molybdate ABC transporter, permease protein 1.8 2.5 10.8 2.0 CPE2343 CPF_2652 ( malE ) putative maltose/maltodextrin ABC transporter 2.9 1.3 3.8 2.1 Unknown functions CPE0183 CPF_0176 nitroreductase family protein 1.0 4.8 2.9 1.1 CPE1172 CPF_1375 haloacid dehalogenase 2.1 2.4 20.6 1.7...”

DR0561, DR_0561 maltose ABC transporter, periplasmic maltose-binding protein from Deinococcus radiodurans R1
DRO_0559 maltose ABC transporter substrate-binding protein from Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539
33% identity, 65% coverage

• Characterization of the Radiation Desiccation Response Regulon of the Radioresistant Bacterium Deinococcus radiodurans by Integrative Genomic Analyses
  Eugénie, Cells 2021
  • “...AATTTGTTATTTGCGAACT yes/yes 3,5 Metabolism and metabolic transport DR0217 DRO_0217 thiosulfate sulfurtransferase +4 ATTACGCCAAAGACGTGTT no/no 4 DR0561 DRO_0559 sugar ABC transporter substrate-binding protein 245 GTTCAGGAAAAAACATAAC no protein observed DR1297 DRO_1288 ABC transporter 131 GTTACGCTCCTAAACAAAT no protein observed DR2256 DRO_2230 tkt transketolase 182/199 TTTACGCCCCTAGCGTATT/ ATTCTGTCTTTACCGGAAT ND X 1,2,3...”
  • “...corroborating our data ( Figure 8 ). We were not able to detect dr1297 or dr0561 tagged proteins, but these genes encode a predicted ABC transporter and a sugar ABC transporter, respectively, containing predicted transmembrane regions or a predicted periplasmic peptide signal that could lead to...”
• Signal Recognition Particle RNA Contributes to Oxidative Stress Response in Deinococcus radiodurans by Modulating Catalase Localization
  Han, Frontiers in microbiology 2020
  • “...pRADgro plasmid exclusively in the cytoplasm by Western blot ( Figure 5 ). In contrast, DR_0561, the homolog of the well-known periplasmic maltose binding protein (MalE) in E. coli , was only detected in the periplasm ( Figure 5 ). These results indicate that there is...”
• DdrI, a cAMP Receptor Protein Family Member, Acts as a Major Regulator for Adaptation of Deinococcus radiodurans to Various Stresses
  Meyer, Journal of bacteriology 2018
  • “...a panel of 6 genes (dr0997 [ddrI], dr0349 [lon2], dr0561, dr1046 [clpB], and dr1082 [lrpA, also called hpf or raiA], and drA0199) previously shown to be induced...”
  • “...induced independently of the DdrI protein, whereas dr0349, dr0561, dr1046, and dr1082 were induced by heat shock treatment in a DdrI-dependent manner (Fig. 5...”
• A tamB homolog is involved in maintenance of cell envelope integrity and stress resistance of Deinococcus radiodurans
  Yu, Scientific reports 2017
  • “...peptide ABC transporter periplasmic peptide-binding protein ++ DR_0363 peptide ABC transporter periplasmic peptide-binding protein ++ DR_0561 maltose ABC transporter periplasmic maltose-binding protein ++ DR_1038 branched-chain amino acid ABC transporter periplasmic amino acid-binding protein ++ DR_0788 branched-chain amino acid ABC transporter periplasmic amino acid-binding protein ++ DR_0564...”
• Oxidative stress resistance in Deinococcus radiodurans
  Slade, Microbiology and molecular biology reviews : MMBR 2011
  • “...PHXb DR0205 DR1356 DR1357 DR1358 DR1359 DR0363 DR0365 DR2118 DR0280 DR0561 DR2523 DR0139 DR0646 DR2363 DR2132 DrRRA S OHSAC H S OHSC E ES OHAC OS OHSAC S E...”
• Global transcriptional and proteomic analysis of the Sig1 heat shock regulon of Deinococcus radiodurans
  Schmid, Journal of bacteriology 2005
  • “...DR1114 DR0127 DR0128 DR1046 DRA0199 DR0126 DR0129 DR2381 DR0561 DR0178 DR0349 DR0997 Gene name Induction ratio R1a Predicted functionb hsp20 11.99 11.06 10.77...”
• Characterization of the Radiation Desiccation Response Regulon of the Radioresistant Bacterium Deinococcus radiodurans by Integrative Genomic Analyses
  Eugénie, Cells 2021
  • “...yes/yes 3,5 Metabolism and metabolic transport DR0217 DRO_0217 thiosulfate sulfurtransferase +4 ATTACGCCAAAGACGTGTT no/no 4 DR0561 DRO_0559 sugar ABC transporter substrate-binding protein 245 GTTCAGGAAAAAACATAAC no protein observed DR1297 DRO_1288 ABC transporter 131 GTTACGCTCCTAAACAAAT no protein observed DR2256 DRO_2230 tkt transketolase 182/199 TTTACGCCCCTAGCGTATT/ ATTCTGTCTTTACCGGAAT ND X 1,2,3 DRA0275...”

CPE2343 probable maltose ABC transporter from Clostridium perfringens str. 13
Q8XHY1 Maltodextrin-binding protein from Clostridium perfringens (strain 13 / Type A)
34% identity, 63% coverage

• Clostridium perfringens phospholipase C, an archetypal bacterial virulence factor, induces the formation of extracellular traps by human neutrophils
  Badilla-Vargas, Frontiers in cellular and infection microbiology 2023
  • “...phospholipase C (smart00770); PLAT (cd00113) 43 980 Q8XHY1 18 33 242.22 probable maltose ABC transporter CPE2343 periplasmic-binding component of ABC transport systems specific for maltose (cd13586) 42 555 Q8XNZ9 7 16 159.70 Cystathionine beta-synthase metB ; CPE0176 Aspartate aminotransferase I (cl18945) 38 741 Q8XNA0 10 27...”
• Comparative transcription analysis and toxin production of two fluoroquinolone-resistant mutants of Clostridium perfringens
  Park, BMC microbiology 2013
  • “...2.7 CPE2084 CPF_2341 ( modB ) molybdate ABC transporter, permease protein 1.8 2.5 10.8 2.0 CPE2343 CPF_2652 ( malE ) putative maltose/maltodextrin ABC transporter 2.9 1.3 3.8 2.1 Unknown functions CPE0183 CPF_0176 nitroreductase family protein 1.0 4.8 2.9 1.1 CPE1172 CPF_1375 haloacid dehalogenase 2.1 2.4 20.6...”
• Clostridium perfringens phospholipase C, an archetypal bacterial virulence factor, induces the formation of extracellular traps by human neutrophils
  Badilla-Vargas, Frontiers in cellular and infection microbiology 2023
  • “...296.23 Phospholipase C (Alpha toxin) CPE0036 Zinc dependent phospholipase C (smart00770); PLAT (cd00113) 43 980 Q8XHY1 18 33 242.22 probable maltose ABC transporter CPE2343 periplasmic-binding component of ABC transport systems specific for maltose (cd13586) 42 555 Q8XNZ9 7 16 159.70 Cystathionine beta-synthase metB ; CPE0176 Aspartate...”
  • “...P0C2E4, Q8XK52; Q8XP50), two chaperones (P26823 and P26821), one folding enzyme (Q8XHK0), three membrane transporters (Q8XHY1, Q8XNA0, Q8XKB3), one adhesion membrane protein (Q93M90), two membrane enzymes (Q8XIW4 and Q8XN18), one secreted (Q8XIL2) and two periplasmic proteins (Q8XIN7 and Q8XLL1) of unknown functions, three cell wall-bound enzymes...”

Athe_2574 extracellular solute-binding protein family 1 from Anaerocellum thermophilum DSM 6725
Athe_2574 maltose ABC transporter substrate-binding protein from Caldicellulosiruptor bescii DSM 6725
33% identity, 69% coverage

• Maltodextrin Transport in the Extremely Thermophilic, Lignocellulose Degrading BacteriumAnaerocellum bescii (f. Caldicellulosiruptor bescii)
  Tjo, 2024
• The diversity and specificity of the extracellular proteome in the cellulolytic bacterium Caldicellulosiruptor bescii is driven by the nature of the cellulosic growth substrate
  Poudel, Biotechnology for biofuels 2018
  • “...1 : Fig. S2). Briefly, key GHs (Athe_1865, 0610, 0609), cell wall hydrolase (Athe_1080), ESBPs (Athe_2574, 0847), periplasmic binding proteins (Athe_0273), and PUFs (Athe_2464, 2720, 2719, 2368) were C5 specific proteins that were highly abundant in switchgrass as well. These proteins likely drive the solubilization and...”
  • “...present in xylan and, to a lesser extent, switchgrassan observation that is especially evident with Athe_2574. ESBPs are one large group of proteins that remains understudied in C. bescii . These proteins are also termed as non-catalytic plant cell wall binding proteins (PWBP). Although they are...”
• Bioconversion of Lignocellulosic Biomass into Value Added Products under Anaerobic Conditions: Insight into Proteomic Studies
  Vélez-Mercado, International journal of molecular sciences 2021
  • “...(Athe_0089 * ) Upregulated in xylose and xylan ESBPs (Athe_0523 * ) (Athe_2091 * ) (Athe_2574 * ) (Athe_0847 * ) C6 substrates (glucose, cellobiose and avicel) Upregulated in avicel NIA NIA [ 105 ] Glycoside hydrolases (Athe_0459 * ) (Athe_0460 * ) Upregulated in glucose,...”

C289_0465 extracellular solute-binding protein from Anoxybacillus ayderensis
31% identity, 71% coverage

• A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
  Kahar, International journal of molecular sciences 2013
  • “...I pullulanase (C289_2260), glycosidase (C289_2139), and oligo-1,6-glucosidase (C289_0857, C289_1909, and C289_2139). Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to...”

2zyoA / Q9AJF5 Crystal structure of cyclo/maltodextrin-binding protein complexed with maltotetraose (see paper)
30% identity, 69% coverage

• Ligand: alpha-d-glucopyranose (2zyoA)

BAS3922 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative from Bacillus anthracis str. Sterne
32% identity, 62% coverage

• Membrane Proteomes and Ion Transporters in Bacillus anthracis and Bacillus subtilis Dormant and Germinating Spores
  Chen, Journal of bacteriology 2019
  • “...other hand, our results showed that BAS0812 and BAS3922 decreased 5.9- and 3.7-fold, respectively, and BAS0405 increased 2-fold after spore germination, but...”

Csac_0431 extracellular solute-binding protein, family 1 from Caldicellulosiruptor saccharolyticus DSM 8903
A4XGN5 Maltodextrin-binding protein from Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
32% identity, 69% coverage

• Hydrogenomics of the extremely thermophilic bacterium Caldicellulosiruptor saccharolyticus
  van, Applied and environmental microbiology 2008
  • “...maltodextrin ABC transport system (Csac_0427, Csac_0428, and Csac_0431) and the maltose ABC transport system (Csac_2491 to Csac_2493). As observed for certain...”
• Part I: characterization of the extracellular proteome of the extreme thermophile Caldicellulosiruptor saccharolyticus by GeLC-MS2
  Andrews, Analytical and bioanalytical chemistry 2010
  • “...14 A4XGB3 5-methyltetrahydropteroyltriglutamatehomocysteine S-methyltransferase 1 3 A4XGF7 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding 5 24 15 A4XGN5 Extracellular solute-binding protein, family 1 precursor 1 3 3 A4XGZ2 or A4XH19 Glutamate synthase 2 A4XHB1 Aspartyl-tRNA synthetase 13 4 7 A4XHC3 Pullulanase, type I precursor 3 4 1 A4XHF8...”
  • “...protein precursor Yes Yes 1 Yes A4XM93 S-layer domain protein precursor Yes Yes 1 Yes A4XGN5 Extracellular solute-binding protein, family 1 precursor Yes Yes 1 Yes A4XMD5 Extracellular solute-binding protein, family 1 precursor Yes Yes 1 A4XJP0 Cell wall hydrolase autolysin precursor Yes Yes 1 Yes...”

TTHA1652 maltose ABC transporter, periplasmic maltose-binding protein from Thermus thermophilus HB8
32% identity, 66% coverage

• Determination and Dissection of DNA-Binding Specificity for the Thermus thermophilus HB8 Transcriptional Regulator TTHB099
  Moncja, International journal of molecular sciences 2020
  • “...prepilin-like protein +1.429 5.85 10 3 4 TTHB120 hypothetical protein +2.250 1.27 10 3 1 TTHA1652 maltose ABC transporter substrate-binding protein +1.787 1.72 10 3 2 TTHA1651 maltose ABC transporter permease +2.154 1.17 10 3 3 TTHA1650 maltose ABC transporter permease +2.108 1.29 10 3 1...”

TTC1288 No description from Thermus thermophilus HB27
32% identity, 66% coverage

• The high-affinity maltose/trehalose ABC transporter in the extremely thermophilic bacterium Thermus thermophilus HB27 also recognizes sucrose and palatinose
  Silva, Journal of bacteriology 2005
  • “...clusters designated malEFG1 (TTC1627 to -1629) and malEFG2 (TTC1288 to -1286) and two monocistronic genes designated malK1 (TTC0211) and malK2 (TTC0611) are...”
  • “...the clusters malEFG1 (TTC1627 to -1629) and malEFG2 (TTC1288 to -1286) are organized similarly to the corresponding genes in several other organisms (Fig. 3)....”

SAUSA300_0209 putative maltose ABC transporter, maltose-binding protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
SA0207 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAV0214 similar to maltose/maltodextrin transport system from Staphylococcus aureus subsp. aureus Mu50
SAOUHSC_00176 bacterial extracellular solute-binding protein, putative from Staphylococcus aureus subsp. aureus NCTC 8325
NWMN_0152 hypothetical protein from Staphylococcus aureus subsp. aureus str. Newman
SACOL0193 maltose ABC transporter, maltose-binding protein, putative from Staphylococcus aureus subsp. aureus COL
30% identity, 69% coverage

• Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
  Paudel, Applied and environmental microbiology 2021 (secret)
• Aspartate tightens the anchoring of staphylococcal lipoproteins to the cytoplasmic membrane
  Kumari, MicrobiologyOpen 2017
  • “...USA300 Detected (Diep etal., 2014 ; Enany etal., 2014 ; Hanzelmann etal., 2016 ) 25. SAUSA300_0209 Maltose ABC transporter C GPNR No TMD Notdetected 26. SAUSA300_1884 CamS sex pheromone biosynthesis C GNHK No TMD COL USA300 Detected (Becher etal., 2009 ; Hanzelmann etal., 2016 ) 27....”
• Evaluation of Staphylococcus aureus Lipoproteins: Role in Nutritional Acquisition and Pathogenicity
  Shahmirzadi, Frontiers in microbiology 2016
  • “...24 SAUSA300_0798 D-Methionine ABC transporter OpuAC, Lipoprotein_9 19 LAA C 30 15 Sugar transport 25 SAUSA300_0209 Maltose ABC transporter SBP_bac_1, 8 20 VTA C 47 6 Miscellaneous functions Biosynthesis 26 SAUSA300_1884 CamS sex pheromone biosynthesis CamS 17 LAA C 44 14 Respiration 27 SAUSA300_0963 Quinol oxidase,...”
• Quantitative proteomic view associated with resistance to clinically important antibiotics in Gram-positive bacteria: a systematic review
  Lee, Frontiers in microbiology 2015
  • “...protein subunitsugar transport spr1527 Lin Up 1 Feng et al., 2011 Carbohydrate transport Maltose/maltodextrin-binding protein SA0207 Dap Down 1 Fischer et al., 2011 Carbohydrate transport Function unknown Unknown SA1238 Met Up 1 Cordwell et al., 2002 Unknown Unknown SA1051 Met Up 1 Cordwell et al., 2002...”
• Daptomycin resistance mechanisms in clinically derived Staphylococcus aureus strains assessed by a combined transcriptomics and proteomics approach
  Fischer, The Journal of antimicrobial chemotherapy 2011
  • “...SdhA SdhB SA1533 SA0995 SA0996 Eno GapA MsmX SA0731 SA0727 SA0207 SA0206 PurH SA0925 FabF SA0843 CrtN SA2348 SA0587 RpsJ RpsM RpsB RpsC RpsD RpsE RpsF RpsG RplL...”
• Revealing fosfomycin primary effect on Staphylococcus aureus transcriptome: modulation of cell envelope biosynthesis and phosphoenolpyruvate induced starvation
  Petek, BMC microbiology 2010
  • “...example, alanine racemase gene SA1231, some transporter genes ( opp2B , SA1183, SA1972, msmX , SA0207, malF ) and amino acid biosynthesis genes dhoM and hisC were significantly differentially expressed only at higher concentrations of fosfomycin (see Additional file 1 ). Metabolic pathways affected by fosfomycin...”
• Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
  Anderson, FEMS immunology and medical microbiology 2010
  • “...transacylase sa_c318s157_a_at * 2.7 2.5 30 fabF SA0988 acyl-carrier-protein synthase II sa_c4695s4014_a_at 5.8 2.5 2.5 SA0207 hypothetical protein sa_c6975s6099_a_at 6.3 2.5 2.5 SA0317 lipase precursor sa_c10609s11066_s_at 3.3 2.5 ND SA0390 lipase precursor sa_c1242s1022_a_at * 4.3 2.5 15 SA1240 DAK2 domain protein Nucleotide transport and metabolism sa_c4816s4124_at...”
• Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
  Donat, Journal of bacteriology 2009
  • “...protein, similar to integral membrane protein SA0207 Hypothetical protein, similar to maltose/maltodextrin-binding protein SA0248 Hypothetical protein similar...”
• Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
  Seggewiss, Journal of bacteriology 2006
  • “...SA0293 SA2156 SA0589 SA2303 SA0208 SA2302 SA0111 SA0848 SA2167 SA0207 SA0849 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 16.29...”
• Mapping the pathways to staphylococcal pathogenesis by comparative secretomics
  Sibbald, Microbiology and molecular biology reviews : MMBR 2006
  • “...A A A A G G A C C C G S G 15925912 15925918 Slp SA0207 L V S T G A C C G G 15925928a,b SA0217 L S S C A 15925940c SA0229 L S G C G 15926044 15926073 15926079a...”
• Staphylococcus aureus deficient in lipidation of prelipoproteins is attenuated in growth and immune activation
  Stoll, Infection and immunity 2005
  • “...SA2079 SA0010, SA0201, SA0229, SA0849, SA0850, SA2255 SA0207 SA0217 SA2194, SA0587 SA2074 SA2202 SA2235 SA0422, SA0771 SA1820, SA1820 SA0913 SA1361 SA1687...”
• Staphylococcus aureus virulence expression is impaired by Lactococcus lactis in mixed cultures
  Even, Applied and environmental microbiology 2009
  • “...MW1642 MW1641 MW2528 MW0568 MW1032 pfk pykA SAV0269 SAV0214 MW0245 MW0190 rbsD SAV2158 SAV0189 SAV2323 SAV0474 MW2084 MW0163 MW2244 MW0428 mtlA glcA glvC treP...”
• Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
  Liu, Plants (Basel, Switzerland) 2023
  • “...acid ABC transporter ATP-binding protein putative SAOUHSC_02698 2.883 Amino acid ABC transporter permease protein putative SAOUHSC_00176 2.892 Bacterial extracellular solute-binding protein putative SAOUHSC_00423 3.536 Conserved hypothetical protein SAOUHSC_02430 3.658 ABC transporter periplasmic binding protein putative SAOUHSC_01656 4.262 Conserved hypothetical protein SAOUHSC_01657 4.964 ABC transporter putative SAOUHSC_00175...”
• Functional Mapping of Phenotypic Plasticity of Staphylococcus aureus Under Vancomycin Pressure
  Yang, Frontiers in microbiology 2021
  • “...governing phenotypic plasticity to the pressure of vancomycin. These seven genes, SAOUHSC_00020 ( walR ), SAOUHSC_00176, SAOUHSC_00544 ( sdrC ), SAOUHSC_02998, SAOUHSC_00025, SAOUHSC_00169, and SAOUHSC_02023, were found to help S. aureus regulate antibiotic pressure. Our dynamic gene mapping technique provides a tool for dissecting the phenotypic...”
  • “...Y SAOUHSC_00169 Peptide ABC transporter permease 0 g/mL 193,712 19.76 N < - > S SAOUHSC_00176 Extracellular solute-binding protein 0 g/mL 229,384 28.63 / / Non-coding region 0 g/mL 550,323 19.41 N < - > S SAOUHSC_00544 Fibrinogen-binding protein SdrC 0 g/mL 2,072,412 20.49 / /...”
• Inferring multilayer interactome networks shaping phenotypic plasticity and evolution
  Yang, Nature communications 2021
  • “...differently in affecting phenotypic plasticity. Some QTLs, such as Q25261 (at SAOUHSC_00020 ), Q193712 (at SAOUHSC_00176 ), Q92210 (at SAOUHSC_00085 ), and Q2644158 (at SAOUHSC_02871 ), have significant net effects mainly due to favorable accumulated promotion from regulators, although the strength of promotion and number of...”
• Comparative Analysis of Virulence and Toxin Expression of Vancomycin-Intermediate and Vancomycin-Sensitive Staphylococcus aureus Strains
  Jin, Frontiers in microbiology 2020
  • “...Capsular polysaccharide biosynthesis protein Cap8F SAOUHSC_00126 6.0723 7.23 7.07E-33 2.77E-32 Capsular polysaccharide biosynthesis protein Cap8M SAOUHSC_00176 6.6897 2.98 0 0 Extracellular solute-binding protein Virulence-associated genes SAOUHSC_01121 4.1632 6.23 0 0 Alpha-hemolysin SAOUHSC_01942 4.4034 2.01 0.00013251 0.00016629 Serine protease SplA SAOUHSC_01941 3.2598 3.29 0.0003595 0.00042238 Serine protease...”
• Functional analysis of the EsaB component of the Staphylococcus aureus Type VII secretion system
  Casabona, Microbiology (Reading, England) 2017
  • “...protein 6.3 SAOUHSC_01292 4.4 Putative DNA-binding protein ns SAOUHSC_00130 isdI 4.4 Heme-degrading monooxygenase IsdI 5.7 SAOUHSC_00176 4.5 Extracellular solute-binding protein ns SAOUHSC_02435 sfaA 4.5 Putative transporter 6.7 SAOUHSC_02799 sarT 4.6 Staphylococcal accessory regulator ns SAOUHSC_02432 4.8 Unknown, hypothetical protein 6.2 SAOUHSC_02245 4.9 Unknown, hypothetical protein 6.5...”
• The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus
  Schulthess, Journal of bacteriology 2011
  • “...NWMN_0102 NWMN_0103 NWMN_0104 NWMN_0105 NWMN_0106 NWMN_0107 NWMN_0108 NWMN_0152 Gene symbolb 4958 SCHULTHESS ET AL. J. BACTERIOL. TABLE 4. Genes with 2...”
• In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
  Sadaka, PloS one 2014
  • “...12.1 (1.2) 6.2 (1.5) SACOL0192 Maltose ABC transporter, ATP-binding protein, putative 21.5 (1.5) 6.5 (1.6) SACOL0193 Maltose ABC transporter, maltose-bindingprotein, putative 14.4 (1.3) 3.4 (1.2) 4.2 (1.4) SACOL0194 Maltose ABC transporter permease protein 11.1 (1.5) 3.3 (1.4) 3.7 (1.4) SACOL0195 Maltose ABC transporter permease protein 13.9...”
• Staphylococcus aureus gene expression in a rat model of infective endocarditis
  Hanses, Genome medicine 2014
  • “...lantibiotic ABC transporter protein epiF SACOL1873 5.5 ns 5.7 ns lantibiotic ABC transporter protein malE SACOL0193 ns ns 3.1 2.5 maltose ABC transporter, maltose-binding malF SACOL0194 7.4 3.9 6.0 3.5 maltose ABC transporter, permease protein malK SACOL0192 14.7 14.7 6.2 6.8 maltose ABC transporter, ATP-binding protein...”

MW0190 ORFID:MW0190~hypothetical protein, similar to maltose/maltodextrin-binding protein from Staphylococcus aureus subsp. aureus MW2
30% identity, 69% coverage

• Staphylococcus aureus virulence expression is impaired by Lactococcus lactis in mixed cultures
  Even, Applied and environmental microbiology 2009
  • “...MW2528 MW0568 MW1032 pfk pykA SAV0269 SAV0214 MW0245 MW0190 rbsD SAV2158 SAV0189 SAV2323 SAV0474 MW2084 MW0163 MW2244 MW0428 mtlA glcA glvC treP SAV0771 MW0733...”
  • “...sources, like ribose (rbsD), maltose and maltodextrin (MW0190 [mtlA]), and trehalose (treP). Such regulation resulting from catabolic repression in several...”

SAR0206 putative extracellular sugar-binding lipoprotein from Staphylococcus aureus subsp. aureus MRSA252
30% identity, 69% coverage

• Phenanthrene Antibiotic Targets Bacterial Membranes and Kills Staphylococcus aureus With a Low Propensity for Resistance Development
  Chen, Frontiers in microbiology 2018
  • “...change Predicted amino change S. aureus MRSA252 Locus tag Predicted gene product 1 TG N207K SAR0206 Maltose ABC transporter substrate-binding protein ( Puyet and Espinosa, 1993 ) 2 AG T111A SAR0210 gfo/Idh/MocA family oxidoreductase ( Kanagasundaram and Scopes, 1992 ) 3 AT K225I SAR2028 Aspartate aminotransferase...”

4hw8A / Q2G1E9 2.25 angstrom structure of the extracellular solute-binding protein from staphylococcus aureus in complex with maltose.
30% identity, 69% coverage

• Ligand: alpha-d-glucopyranose (4hw8A)

EfmE1162_0369 extracellular solute-binding protein from Enterococcus faecium E1162
31% identity, 70% coverage

• A LacI-family regulator activates maltodextrin metabolism of Enterococcus faecium
  Zhang, PloS one 2013
  • “...transporter, permease protein 0.12 - EfmE1162_0368 ZP_06676213 mdxC maltose/maltodextrin ABC transporter, permease protein 0.27 - EfmE1162_0369 ZP_06676214 mdxD maltose/maltodextrin ABC transporter, binding protein 0.27 - EfmE1162_0370 ZP_06676215 pulA Neopullulanase 0.34 - EfmE1162_1270 ZP_06677115 oligo-1,6-glucosidase 0.23 - EfmE1162_1401 ZP_06677246 oligo-1,6-glucosidase 0.13 - EfmE1162_1402 ZP_06677247 beta-glucosidase 0.16 -...”

2gh9A / Q72I44 Thermus thermophilus maltotriose binding protein bound with maltotriose (see paper)
32% identity, 65% coverage

• Ligand: alpha-d-glucopyranose (2gh9A)

ESA_03421 extracellular solute-binding protein from Cronobacter sakazakii ATCC BAA-894
31% identity, 67% coverage

• Maltodextrin-binding protein as a key factor in Cronobacter sakazakii survival under desiccation stress
  Xue, Food Research International. 2024
• Maltodextrin-binding protein as a key factor in Cronobacter sakazakii survival under desiccation stress
  Xue, Food research international (Ottawa, Ont.) 2024 (PubMed)
  • “...C. sakazakii. Furthermore, through our comparative proteomic profiling, we identified the maltodextrin-binding protein encoded by ESA_03421 as a potential factor influencing dry tolerance. This protein is regulated by EnvZ-OmpR, RecA, and FlhD. Notably, the knockout of ESA_03421 resulted in a 150% greater reduction in Log CFU...”
• Inactivation of Lipopolysaccharide-Biosynthesizing Genes Altered Lipids Composition and Intensity in <i>Cronobacter sakazakii</i>
  Hu, Pathogens (Basel, Switzerland) 2024
  • “...resistance of C. sakazakii to these environmental stresses. For example, the maltodextrin-binding protein encoded by ESA_03421 was reported as the key gene involved in the thermotolerance of C. sakazakii during desiccation through a comparative proteomics analysis [ 13 ]. Other influencing factors were also reported recently,...”

lmo2125 similar to maltose/maltodextrin ABC-transporter (binding protein) from Listeria monocytogenes EGD-e
30% identity, 71% coverage

• The ribonuclease PNPase is a key regulator of biofilm formation in Listeria monocytogenes and affects invasion of host cells
  Quendera, NPJ biofilms and microbiomes 2023
  • “...from the mannose/glucose ( lmo0096 , lmo0783 , lmo0784 ) and maltose ( lmo2124 , lmo2125 ) transport systems, along with genes involved in the pentose phosphate pathway ( lmo0342 , lmo0343 , lmo0345 ). The categories that were strongly downregulated by PNPase inactivation were the...”
  • “...MpoA 4.36 2.1310 2 2.71 lmo2124 Maltose/maltodextrin ABC-transport system permease, MalF 10.59 7.7810 6 2.00 lmo2125 Maltose/maltodextrin ABC-transporter binding protein, MalE 15.09 2.3810 7 3.05 lmo0048 Sensor of histidine kinase, AgrB Quorum sensing system 8.59 4.3610 5 6.73 lmo0049 Autoinducing peptide, AgrD 5.44 4.1010 3 Downregulated...”
• Synergistic Antibacterial Mechanism of Mannosylerythritol Lipid-A and Lactic Acid on Listeria monocytogenes Based on Transcriptomic Analysis
  Liu, Foods (Basel, Switzerland) 2022
  • “...in bacterial viability. The most significantly down-regulated genes mainly included an operon from lmo2121 to lmo2125 (log2FC ranged from 10.94 to 13.44). These genes mainly encode the maltose phosphorylase, maltodextrose utilization protein MalA, sugar ABC transporter permease, and sugar ABC transporter substrate-binding protein. These findings suggest...”
• The role of solute binding proteins in signal transduction
  Matilla, Computational and structural biotechnology journal 2021
  • “...~12.0/24.0 e , n [190] 0.2% (w/v) arabinose vs no arabinose 12.1 b [94] MalE lmo2125 /T a SBP_bac_8/PF13416 Listeria monocytogenes Maltose 25 mM maltose vs no maltose 25 d [191] 12.5 mM maltotriose vs no maltotriose 57 d MalE1 TM_1204 /T a SBP_bac_8/PF13416 T. maritima...”
• Antibacterial Efficacy and Mechanism of Mannosylerythritol Lipids-A on Listeria monocytogenes
  Liu, Molecules (Basel, Switzerland) 2020
  • “...> 5, 4.6% of the genes with FC > 20, and there were two genes (lmo2125, lmo2124) with FC > 100. Overall, these results suggested that there was a significant difference between the MEL-A treatment group and the control group. 3.5.2. Gene Ontology (GO) Analysis The...”
• Genomic Differences between Listeria monocytogenes EGDe Isolates Reveal Crucial Roles for SigB and Wall Rhamnosylation in Biofilm Formation
  Hsu, Journal of bacteriology 2020
  • “...82 G to W Missense 2003900 aroF C A 138 V to F Missense 2207164 lmo2125 T G 400 Q to P Missense 2734614 lmo2660 C A 211 G to V Missense 2836724 lmo2757 G A 354 R to C Missense 2849710 lmo2769 G T 247...”
• The Combined Effect of Cold and Copper Stresses on the Proliferation and Transcriptional Response of Listeria monocytogenes
  Quesille-Villalobos, Frontiers in microbiology 2019
  • “...genes that encode the phosphotransferase system (PTS; genes lmo0027, lmo0298, lmo0299, lmo1997, lmo2000, lmo2001, lmo2124, lmo2125, lmo2665, lmo2666 and lmo2708) ( Figure 2B and Supplementary Table S2 ). The effect of copper over the carbohydrate metabolism has been described in other bacterial models. When a E....”
• Whole Genome and Core Genome Multilocus Sequence Typing and Single Nucleotide Polymorphism Analyses of Listeria monocytogenes Isolates Associated with an Outbreak Linked to Cheese, United States, 2013
  Chen, Applied and environmental microbiology 2017
  • “...CG42_RS08875, rRNA methyltransferase, lmo1662 2275331 T T G Yes CG42_RS11330, sugar ABC transporter substrate-binding protein, lmo2125 2311944 A A G Yes CG42_RS11530, xylose isomerase, lmo2160 2532881 C C A No W W L CG42_RS12665, glutamate decarboxylase, lmo2434 a The reported SNP position, protein ID, and putative...”
  • “...6 6 VOC family protein, d CG42_RS08730 lmo1662 11 134 11 rRNA methyltransferase, d CG42_RS08875 lmo2125 2 2 119 Sugar ABC transporter substrate-binding protein, CG42_RS11330 lmo2160 a 17 17 122 Xylose isomerase, d CG42_RS11530 lmo2434 15 or 129 15 117 Glutamate decarboxylase, CG42_RS12665 a The locus...”
• Survival of Listeria monocytogenes in Soil Requires AgrA-Mediated Regulation
  Vivant, Applied and environmental microbiology 2015
  • “...such as the ABC transporter (lmo2123 to lmo2125, lmo1739) and the phosphotransferase (PTS) system (lmo2782, lmo2665, lmo2666, lmo2780). Fourteen transcriptional...”
• More

5tu0A / Q929P4 1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
30% identity, 71% coverage

• Ligand: tartronate (5tu0A)

GANS_BACSU / O07009 Galactooligosaccharide-binding protein; Cyclodextrin-binding protein from Bacillus subtilis (strain 168) (see 2 papers)
TC 3.A.1.1.2 / O07009 Cyclodextrin-binding protein, component of The galactooligosaccharide (transports the di, tri and tetrasaccharides) uptake porter GanOPQ (GanSPQ; MalEFG) functioning with the energizing ATPase MsmX (see 3.A.1.1.26) from Bacillus subtilis (see 2 papers)
30% identity, 72% coverage

• function: Involved in galactan degradation (PubMed:27501980, PubMed:29240795). Part of the ABC transporter complex GanPQS involved in the uptake of galactooligosaccharides (PubMed:27501980, PubMed:29240795). Binds mainly galactotetraose and galactotriose (PubMed:27501980).
  subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (GanP and GanQ) and a solute-binding protein (GanS).
  disruption phenotype: Deletion mutant displays a 2-fold increase in the doubling time when galactan is the sole carbon and energy source.
• substrates: Galactooligosaccharides
  tcdb comment: These oligosaccharides are derived from galactans and arabinogalactans, compenents of pectins in plant cell walls (Watzlawick et al. 2016)

1eljA / P58300 The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
29% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (1eljA)

SPD_1934 maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Streptococcus pneumoniae D39
P59214 Maltooligosaccharide ABC transporter solute-binding lipoprotein from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
spr1918 ABC transporter substrate-binding protein - maltose/maltodextrin from Streptococcus pneumoniae R6
31% identity, 69% coverage

• StkP- and PhpP-Mediated Posttranslational Modifications Modulate the S. pneumoniae Metabolism, Polysaccharide Capsule, and Virulence
  Kant, Infection and immunity 2023
  • “...2.75 5.94E-05 SPD_1932 Maltodextrin phosphorylase 2.55 0 6.38 0 SPD_1933 4-alpha-glucanotransferase 2.12 0 6.78 0 SPD_1934 Maltose/maltodextrin-binding protein 2.82 8.47E-215 2.52 6.38E-94 SPD_1935 Sugar ABC transporter permease 2.43 8.81E-47 1.96 8.43E-27 SPD_1663 Alpha,alpha-phosphotrehalase 27.30 9.72E-40 2.15 1.69E-23 SPD_1664 PTS beta-glucoside transporter subunit EIIBCA 8.25 0 8.11...”
• Maltose-Dependent Transcriptional Regulation of the mal Regulon by MalR in Streptococcus pneumoniae
  Afzal, PloS one 2015
  • “...spd_1215 Alpha-amylase, AmyA2 6.6 spd_1932 Glycogen phosphorylase family protein, MalP 6.2 spd_1933 Amylomaltase, MalM 6.2 spd_1934 Maltose/maltodextrin ABC transporter, MalX 4.0 spd_1935 Maltodextrin ABC transporter, permease protein, MalC 3.6 spd_1936 Maltodextrin ABC transporter, permease protein, MalD 2.9 a Gene numbers refer to D39 locus tags. b...”
  • “...PtsG 1.8 spd_0662 Hypothetical protein 3.7 spd_1215 Cytoplasmic alpha-amylase, AmyA2 6.8 spd_1933 Amylomaltase, MalM 6.3 spd_1934 Maltose/maltodextrin ABC transporter, MalX 2.9 spd_1938 Maltose operon transcriptional repressor, MalR -2.9 a Gene numbers refer to D39 locus tags. b D39 annotation/TIGR4 annotation [ 20 ]. c Ratio represents...”
• The Small Molecule DAM Inhibitor, Pyrimidinedione, Disrupts Streptococcus pneumoniae Biofilm Growth In Vitro
  Yadav, PloS one 2015
  • “...-1.7 (0.04) SPD_1833 PTS system, IIA component transferase activity phosphoenolpyruvate-dependent sugar phosphotransferase system -1.6 (0.01) SPD_1934 (malX) maltose/maltodextrin ABC transporter, maltose transmembrane transporter activity -1.4 (0.01) SPD_2026 ABC transporter, permease protein transport -1.6 (0.01) SPD_0400 Glycosyl transferase family protein 8, putative transferase activity, transferring glycosyl groups...”
• Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
  Paixão, PloS one 2015
  • “...Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 5.8 SPD_0292 Gluconate 5-dehydrogenase 5.3 SPD_1409 Sugar ABC transporter ATP-binding protein 4.8 SPD_1934 malX Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 4.8 SPD_0297 PTS system transporter subunit IID 4.4 SPD_1496 PTS system transporter subunit IIBC 4.4 SPD_1006 glgC Glucose 1-phosphate adenylyltransferase 4.4 SPD_0621 lctO Lactate...”
• Proteomic and bioinformatic pipeline to screen the ligands of S. pneumoniae interacting with human brain microvascular endothelial cells
  Jiménez-Munguía, Scientific reports 2018
  • “...Secretory A, B, D 20 Q7ZAK5 Pneumolysin (Thiol-activated cytolysin) spr1739 Secretory A, B, D 21 P59214 Maltose/maltodextrin-binding protein spr1918 Lipoprotein A, B, C 22 Q8DQ09 Adhesion lipoprotein spr0906 Lipoprotein A, B, C Categories for the subcellular location were established according to LocateP. Membrane proteins were categorized...”
• Proteomic and bioinformatic pipeline to screen the ligands of S. pneumoniae interacting with human brain microvascular endothelial cells
  Jiménez-Munguía, Scientific reports 2018
  • “...D 20 Q7ZAK5 Pneumolysin (Thiol-activated cytolysin) spr1739 Secretory A, B, D 21 P59214 Maltose/maltodextrin-binding protein spr1918 Lipoprotein A, B, C 22 Q8DQ09 Adhesion lipoprotein spr0906 Lipoprotein A, B, C Categories for the subcellular location were established according to LocateP. Membrane proteins were categorized as: 1TMD, proteins...”
  • “...ontology analysis revealed that Spr1790 plays role in the membrane organization and transport. Spr1697 and Spr1918 are associated with transport of solutes across lipid bilayer. Spr0329 binds penicillin and interact selectively as well as non-covalently with ions. Spr1042 and Spr0581 are peptidases. Spr1494 and Spr0906 play...”
• A Pneumococcal Protein Array as a Platform to Discover Serodiagnostic Antigens Against Infection
  Olaya-Abril, Molecular & cellular proteomics : MCP 2015
  • “...spr1257 (80), spr1382 (1), spr1707 (3), spr1712 (78), spr1918 (22) spr0174 (79), spr0747 (37), spr0934 (15), spr1061 (55), spr1645 (52), spr1687 (18) spr0642...”

SOR_0121 extracellular solute-binding protein from Streptococcus oralis Uo5
32% identity, 66% coverage

• Potential of Prebiotic D-Tagatose for Prevention of Oral Disease
  Mayumi, Frontiers in cellular and infection microbiology 2021
  • “...transporter permease gene (SOR_1115) was up-regulated ( Figure 10 ), while sugar ABC transporter genes (SOR_0121, 1899) were down-regulated. Alteration of Metabolomic Profile Metabolomic analysis was also performed to observe the effects of changes in gene expression profiles on the tested strains. Principal component analysis illustrated...”

MALX_STRPN / P59213 Maltooligosaccharide ABC transporter solute-binding lipoprotein; Maltodextrin-binding protein; Solute-binding protein MalX from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
SP_2108 maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Streptococcus pneumoniae TIGR4
31% identity, 69% coverage

• function: Part of an ABC transporter complex involved in the uptake of maltodextrins. Binds glycogen-derived linear maltooligosaccharides increasing in size from maltotriose to maltooctaose with the highest affinity for maltotriose. Has a very weak affinity for maltose. Has also a very low affinity for maltotetraitol, indicating that the binding is selective for maltooligosaccharides with an intact reducing end.
  disruption phenotype: Grows readily on glucose and maltotriose, but is not able to grow on glycogen. Deletion mutant is still able to depolymerize glycogen to some extent resulting in alpha- glucooligosaccharides increasing in size from maltotetraose to maltooctaose and larger oligosaccharides. In contrast to the wild-type cells, which almost completely deplete alpha-glucooligosaccharides up to eight glucose units in length, only partially deplete oligosaccharides of 9-11 glucose units in length and which have little to no ability to deplete oligosaccharides longer than 11 glucose units in length, the most abundant alpha-glucooligosaccharides produced by the deletion mutant are maltopentaose, maltohexaose, and maltoheptaose.
• Streptococcus pneumoniae serotype distribution in low- and middle-income countries of South Asia: Do we need to revisit the pneumococcal vaccine strategy?
  Dhawale, Human vaccines & immunotherapeutics 2025 (no snippet)
• Bacterial surface lipoproteins mediate epithelial microinvasion by Streptococcus pneumoniae
  Chan, Infection and immunity 2024
  • “...transporter ( 31 ) RSS80_03685 SP_0749 livJ Branched chain amino-acid transporter ( 32 ) RSS80_10385 SP_2108 malX Maltosaccharide transporter ( 33 ) RSS80_00790 SP_0149 metQ Methionine-binding lipoprotein Q ( 34 ) RSS80_05810 SP_1175 phtA Pneumococcal histidine triad protein A ( 35 ) RSS80_05040 SP_1032 piaA Pneumococcal...”
• A broad-spectrum pneumococcal vaccine induces mucosal immunity and protects against lethal Streptococcus pneumoniae challenge
  Chiu, Emerging microbes & infections 2023
  • “...in meningitis [ 39 ] and colonization [ 40 ]. A lipoprotein-based subunit vaccine containing SP_2108 and SP_0148 has been shown to reduce the colonization of S. pneumoniae through activation of TLR2 [ 41 ]. These findings suggest that activation of the TLR2 signalling pathway is...”
• Bacterial surface lipoproteins mediate epithelial microinvasion byStreptococcus pneumoniae
  Chan, 2023
• Platelets, Bacterial Adhesins and the Pneumococcus
  Jahn, Cells 2022
  • “...phosphate ions - - 24 SP_1690 substrate-binding protein of ABC transporter - 4 25 MalX (SP_2108) substrate-binding protein of ABC transporter for maltose/maltodextrin - 4 26 SatA (SP_1683) substrate-binding protein of ABC transporter for sialic acid - 4 CBPs 27 CbpC (SP_0377) regulatory function for autolysis...”
• Corrected and Republished from: "A Novel, Multiple-Antigen Pneumococcal Vaccine Protects against Lethal Streptococcus pneumoniae Challenge"
  Chan, Infection and immunity 2022
  • “...such as PavB and several lipoproteins, including PsaA, PiaA, and the Th17 antigens SP_0148 and SP_2108 ( 30 ) ( Table 1 ). Conversely, 152 proteins were decreased by more than 2-fold by the vaccine preparation process, including multiple proteins required for basic metabolic functions (e.g.,...”
  • “...ABC transporter lipoprotein (PsaA) 4.03 77 , 78 SP_2093 Putative uncharacterized membrane protein 2.78 79 SP_2108 Maltose/maltodextrin-binding protein (MalX) 3.19 72 a Only proteins with an increased fold change of 2 and above are shown. Vaccination with MAV induces functional antibodies. To assess the immunogenicity of...”
• A Nonadjuvanted Whole-Inactivated Pneumococcal Vaccine Induces Multiserotype Opsonophagocytic Responses Mediated by Noncapsule-Specific Antibodies
  David, mBio 2022
  • “...Pyruvate oxidase 15,773.81,840.67 3,601.27212.76 2.131 SP_1872 piuA Iron-compound ABC transporter, iron-compound-binding protein 15,729.47473.02 18,320.274,265.17 0.220 SP_2108 malX Maltose/maltodextrin-binding protein 12,613.471,742.34 19,832.93303.2 0.653 SP_2012 gap Glyceraldehyde-3-phosphate dehydrogenase 10,625.133,76.98 6,753.272,76.51 0.654 SP_1890 amiC Oligopeptide transport system permease protein AmiC 9,958.472,560.59 13,030.931,792.25 0.388 SP_0369 pbp1A Penicillin-binding protein 1A 8,312.81701.7...”
• The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
  Nakamya, Pathogens (Basel, Switzerland) 2021
  • “...malC 2.5 <0.0001 Maltodextrin ABC transporter permease SP_2110 malD 2.4 <0.0001 Maltodextrin ABC transporter permease SP_2108 malX 2.4 <0.0001 Maltose/maltodextrin-binding protein SP_1894 gtfA 2.3 <0.0001 Sucrose phosphorylase SP_1722 SP_1722 51.0 <0.0001 PTS sucrose system EIIBCA or EIIBC SP_0648 bgaA 7.0 <0.0001 Beta galactosidase SP_1898 aga 2.2...”
• More

SGO_0104 Maltose/maltodextrin-binding protein precursor from Streptococcus gordonii str. Challis substr. CH1
32% identity, 65% coverage

• Streptococcus gordonii Type I Lipoteichoic Acid Contributes to Surface Protein Biogenesis
  Lima, mSphere 2019
  • “...SGO_0578 Amino acid ABC transporter, permease protein SGO_0982 Amino acid ABC transporter, amino acid-binding protein SGO_0104 Arabinogalactan oligomer/maltooligosaccharide transport system substrate-binding protein ArcA SGO_1593 Arginine deiminase SGO_1082 Basic membrane protein A SGO_1630 Branched-chain amino acid transport system substrate-binding protein SGO_1626 Branched-chain amino acid transport system substrate-binding...”
• Dynamics of the Streptococcus gordonii Transcriptome in Response to Medium, Salivary α-Amylase, and Starch
  Haase, Applied and environmental microbiology 2015
  • “...to compare 2CT values for target genes SGO_0100 to SGO_0104 between the growth conditions as that experiment began with each biological sample divided in half...”
  • “...RQa Log2 (ratio) P SGO_0100 SGO_0101 SGO_0102 SGO_0103 SGO_0104 2.6634 2.6666 2.9261 2.8531 2.3722 1.4133 1.415 1.549 1.5126 1.2462 0.0003 0.0011 0.0089 0.0407...”
• Mass Spectrometric Analysis of Whole Secretome and Amylase-precipitated Secretome Proteins from Streptococcus gordonii.
  Maddi, Journal of proteomics & bioinformatics 2014
  • “...19 35.3 Serine/threonine protein kinase SGO_0600 Serine/threonine protein kinase 67 18 24.6 Maltose/maltodextrin-binding protein * SGO_0104 Maltose binding domain 45 17 44.2 Oligopeptide-binding lipoprotein hppH * SGO_1715 ABC-type oligopeptide transport system 72 17 32.2 Protein with prophage function domain SGO_0067 Prophage function domain 52 16 35...”
• Effect of starch and amylase on the expression of amylase-binding protein A in Streptococcus gordonii
  Nikitkova, Molecular oral microbiology 2012
  • “...in S. gordonii are represented by annotated genes malD SGO_0102, malC SGO_0103, maltose/maltodextrin-binding protein precursor SGO_0104, and ATP-binding protein SGO_0352. A potential transcriptional regulator for this operon is the upstream positioned transcriptional repressor SGO_0100, which is a LacI/GalR family protein with a sugar-binding domain and a...”

2xd3A / P59213 The crystal structure of malx from streptococcus pneumoniae in complex with maltopentaose. (see paper)
30% identity, 70% coverage

• Ligand: alpha-d-glucopyranose (2xd3A)

SPG_2045 maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Streptococcus pneumoniae G54
31% identity, 69% coverage

• Extracellular matrix formation enhances the ability of Streptococcus pneumoniae to cause invasive disease
  Trappetti, PloS one 2011
  • “...SO/PO ST/PT SP_1274 SPG_1168 LicD2 protein 7.6 (100.0) c 5.6 (28.6) (2.0) 6.2 (1.7) SP_2108 SPG_2045 Maltose/maltodextrin ABC transporter (59.0) 7.6 (29.6) (0.4) (49.7) SP_1580 SPG_1505 Sugar ABC transporter, ATP-binding protein; maltose/maltodextrin transport system ATP-binding 4.6 (13.8) 5.3 (9.3) (4.1) (1.0) SP_0061 SPG_0065 PTS system, IIB...”

MDXE_BACSU / O06989 Maltodextrin-binding protein MdxE from Bacillus subtilis (strain 168) (see paper)
TC 3.A.1.1.26 / O06989 MalE aka yvdG, component of The maltose porter, MdxEFG and MsmX from Bacillus subtilis (see 2 papers)
BSU34610 maltose/maltodextrin-binding lipoprotein from Bacillus subtilis subsp. subtilis str. 168
30% identity, 69% coverage

• function: Part of the ABC transporter complex involved in maltodextrin import. Binds maltodextrin. Can also bind maltose with low affinity, but is not involved in its uptake.
  subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (MdxF and MdxG) and a solute-binding protein (MdxE).
• substrates: Maltose
• Carbohydrate availability regulates virulence gene expression in Streptococcus suis
  Ferrando, PloS one 2014
  • “...on the experimentally determined transcription start site (Ts arrow) C . The B. subtilis mdxE (BSU34610) promoter D . The L. monocytogenes lmo2125 promoter E . and F . Sequence alignment of the DNA binding domains of the ApuR and CcpA proteins of S. suis, L....”
• Genomic and transcriptomic analysis of carbohydrate utilization by Paenibacillus sp. JDR-2: systems for bioprocessing plant polysaccharides
  Sawhney, BMC genomics 2016
  • “...from B. subtilis (O06988) 47 0771 SBP c maltodextrin binding protein from Bacillus subtilis 168 (O06989) 33 1340 SYM d AraE xylose and arabinose symporter in B. subtilis (X98354) 49 a LT, locus tag annotated as Pjdr2_#### abbreviated to only consist of the numeric portion, ####...”

TC 3.A.1.1.16 / P58300 MalE aka PF1938, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) from Pyrococcus furiosus (see paper)
PF1938 putative sugar binding protein (malE-like) from Pyrococcus furiosus DSM 3638
28% identity, 69% coverage

• substrates: Maltooligosaccharides
• Genome-wide binding analysis of the transcriptional regulator TrmBL1 in Pyrococcus furiosus
  Reichelt, BMC genomics 2016
  • “...dehydrogenase - upstream singleton PF1920 triosephosphate isomerase - downstream operon PF1933 PF1934 PF1935 PF1936 PF1937 PF1938 putative sugar transport ATP-hydrolyzing hypothetical protein amylopullulanase malG-like sugar transport inner membrane protein malF-like sugar transport inner membrane protein malE-like sugar binding protein MD system downstream singleton PF1956 fructose-bisphosphate aldolase...”
• Experimental and computational analysis of the secretome of the hyperthermophilic archaeon Pyrococcus furiosus
  Schmid, Extremophiles : life under extreme conditions 2013
  • “...starch degradation. Previous microarray analysis have shown that the amylopullulanase PF1935*, the maltotriose binding protein PF1938 and the hypothetical protein PF1109 are the only extracellular proteins that are specifically up-regulated when P. furiosus grows on starch (Lee et al. 2006 ). All these proteins were also...”
  • “...protein SP II 40.3 11 46 PF1935* d 75993212 Amylopullulanase SP I 127.1 52 47 PF1938 18202323 Maltotriose-binding protein SP II 48.2 20 59 a Significant hits obtained after searches in Pfam 26.0 (Punta et al. 2012 ) for hypothetical proteins b The column shows the...”
• Thermostable tag (TST) protein expression system: engineering thermotolerant recombinant proteins and vaccines
  Luke, Journal of biotechnology 2011
  • “...A high copy mutation) E. coli recombinant protein expression vectors. pVEXB-MBP (MKIEE-pfMBP-GIEGR): The pfMBP gene (PF1938) from P. furiosus DSM 3638 (ATCC 43587D-5) was PCR amplified from genomic DNA using the following primer pair to make a cytoplasmic expression construct. PF1938F: 5-tcccag cacctg caccc ATGA AAATCGAAGAA...”
• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...operon in P. furiosus (PF1938-1936 and PF1933) encodes a maltodextrin binding protein (MdxE Pf , PF1938) and is upregulated in response to growth on maltose and starch [ 10 , 11 ]. In P. furiosus , the mal operon (PF1739-1741 and PF1744) encodes MalE Pf ,...”
  • “...these hypotheses and to determine the origins of these evolutionarily mobile genes. The MdxE Pf (PF1938) protein sequence was used as a query for a BLAST search of the non-redundant protein database at NCBI. The top 250 hits were aligned using ClustalX and then used to...”
• Disruption of a sugar transporter gene cluster in a hyperthermophilic archaeon using a host-marker system based on antibiotic resistance
  Matsumi, Journal of bacteriology 2007
  • “...furiosus (Mal-I, PF1739 to PF1744, and Mal-II, PF1933 to PF1938) (33), only one putative gene cluster is found on the T. kodakaraensis genome (TK1771 to TK1775)...”
• Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
  Chou, Applied and environmental microbiology 2007
  • “...sulfate transport, permease Mal II operon PF1933 PF1934 PF1935 PF1936 PF1937 PF1938 PF1939 3.9 8.3 8.4 8.1 NC 9.1 NC NC NC NC NC 2.1 NC NC NC 1.9 2.2 1.9 2.8...”
• Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
  Lee, Journal of bacteriology 2006
  • “...PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose transport (Mal-I) Maltose/trehalose transport (Mal-I) Trehalose synthetase Maltose/trehalose...”
  • “...The second transporter (Mal-II; PF1933, PF1936 to PF1938) is specific for maltooligosaccharides, but it does not transport maltose and trehalose. Accordingly,...”
• Heat shock response by the hyperthermophilic archaeon Pyrococcus furiosus
  Shockley, Applied and environmental microbiology 2003
  • “...radB Damage-inducible protein (dinF homolog) PF1739 PF0127 PF1926 PF1938 PF1742 PF0021 PF1850 2.69 0.17 1.41 0.28 1.39 0.20 1.34 0.19 1.29 0.31 0.46 0.32...”
• More

TON_1795 ABC-type maltodextrin transport system from Thermococcus onnurineus NA1
29% identity, 67% coverage

• Proteome analyses of hydrogen-producing hyperthermophilic archaeon Thermococcus onnurineus NA1 in different one-carbon substrate culture conditions
  Moon, Molecular & cellular proteomics : MCP 2012
  • “...dipeptide/oligopeptide transporter; MalEFGK (TON_1791 and TON_1795), ABC-type maltodextrin transporter; AAT, additional amino acid ABC transporter; Fdred,...”

BF29_RS09825 extracellular solute-binding protein from Heyndrickxia coagulans DSM 1 = ATCC 7050
30% identity, 66% coverage

• Time-resolved transcriptomic and proteomic profiling of <i>Heyndrickxia coagulans</i> during NaOH-buffered L-lactic acid production
  Huang, Frontiers in microbiology 2023
  • “...which was attributed to the high concentration of sodium lactate in the fermentation broth. MdxE (BF29_RS09825), MdxF (BF29_RS09830), and MdxG (BF29_RS09835) collectively encode a maltodextrin transport system known as MdxEFG, where MdxE functions as the substrate-binding protein and the latter two act as permease proteins (...”

HMPREF0675_4618 extracellular solute-binding protein from Cutibacterium acnes SK137
28% identity, 66% coverage

• Comparative Proteomic Analysis of Membrane Vesicles from Clinical C. acnes Isolates with Differential Antibiotic Resistance
  Jiang, Clinical, cosmetic and investigational dermatology 2022
  • “...regulating mitochondrial homeostasis, and dismantling the adhesion complexes of parasitic protozoa. 22 D4HFG5 0.01 pak:HMPREF0675_4618 HMPREF0675_4618 It is the ATP-binding cassette (ABC) transporter, which couples the energy stored in ATP to the movement of molecules across the membrane. ABC exporters have been linked with multidrug resistance...”

SGF29_SCHPO / Q9USW9 SAGA-associated factor 29 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 4 papers)
NP_596000 SAGA complex subunit Sgf29 from Schizosaccharomyces pombe
SPBC1921.07c SAGA complex subunit Sgf29 (predicted) from Schizosaccharomyces pombe
55% identity, 23% coverage

• function: Chromatin reader component of the transcription regulatory histone acetylation (HAT) complex SAGA (PubMed:21642955, PubMed:26401015). Sgf29 specifically recognizes and binds methylated 'Lys-4' of histone H3 (H3K4me), with a preference for trimethylated form (H3K4me3) (PubMed:26401015). In the SAGA complex, sgf29 is required to facilitate crosstalk between gcn5 acetyltransferase activity and H3K4me3 recognition (PubMed:26401015). At the promoters, SAGA is required for recruitment of the basal transcription machinery (PubMed:19056896). It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination (PubMed:19056896). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac) (PubMed:19056896).
  subunit: Component of the SAGA complex.
• Nucleosome competition reveals processive acetylation by the SAGA HAT module.
  Ringel, Proceedings of the National Academy of Sciences of the United States of America 2015
  • GeneRIF: Data indicate that Spt-Ada-Gcn5 acetyltransferase (SAGA) coactivator complex contains a separable subcomplex known as the histone acetyltransferase (HAT) module that contains the HAT, Gcn5, bound to Sgf29.
• A genome-wide screen of genes involved in cadmium tolerance in Schizosaccharomyces pombe
  Kennedy, Toxicological sciences : an official journal of the Society of Toxicology 2008
  • “...sin3 SPAC29A4.20 ELP3/YPL086C kap1 gcn5 SPBC1921.07c SPBC28F2.10c SPAC1952.05 SGF29/YCL010C NGG1/YDR176W GCN5/YGR252W SPAC6B12.05c IES2/YNL215W SPCC18.06c...”

TK1771 ABC-type maltodextrin transport system, maltodextrin-binding periplasmic component from Thermococcus kodakaraensis KOD1
28% identity, 72% coverage

• Proteome profiling of heat, oxidative, and salt stress responses in Thermococcus kodakarensis KOD1
  Jia, Frontiers in microbiology 2015
  • “...16 Predicted exonuclease TK0458 18 2.5 6.15 6.4 20.05 20.0 17 ABC-type maltodextrin-binding periplasmic component TK1771 15 3.2 4.56 4.5 49.44 51.5 18 Thermosome beta subunit TK2303 36 3.1 4.86 4.8 59.13 60.2 19 Sugar-phosphate nucleotidyltransferase TK0955 19 2.5 5.15 5.2 46.80 47.7 20 Acyl-CoA synthetase...”
  • “...Thermosome alpha subunit TK0678 48 3.5 4.84 4.3 59.12 59.9 19 ABC-type maltodextrin transport system TK1771 15 2.5 4.56 4.4 49.44 48.5 20 Thermosome beta subunit TK2303 36 3.3 4.86 4.3 59.13 60.4 21 Sugar-phosphate nucleotidyltransferase TK0219 19 2.1 5.15 5.2 46.80 45.8 22 Acyl-CoA synthetase...”
• Disruption of a sugar transporter gene cluster in a hyperthermophilic archaeon using a host-marker system based on antibiotic resistance
  Matsumi, Journal of bacteriology 2007
  • “...additional genes encoding the components of a sugar transporter (TK1771 to TK1773) of T. kodakaraensis (Fig. 2B) (24). In the latter stages of this study, we...”
  • “...TK1774* and, for simplicity, to the four-gene cluster (TK1771 to TK1774*) as malTk. Amylopullulanases, or type II pullulanases, exhibit both Downloaded from...”

KSF55_00870 extracellular solute-binding protein from Lactiplantibacillus pentosus
29% identity, 68% coverage

• Genome-wide transcriptomics revealed carbon source-mediated gamma-aminobutyric acid (GABA) production in a probiotic, <i>Lactiplantibacillus pentosus</i> 9D3
  Raethong, Heliyon 2025
  • “...(KSF55_15460), were up-regulated relative to glucose and sucrose cultures. Moreover, the expression level of the KSF55_00870, which encodes arabinogalactan oligomer/maltooligosaccharide transport system substrate-binding protein, was very low in cultures using sucrose and glucose but showed significant upregulation in lactose cultures. Table 2 List of DEGs related...”

B9H01_RS10255 extracellular solute-binding protein from Streptococcus suis
SSU05_2133 ABC transporter substrate-binding protein - maltose/maltodextrin from Streptococcus suis 05ZYH33
29% identity, 69% coverage

• Orphan response regulator CovR plays positive regulative functions in the survivability and pathogenicity of Streptococcus suis serotype 2 isolated from a pig
  Zhang, BMC veterinary research 2023
  • “...B9H01_RS10260 B9H01_RS10260 K15771 ganP 0.8343401 B9H01_RS10025 B9H01_RS10025 K11707 troA 0.76620194 B9H01_RS10000 B9H01_RS10000 K11709 troD 0.863698938 B9H01_RS10255 B9H01_RS10255 K15770 cycB 0.830055652 B9H01_RS10005 B9H01_RS10005 K11708 troC 0.802254795 Amino sugar and nucleotide sugar metabolism B9H01_RS08575 B9H01_RS08575 K02795 manY 0.792380203 B9H01_RS06090 nagA K01443 nagA 0.816709683 B9H01_RS01845 B9H01_RS01845 K00849 galK 0.764379039...”
• Overcoming function annotation errors in the Gram-positive pathogen Streptococcus suis by a proteomics-driven approach
  Rodríguez-Ortega, BMC genomics 2008
  • “...(PilT family) Lipoprotein LipoP ssu05_1083 , Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein Lipoprotein LipoP ssu05_2133 , ABC transporter substrate-binding protein maltose/maltodextrin Lipoprotein LipoP ssu05_0513 , Membrane-fusion protein Membrane TMHMM ssu05_1022 , hypothetical protein SSU05_1022 Membrane TMHMM ssu05_1635 , Predicted xylanase/chitin deacetylase Membrane TMHMM ssu05_1354 ,...”
  • “...were classed as lipoproteins. For two of them (those coded by the loci ssu05_1083 and ssu05_2133 ), PSORTb did not produce a prediction (this algorithm does not predict type-II signal peptides [ 25 , 26 ]). For the other one (that encoded in the ssu05_0700 locus),...”

lp_0175 maltose/maltodextrin ABC transporter, substrate binding protein from Lactobacillus plantarum WCFS1
F9USY7 Maltodextrin-binding protein from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0175 extracellular solute-binding protein from Lactiplantibacillus plantarum WCFS1
28% identity, 68% coverage

• Heterologous expression of the Oenococcus oeni two-component signal transduction response regulator in the Lactiplantibacillus plantarum WCFS1 strain enhances acid stress tolerance
  Zheng, BMC microbiology 2024
  • “...absorption protein-coding gene ( kup1 ), the Spx subfamily protein-coding gene (lp_3579), the MdxE-coding gene (lp_0175), and the MATE family protein-coding gene (lp_1386) were significantly upregulated at all three time points. All homologous proteins mentioned above have been reported to be involved in the process of...”
  • “...lp_3334 (adeC) 3.55 4.19 1.27 Carbohydrate transport and metabolism Maltodextrin ABC transporter; substrate binding protein lp_0175 (mdxE) 2.45 1.26 1.00 Defense mechanisms Na + driven multidrug efflux protein; MATE family lp_1386 1.99 1.48 1.52 Function unknown Lipoprotein precursor; FMN-binding protein lp_1070 2.42 1.85 1.58 Hypothetical membrane...”
• Response of Lactobacillus plantarum WCFS1 to the Gram-Negative Pathogen-Associated Quorum Sensing Molecule N-3-Oxododecanoyl Homoserine Lactone
  Spangler, Frontiers in microbiology 2019
  • “...1.48 F9USS0_LACPL lp_0091 Pyridoxamine 5 -phosphate oxidase, FMN-binding -0.81 -0.39 4 h 7 h F9USY7_LACPL lp_0175 mdxE Maltooligosaccharide transport system substrate-binding protein -0.88 -0.26 MTLD_LACPL lp_0233 mtlD Mannitol-1-phosphate 5-dehydrogenase -0.71 -0.34 F9UT36_LACPL lp_0235 Hypothetical protein -0.55 -0.69 F9UKW1_LACPL lp_0479 Hypothetical protein 0.55 1.09 F9UL19_LACPL lp_0546 hprT...”
• Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
  Zhai, Scientific reports 2017
  • “...F9UMS0 citF; citrate lyase, alpha chain 1.95 Q88VM8 dltC1; D-alaninepoly(phosphoribitol) ligase subunit 2-1 1.65 Transporter F9USY7 mdxE; maltodextrin ABC transporter, substrate binding protein 1.91 F9USZ2 msmX; maltodextrin ABC transporter, ATP-binding protein 2.23 F9USG5 lp_3042; Multidrug ABC transporter, ATP-binding and permease protein 1.97 F9UM05 lp_0783; Oligopeptide ABC...”
• Systematic elucidation of independently modulated genes in Lactiplantibacillus plantarum reveals a trade-off between secondary and primary metabolism
  Qiu, Microbial biotechnology 2024
  • “...region between 151,222 and 158,185bp belong to the same operon (Figure 3A ). While mdxE (lp_0175), mdxG (lp_0177) and lp_0178 are already included by both MalR and MdxR regulons, MalR+MdxR IM also captures the combinatorial regulatory signals for malS (lp_0179) and msmX (lp_0180), which share the...”

SEQ_1448 maltose/maltodextrin-binding protein precursor from Streptococcus equi subsp. equi 4047
30% identity, 65% coverage

• Differences in the Accessory Genomes and Methylomes of Strains of Streptococcus equi subsp. equi and of Streptococcus equi subsp. zooepidemicus Obtained from the Respiratory Tract of Horses from Texas
  Morris, Microbiology spectrum 2022
  • “...1411644 m6A CTGCAG SEQ_1410 1411647 m6A CTGCAG SEQ_1439 1442999 m6A CTGCAG SEQ_1439 1443002 m6A CTGCAG SEQ_1448 1453017 m6A CTGCAG SEQ_1448 1453020 m6A CTGCAG SEQ_1597 1602240 m6A CTGCAG SEQ_1597 1602243 m6A CTGCAG SEQ_1597 1602706 m6A CTGCAG SEQ_1615 1626084 m6A CTGCAG SEQ_1625 1634867 m6A CTGCAG SEQ_1625 1634870 m6A...”

SeseC_01633 extracellular solute-binding protein from Streptococcus equi subsp. zooepidemicus ATCC 35246
30% identity, 65% coverage

• Insight into the specific virulence related genes and toxin-antitoxin virulent pathogenicity islands in swine streptococcosis pathogen Streptococcus equi ssp. zooepidemicus strain ATCC35246
  Ma, BMC genomics 2013
  • “...Additionally, we found that some genes, including mal A (SeseC_01626), mal D (SeseC_01627), mal E (SeseC_01633, SeseC_01622), mal F (SeseC_01624, SeseC_01630), mal G (SeseC_01625) and mal Q (SeseC_01617) were upregulated when Sz35246 infected mice. These genes are related to maltose transport and metabolism and utilization of...”

SPy1306, SPy_1306 maltose/maltodextrin-binding protein from Streptococcus pyogenes M1 GAS
M5005_Spy_1067 maltose/maltodextrin-binding protein from Streptococcus pyogenes MGAS5005
29% identity, 69% coverage

• The group A <i>Streptococcus</i> pathogenicity island RD2: virulence role and barriers to conjugative transfer
  Roshika, Infection and immunity 2025
  • “...A431 or VK2 cells, it may be one of the smaller, predicted RD2 adhesins (i.e., Spy1306 or Spy1326) that play a role, and these may be inhibited by the capsule. On a related note, it should be mentioned that no RD2-encoded gene was identified from a...”
• The RD2 Pathogenicity Island Modifies the Disease Potential of the Group A Streptococcus
  Roshika, Infection and immunity 2021 (secret)
• In vivo expression of Streptococcus pyogenes immunogenic proteins during tibial foreign body infection
  Freiberg, Infection and immunity 2014
  • “...15675028 15674573 SPy_1760 SPy_1676 SPy_1282 SPy_1547 SPy_1306 SPy_1544 SPy_0160 SPy_1283 SPy_1541 SPy_0274 SPy_2079 SPy_1881 SPy_0463 SPy_1406 SPy_1651...”
• Genome-wide identification of genes required for fitness of group A Streptococcus in human blood
  Le, Infection and immunity 2013
  • “...Spy1079 Spy1189 Spy1194 Spy1237 Spy1240 Spy1257 Spy1269 Spy1304 Spy1306 Spy1337 Spy1351 Spy1364 Spy1389 Spy1391 Spy1423 Spy1426 b Le Breton et al. TABLE 2...”
• Lateral gene transfer of streptococcal ICE element RD2 (region of difference 2) encoding secreted proteins
  Sitkiewicz, BMC microbiology 2011
  • “...and G streptococci by PCR. A. Detection of genes encoding putative extracellular proteins Strain M28_ Spy1306 M28_ Spy1307 M28_ Spy1308 M28_ Spy1325 M28_ Spy1326 M28_ Spy1332 M28_ Spy1336 GCS 15169 + + - + + - + 15170 + + - - + - - 15172...”
• Surface export of GAPDH/SDH, a glycolytic enzyme, is essential for Streptococcus pyogenes virulence
  Jin, mBio 2011
  • “...transporters ( TableS5 ). In particular, multiple operons ( SPy1057-1060 , SPy1294-1296 , SPy1299-1301 , SPy1306 , and SPy1986 ) containing genes for utilization/transport of nonglucose substrates, such as maltose/maltodextrin, mannose, mannose/fructose, N -acetylneuraminate, -glucoside, fructose, cellobiose, galactose, lactose, and trehalose were downregulated (8- to 32-fold...”
• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...permease protein M28_Spy1046 SPy1302 amyA 82.63 Cyclodextrin glucanotransferase M28_Spy1047 SPy1304 amyB 2.06 24.86 Neopullulanase M28_Spy1048 SPy1306 malX 37.14 Maltose maltodextrin-binding protein M28_Spy1349 SPy1592 - 42.74 Sugar-binding protein M28_Spy1350 SPy1593 - 13.77 Sugar transport system permease protein M28_Spy1351 SPy1595 - 7.07 Sugar transport system permease protein M28_Spy1354...”
• Protein array profiling of tic patient sera reveals a broad range and enhanced immune response against Group A Streptococcus antigens
  Bombaci, PloS one 2009
  • “...11 SPy1795 putative ABC transporter 38 22 3 SPy1054 putative collagen-like protein 36 14 3 SPy1306 maltose/maltodextrin-binding protein 34 15 0 Numeric values refer to % of positive sera of each class versus each antigen. Number of tic, pharyngitis and no tic sera positive against each...”
  • “...sera from either no tic or tic patients with each of the antigens Spy0843, M5005_Spy0249, Spy1306 and Spy1939. Standard errors of the means are reported. Both ELISA titers and MFIs differences between the two sera classes were statistically significant with P values<0.05 calculated either with T...”
• More
• Improved transformation efficiency of group A Streptococcus by inactivation of a type I restriction modification system
  Finn, PloS one 2021
  • “...854. Gene Locus Gene Name Gene product RNA-seq qRT-PCR M5005_Spy_1066 amyB neopullulanase/cyclomaltodextrinase/maltogenic alpha-amylase 1.277 -0.327 M5005_Spy_1067 malX maltose/maltodextrin-binding protein 1.197 0.061 M5005_Spy_1399 - PTS system galactose-specific transporter subunit IIC 1.179 -0.576 M5005_Spy_1499 grpE putative Hsp-70 cofactor 1.421 0.160 M5005_Spy_1634 lacF PTS system lactose-specific transporter subunit IIA...”
• Genome-wide analysis of in vivo CcpA binding with and without its key co-factor HPr in the major human pathogen group A Streptococcus
  DebRoy, Molecular microbiology 2021
  • “...Prom CTGCAAGCGGTTGCAT M5005_Spy_1058 malE Maltose/maltodextrinbinding protein G Yes Independent 36 Yes Yes Yes Prom ATCGTAATCGCTTTCA M5005_Spy_1067 malX Sugar ABC transporter substratebinding protein G Yes Semi dependent 37 Yes Yes Yes Prom TTAGAAAACGCTTTCT M5005_Spy_1083 bglG Transcription antiterminator BglG G Yes Semi dependent 38 Yes Yes Yes ORF...”
• Serine/threonine protein kinase Stk is required for virulence, stress response, and penicillin tolerance in Streptococcus pyogenes
  Bugrysheva, Infection and immunity 2011
  • “...demonstrated that Stk activates genes from M5005_Spy_1063 to M5005_Spy_1067 (Table 1), which are all in the same orientation. These genes Downloaded from...”
• Two closely related ABC transporters in Streptococcus mutans are involved in disaccharide and/or oligosaccharide uptake
  Webb, Journal of bacteriology 2008
  • “...Spr1922 (accession number AE008556) (C), and M5005_Spy_1055 to M5005_Spy_1067 (accession number CP000017) (D). optical density at 620 nm of 1. Prior to their...”

M28_Spy1048 maltose/maltodextrin-binding protein from Streptococcus pyogenes MGAS6180
29% identity, 69% coverage

• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...system permease protein M28_Spy1046 SPy1302 amyA 82.63 Cyclodextrin glucanotransferase M28_Spy1047 SPy1304 amyB 2.06 24.86 Neopullulanase M28_Spy1048 SPy1306 malX 37.14 Maltose maltodextrin-binding protein M28_Spy1349 SPy1592 - 42.74 Sugar-binding protein M28_Spy1350 SPy1593 - 13.77 Sugar transport system permease protein M28_Spy1351 SPy1595 - 7.07 Sugar transport system permease protein...”

TC 3.A.1.1.6 / Q48395 CymE, component of Cyclodextrin porter from Klebsiella oxytoca (see paper)
26% identity, 59% coverage

• substrates: Cyclodextrin

6fflA / Q6MNM0 Maltose/maltodextrin-binding domain male from bdellovibrio bacteriovorus bound to maltotriose (see paper)
27% identity, 68% coverage

• Ligand: alpha-d-glucopyranose (6fflA)

TC 3.A.1.1.44 / Q7AKP1 Putative maltose-binding protein, component of MalEFG (K unknown), involved in maltose and maltodextrin uptake from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
SCO2231 maltose-binding protein from Streptomyces coelicolor A3(2)
26% identity, 67% coverage

• substrates: Maltodextrin, Maltose
  tcdb comment: The MalK protein may be the MsiK (Sco4240; Q9L0Q1; see 3.A.1.1.33) protein
• ArgR of Streptomyces coelicolor is a versatile regulator
  Pérez-Redondo, PloS one 2012
  • “...hisD NS 2.0 NS NS SCO2210 ( glnII ) (6) 23736302374004 5,3 ND glnII argR SCO2231 ( malE )-SCO2232 ( malR ) 24003462400648 9,3 8,6 + SCO2686 29307012931003 12,8 + SCO3034 ( whiB ) 33210203321291 6,0 + whiB NS 0.5 (5) NS 1.7 (5) whiB argR...”
• Quantitative proteomics analysis of Streptomyces coelicolor development demonstrates that onset of secondary metabolism coincides with hypha differentiation
  Manteca, Molecular & cellular proteomics : MCP 2010
  • “...domains); SCO4296, chaperonin GroEL (two transmembrane domains); SCO2231 (one signal peptide), a putative bacterial transport protein; and SCO3549, BldG (see...”
• Lack of A-factor production induces the expression of nutrient scavenging and stress-related proteins in Streptomyces griseus
  Birkó, Molecular & cellular proteomics : MCP 2009
  • “...SCO7020 (78%), SAV5981 (73%), SCO5776 (40%), SAV2485 (55%) SCO2231 (48%), SAV5977 (48%) SCO5776 (40%), SAV2485 (55%) SCO1793 (81%), SAV6485 (83%) SCO5260 (58%),...”
  • “...proteins related to ABC transporter systems (including SCO5776, SCO2231, and SCO6009 whose orthologues we found in this study), which was considered as a...”

Q6MNM0 ABC-type maltose transporter (EC 7.5.2.1) from Bdellovibrio bacteriovorus (see paper)
TC 3.A.1.1.51 / Q6MNM0 Maltose - maltoheptose transporter, MalEFGK from Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
27% identity, 47% coverage

• substrates: Maltoheptose, Maltohexose, Maltopentose, Maltose, Maltotetrose, Maltotriose, Trehalose
  tcdb comment: MalEF is a R-M fusion protein with the MalE domain N-terminal and the MalF domain C-terminal. The protein, of 733 aas, has 8 TMSs, one N-terminal to MalE (a signal sequence for export of the MalE domain to the periplasm), an extra TMS at the N-terminus to bring the N-terminus to the periplasmic side of the inner membrane, and then the usual 6 TMSs observed for most ABC membrane proteins. MalG (M, 272 aas, 6 TMSs) and MalK (C, 374 aas) are of normal size and composition. While MalE of E. coli was able to additionally increase ATPase activity of MalFGK2Bb in vitro, the isolated MalE domain of B. bacteriovorus failed to stimulate the E. coli system (Licht et al. 2018)

P41130 Maltose-binding periplasmic protein (Fragment) from Photorhabdus luminescens
91% identity, 8% coverage

• METSP: a maximum-entropy classifier based text mining tool for transporter-substrate identification with semistructured text
  Zhao, BioMed research international 2015
  • “...collect some transporters with similar functions in different organisms [ 33 ]. The UniProt entry P41130 (maltose-binding periplasmic protein) from photorhabdus luminescens is not included in TCDB because it is similar to transporter P0AEX9 (maltose-binding periplasmic protein) from E. coli . In summary, our approach utilizes...”

8artB / C9ZHD5 Abc transporter binding protein male from streptomyces scabiei in complex with maltose
23% identity, 69% coverage

• Ligand: alpha-d-glucopyranose (8artB)

M28_Spy1039 maltose/maltodextrin-binding protein from Streptococcus pyogenes MGAS6180
28% identity, 64% coverage

• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...2.80 2.01 Glucosaminefructose-6-phosphate aminotransferase M28_Spy1036 SPy1291 glgP 2.16 Maltodextrin phosphorylase M28_Spy1037 SPy1292 malM 14.96 4-alpha-glucanotransferase M28_Spy1039 SPy1294 malE 4.94 Maltose maltodextrin-binding protein M28_Spy1041 SPy1296 malG 2.19 Maltose transport system permease protein M28_Spy1044 SPy1299 malD 34.73 Maltodextrin transport system permease protein M28_Spy1045 SPy1301 malC 38.81 Maltodextrin transport...”

Spy49_1028 Maltose maltodextrin ABC transporter, substrate binding periplasmic protein malE from Streptococcus pyogenes NZ131
28% identity, 64% coverage

• Transcriptomic Analysis of Streptococcus pyogenes Colonizing the Vaginal Mucosa Identifies hupY, an MtsR-Regulated Adhesin Involved in Heme Utilization
  Cook, mBio 2019
  • “...), mannose ( spy49_0834 to - 0836 and sak_1908 to - 1910 ), maltose ( spy49_1028 to - 1030 and sak_1475 to - 1477 ), and galactose and fructose ( spy49_1327c to - 1329c and sak_1893 to - 1895 ). Genes and operons involved in degradation...”

M5005_Spy_1058 maltose/maltodextrin-binding protein from Streptococcus pyogenes MGAS5005
28% identity, 66% coverage

• Genome-wide analysis of in vivo CcpA binding with and without its key co-factor HPr in the major human pathogen group A Streptococcus
  DebRoy, Molecular microbiology 2021
  • “...ORF TAAGATACCGCTTGCA M5005_Spy_1055 glgP Maltodextrin phosphorylase G Yes Independent 34 Yes Yes Yes ORF TAAGATACCGCTTGCA M5005_Spy_1058 malE Maltose/maltodextrinbinding protein G Yes Independent 35 Yes Yes Yes Prom CTGCAAGCGGTTGCAT M5005_Spy_1057 malR LacI family transcriptional regulator K Yes Independent 35 Yes Yes Yes Prom CTGCAAGCGGTTGCAT M5005_Spy_1058 malE Maltose/maltodextrinbinding...”
• Maltodextrin utilization plays a key role in the ability of group A Streptococcus to colonize the oropharynx
  Shelburne, Infection and immunity 2006
  • “...infected with GAS (28). One of these proteins, M5005_Spy_1058, is a putative maltodextrin-binding protein that has been annotated as Many human bacterial...”
  • “...(Table 2) (52). The malE open reading frame M5005_Spy_1058 corresponds to open reading frame SPy1294 in serotype M1 strain SF370 (12). Sequence data obtained...”

SPs0871 putative maltose/maltodextrin-binding protein from Streptococcus pyogenes SSI-1
SpyM3_0983 putative maltose/maltodextrin-binding protein from Streptococcus pyogenes MGAS315
28% identity, 64% coverage

• Characterization of a putative maltodextrin-binding protein of Streptococcus pyogenes, SPs0871 and the development of a VHH inhibitor
  Yamawaki, Biochemical and biophysical research communications 2021 (PubMed)
  • “...protein of Streptococcus pyogenes, SPs0871 and the development of a VHH inhibitor Biochemical and Biophysical Research Communications Journal sco 0006291X 565 1...”
  • “...strategy for treatment, we physicochemically characterized SPs0871, a putative maltose/maltodextrin-binding protein that is thought to have important roles...”
• Novel regulatory small RNAs in Streptococcus pyogenes
  Tesorero, PloS one 2013
  • “...[20] , [42] SSRC22 SPyM3_0918 hypothetical protein <<< SPyM3_0919 hypothetical protein <<< Q, Z SSRC23 SPyM3_0983 putative maltose/maltodextrin-binding protein >>> SPyM3_0984 putative maltose/maltodextrin ABC transport system (permease) >>> Q, Z SSRC24 SPyM3_0989 hypothetical protein <<< SPyM3_0990 putative esterase <<< Q, Z SSRC25 SPyM3_1093 putative heavy metal/cadmium-transporting...”

Desfe_0354 extracellular solute-binding protein from Desulfurococcus amylolyticus DSM 16532
27% identity, 63% coverage

• Metabolic reconstruction and experimental verification of glucose utilization in Desulfurococcus amylolyticus DSM 16532
  Reischl, Folia microbiologica 2018
  • “...the sugar via ABC transporter permease (Desfe_0355 and Desfe_0366) and the ABC transporter substrate-binding protein (Desfe_0354). Fermentative growth D. amylolyticus possesses all necessary genes for gluconeogenesis and glycolysis (Fig. 1 ). The glucose, fructose, and mannose degradation pathways lead to generation of beta-D-fructose-6-phosphate, where they enter...”

SPy1294 putative maltose/maltodextrin-binding protein from Streptococcus pyogenes M1 GAS
SPy_1294 extracellular solute-binding protein from Streptococcus pyogenes M1 GAS
28% identity, 64% coverage

• Surface interactome in Streptococcus pyogenes
  Galeotti, Molecular & cellular proteomics : MCP 2012
  • “...inlA; malX; prsA; SPy0210; SPy0252; SPy0457; SPy0778; SPy1294; SPy1390 lmb; mtsA; tlpA; SPy0163; SPy1228 cysM isp; prtS; SPy0793; SPy0843; SPy1326 SpyM3_0104...”
• Adaptation of group A Streptococcus to human amniotic fluid
  Sitkiewicz, PloS one 2010
  • “...2.01 Glucosaminefructose-6-phosphate aminotransferase M28_Spy1036 SPy1291 glgP 2.16 Maltodextrin phosphorylase M28_Spy1037 SPy1292 malM 14.96 4-alpha-glucanotransferase M28_Spy1039 SPy1294 malE 4.94 Maltose maltodextrin-binding protein M28_Spy1041 SPy1296 malG 2.19 Maltose transport system permease protein M28_Spy1044 SPy1299 malD 34.73 Maltodextrin transport system permease protein M28_Spy1045 SPy1301 malC 38.81 Maltodextrin transport system...”
• Proteomic analysis and identification of Streptococcus pyogenes surface-associated proteins
  Severin, Journal of bacteriology 2007
  • “...SPy0163 SPy0210 SPy0317 SPy0453 SPy0457 SPy1094 SPy1274 SPy1294 SPy1390 SPy1882 SPy2037 Secreted proteins SPy0019 SPy0167 SPy0292 SPy0469 SPy0714 SPy1037...”
• Maltodextrin utilization plays a key role in the ability of group A Streptococcus to colonize the oropharynx
  Shelburne, Infection and immunity 2006
  • “...reading frame M5005_Spy_1058 corresponds to open reading frame SPy1294 in serotype M1 strain SF370 (12). Sequence data obtained from both DNA strands with an...”
• Central role of a bacterial two-component gene regulatory system of previously unknown function in pathogen persistence in human saliva
  Shelburne, Proceedings of the National Academy of Sciences of the United States of America 2005
  • “...including pulA (spy1972), encoding a pullulanase, and MalE (spy1294), encoding an inferred maltose-binding protein (Fig. 2C and Table 1). We also identified...”
  • “...amyA (spy1302) (cyclodextrin glucanotransferase), malE (spy1294) (maltose-binding protein), araD (spy0179) (ribose epimerase), and asaD (spy0629)...”
• Identification and characterization of HtsA, a second heme-binding protein made by Streptococcus pyogenes
  Lei, Infection and immunity 2003
  • “...little Fe, Mn, and Zn (Fig. 5). The negative-control protein (Spy1294 containing the His tag) contained levels of Fe and Mn similar to those in the buffer but a...”
  • “...(THCl), Spy0385, MtsA, HtsA, and the negative-control protein Spy1294 (putative maltose/ maltodextrin binding protein), each at 100 M in the buffer. VOL. 71,...”
• The role of CopA in Streptococcus pyogenes copper homeostasis and virulence
  Dao, Journal of inorganic biochemistry 2023
  • “...(> 3-fold), belonged to the PTS family of transporters, while the maltose import pathway genes, SPy_1294, SPy_1296, and SPy_1297, were also upregulated (11.3-fold) ( Table S5 ). The putative PTS genes are predicted to encode a carbohydrate-uptake system with specificity for mannose, maltose, fructose, or N...”
• Multicomponent Vaccines against Group A Streptococcus Can Effectively Target Broad Disease Presentations
  Shaw, Vaccines 2021
  • “...(AP1) (SPy_0125) Pilin tip Cell wall L. lactis 3329 [ 17 , 30 ] MalE (SPy_1294) Maltodextrin binding, saliva survival Membrane - 828 [ 19 , 31 ] Five protein antigens were selected for inclusion in the present study. The functional role and cellular location of...”
• Development of a multicomponent vaccine for Streptococcus pyogenes based on the antigenic targets of IVIG
  Reglinski, The Journal of infection 2016
  • “...dnaK , M5005_Spy1498 , Spy_1760 Chaperone protein DnaK a n/a n/a malE , M5005_Spy1058 , Spy_1294 Maltose/maltodextrin-binding protein b n/a n/a oppA , M5005_Spy0249 Oligopeptide-binding protein 11 No M5005_Spy0137 Nucleoside-binding protein c n/a n/a pulA , SPy_1972 Putative pullulanase 10 No M5005_Spy0942 , Spy_1228 Nucleoside-binding protein...”

1eu8A / Q7LYW7 Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
27% identity, 72% coverage

• Ligand: alpha-d-glucopyranose (1eu8A)

SeseC_01622 extracellular solute-binding protein from Streptococcus equi subsp. zooepidemicus ATCC 35246
28% identity, 67% coverage

• Insight into the specific virulence related genes and toxin-antitoxin virulent pathogenicity islands in swine streptococcosis pathogen Streptococcus equi ssp. zooepidemicus strain ATCC35246
  Ma, BMC genomics 2013
  • “...we found that some genes, including mal A (SeseC_01626), mal D (SeseC_01627), mal E (SeseC_01633, SeseC_01622), mal F (SeseC_01624, SeseC_01630), mal G (SeseC_01625) and mal Q (SeseC_01617) were upregulated when Sz35246 infected mice. These genes are related to maltose transport and metabolism and utilization of carbohydrates,...”

5mk9A / B0L7B0 Maltodextrin binding protein male1 from l. Casei bl23 bound to beta- cyclodextrin (see paper)
26% identity, 66% coverage

• Ligand: alpha-d-glucopyranose (5mk9A)

EF1345 sugar ABC transporter, sugar-binding protein from Enterococcus faecalis V583
IUJ47_RS09705, OG1RF_11135 extracellular solute-binding protein from Enterococcus faecalis OG1RF
28% identity, 67% coverage

• Enterococcus faecalis Maltodextrin Gene Regulation by Combined Action of Maltose Gene Regulator MalR and Pleiotropic Regulator CcpA
  Grand, Applied and environmental microbiology 2020 (secret)
• Characterization of Two Metal Binding Lipoproteins as Vaccine Candidates for Enterococcal Infections
  Romero-Saavedra, PloS one 2015
  • “...EFF34249 Extracellular protein 86% 72% 9E-89 EF0577 Lipoprotein 22,1 EFF33471 PsaA fm 100% 99% 0 EF1345 Sugar ABC transporter 15,4 EFF35767.1 Maltodextrin-binding protein 92% 26% 1E-27 EF1546 LysM domain protein 3,7 EFF34140 LysM domain protein 100% 39% 3E-23 EF1677 Lipoprotein 9,9 WP_002327802 ABC transporter sugar-binding protein...”
• The transcriptome of the nosocomial pathogen Enterococcus faecalis V583 reveals adaptive responses to growth in blood
  Vebø, PloS one 2009
  • “...transport systems in the cell. For example the up-regulation of genes encoding two sugar ABC-transporters (EF1345 and EF1344-43), further supports that V583 utilizes alternative sugars from the blood. Certain transport system encoding genes were down-regulated during growth in blood including a major facilitator ABC transporter (EF0082),...”
• Transcriptional response of Enterococcus faecalis V583 to erythromycin
  Aakra, Antimicrobial agents and chemotherapy 2005
  • “...EF1057 EF1100 EF1128 EF1254 EF1268 EF1304 EF1331 EF1344 EF1345 EF1352 EF1492 EF1673 EF1720 EF1759 EF2049 EF2050 EF2074 EF2081 EF2394 EF2647 EF2769 EF2959 EF2960...”
• Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
  Liu, Plants (Basel, Switzerland) 2023
  • “...ABC transporter substrate-binding protein IUJ47_RS07260 2.394 ABC transporter permease IUJ47_RS09700 2.483 Sugar ABC transporter permease IUJ47_RS09705 2.566 Extracellular solute-binding protein IUJ47_RS04400 2.715 BMP family protein IUJ47_RS12720 3.049 Thiol reductant ABC exporter subunit CydD IUJ47_RS04405 3.21 BMP family protein IUJ47_RS09695 3.237 Sugar ABC transporter permease IUJ47_RS04420 3.248...”
• Global Regulation of Gene Expression by the MafR Protein of Enterococcus faecalis
  Ruiz-Cruz, Frontiers in microbiology 2015
  • “...(5 to 3) OG1RF_10298 GGCGTTCATTACGTTGCTGA TCGCTTCGTCAATGGTTTGAT OG1RF_10456 AGACGCCAATTTGTTAGAACG CACAACTAGCGGCTAAAGAAG OG1RF_10683 CAGAAGATGGCTTACACATTACCT GAGTAGGCTGTCCATGTCGCT OG1RF_10684 TAATGGTCGTTGTGGCAGTA AATTGCCCAACCGATACTCT OG1RF_11135 CGTTCGTAGTTTTGCTGTCA GAAGGGACAAAGCCGATTTCT OG1RF_11146 GAGGGTGGCTTTAGTGGAGA TTCACCTTCTGCTACGACTT OG1RF_11592 AACAAGCCGCCTTATTTGGT GGTTCTTCGCCAGTGTTCAT OG1RF_11763 AACATCGGCGGTATCTTCAG ATGCCTACATCACCAGTAGC OG1RF_11948 CTTGTACTGATGTGACTGGGTT CCAACGCTCCTGTAATGGTT OG1RF_12398 CCCGACGAATGATTTGCCTA ATCTAACGAACCAGCGACACT OG1RF_12405 GAAGCATTGCGTTTGGAGAT AGAAGCGACCACTTTGTTTG OG1RF_12439 GCAACGAAATGGTGGAACAG AAGGCATCGGCAATCTCTAAG OG1RF_12564 ACTTGTTCGTGGACGGATTC TGCAATGCCAACTTCTGTTA Growth and Transformation of...”
  • “...metabolism OG1RF_10683 ( malP ) OG1RF_11003-05 ABC transporter (unknown substrate) ND OG1RF_11135-33 Sugar ABC transporter OG1RF_11135 OG1RF_11146-49 Glycerol metabolism OG1RF_11146 ( gldA ) OG1RF_11181-88 Molybdenum cofactor biosynthesis (ABC transporter) ND OG1RF_11592-90 Glycerol metabolism OG1RF_11592 ( glpK ) OG1RF_11616-11 Mannose-class PTS transporter ND OG1RF_11763-61 Carbohydrate ABC transporter...”

MALE_THELN / Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see 4 papers)
29% identity, 53% coverage

• function: Part of the ABC transporter complex MalEFGK involved in trehalose/maltose import. Binds maltose and trehalose.
  subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE).

TC 3.A.1.1.7 / O51923 MalE aka PF1739, component of Maltose/trehalose porter (see paper)
PF1739 trehalose/maltose binding protein from Pyrococcus furiosus DSM 3638
29% identity, 53% coverage

• substrates: Maltose, Trehalose
• Genome-wide binding analysis of the transcriptional regulator TrmBL1 in Pyrococcus furiosus
  Reichelt, BMC genomics 2016
  • “...PF1751 (Fig. 2 , chromosomal position 1,613,140 to 1,629,427). This fragment contains the TM system (PF1739 to PF1747), which encodes for the trehalose/maltose-specific-ABC transporter [ 56 ]. The transcriptional regulator TrmB is also part of this operon and therefore it was not possible to detect the...”
• Genome sequencing of a genetically tractable Pyrococcus furiosus strain reveals a highly dynamic genome
  Bridger, Journal of bacteriology 2012
  • “...2 PF0189 PF0190 PF0271 PF0272 PF0401 PF1738 PF1739 PF_t006 PF0497 PF1239 PF1240 Dihydroorotase [Cold-induced protein A, CipA (57)] Hypothetical protein...”
  • “...(PF0272), sugar kinase (PF1738), trehalose/maltose binding protein (PF1739), and GAPN (PF0755). However, the growth rates and final cell densities of all...”
• Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
  Chou, Applied and environmental microbiology 2007
  • “...on maltose, 6845 6846 CHOU ET AL. ose transporter (PF1739 to PF1741) and a TrmB homolog (PF1743) known to regulate maltose uptake (30), was minimally affected...”
  • “...on tryptone (29, 48). The Mal I operon (PF1739 to PF1749) (62), which includes genes encoding an ABC trehalose/malt- APPL. ENVIRON. MICROBIOL. P. FURIOSUS...”
• Disruption of a sugar transporter gene cluster in a hyperthermophilic archaeon using a host-marker system based on antibiotic resistance
  Matsumi, Journal of bacteriology 2007
  • “...the two sugar transporters present in Pyrococcus furiosus (Mal-I, PF1739 to PF1744, and Mal-II, PF1933 to PF1938) (33), only one putative gene cluster is found...”
• Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
  Lee, Journal of bacteriology 2006
  • “...PF0478* PF0588 PF1256 PF1535 PF1739 -Glucosidase 4--Glucanotransferase ADP-dependent glucokinase -Amylase Cyclomaltodextrin glucanotransferase Phosphoglucose...”
  • “...maltose in E. coli. One is the Mal-I transporter (PF1739 to PF1741, PF1744), which in P. furiosus has been shown to recognize and transport maltose and...”
• Metabolic and evolutionary relationships among Pyrococcus Species: genetic exchange within a hydrothermal vent environment
  Hamilton-Brehm, Journal of bacteriology 2005
  • “...maltose/trehalose transporter (malEFG and malK, represented by PF1739 to PF1741 and PF1744, respectively), as well as a trehalose-degrading enzyme (PF1742) (1,...”
• Heat shock response by the hyperthermophilic archaeon Pyrococcus furiosus
  Shockley, Applied and environmental microbiology 2003
  • “...trehalose synthase Recombinase, radB Damage-inducible protein (dinF homolog) PF1739 PF0127 PF1926 PF1938 PF1742 PF0021 PF1850 2.69 0.17 1.41 0.28 1.39 0.20 1.34...”
• Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
  Schut, Journal of bacteriology 2003
  • “...PF1703 PF1706 PF1708 PF1709 PF1710 PF1711 PF1713 PF1739 [Maltose transport] PF1740 PF1741 PF1742 PF1784 PF1852 PF1870 [Maltose transport] PF1935 PF1936 PF1937...”
• More

LACR_1853 ABC-type sugar transport system, periplasmic component from Lactococcus lactis subsp. cremoris SK11
25% identity, 55% coverage

• Transcriptome Analysis of a Spray Drying-Resistant Subpopulation Reveals a Zinc-Dependent Mechanism for Robustness in L. lactis SK11
  Dijkstra, Frontiers in microbiology 2018
  • “...36 2.22 5.10 15 LACR_1852 Neopullulanase 3.98 5.10 41 2.72 8.10 23 2.39 2.10 18 LACR_1853 Maltose ABC transporter substrate binding protein 4.59 7.10 33 4.31 9.10 30 2.98 2.10 16 LACR_1201 Hypothetical protein 4.41 8.10 28 5.18 6.10 36 2.67 9.10 12 LACR_1335 ATP phosphoribosyltransferase...”

lmo1730 similar to sugar ABC transporter binding protein from Listeria monocytogenes EGD-e
26% identity, 64% coverage

• Protein level identification of the Listeria monocytogenes sigma H, sigma L, and sigma C regulons
  Mujahid, BMC microbiology 2013
  • “...glpK Energy metabolism Other Lmo1699 1.92 Methyl-accepting chemotaxis protein lmo1699 Cellular processes Chemotaxis and motility Lmo1730 2.55 lactose/L-arabinose transport system substrate-binding protein lmo1730 Transport and binding proteins Carbohydrates, organic alcohols, and acids Lmo1791 1.75 hypothetical protein lmo1791 Lmo1812 1.70 L-serine dehydratase iron-sulfur-dependent alpha subunit lmo1812 Energy...”
• Refinement of the Listeria monocytogenes σB regulon through quantitative proteomic analysis
  Mujahid, Microbiology (Reading, England) 2013
  • “...lmo0643, lmo1046, lmo1349, lmo2047, lmo2743, lmo0110 and lmo1730 (Table S2). Interestingly, a number of proteins that were identified as showing sB-dependent...”
• Glycerol metabolism and PrfA activity in Listeria monocytogenes
  Joseph, Journal of bacteriology 2008
  • “...trpE lmo1634 ansB metK lmo1682 lmo1705 lmo1719 lmo1720 lmo1730 lmo1739 lmo1749 purD purH Function 5422 JOSEPH ET AL. J. BACTERIOL. TABLE 3--Continued Fold...”
• Listeria monocytogenes surface proteins: from genome predictions to function
  Bierne, Microbiology and molecular biology reviews : MMBR 2007
  • “...Lmo0859 Lmo1016 Lmo1041 Lmo1073 Lmo1388 Lmo1426 Lmo1671 Lmo1730 Lmo1738 Lmo1847 Lmo1959 Lmo2007 Lmo2125 Lmo2184 Lmo2196 Lmo2349 Lmo2417 Lmo2431 Lmo2499 Lmo2569...”

Q92AS8 ABC-type beta-glucan transporter (EC 7.5.2.3) from Listeria innocua (see paper)
lin1841 similar to sugar ABC transporter binding protein from Listeria innocua Clip11262
26% identity, 64% coverage

• Structural and thermodynamic insights into β-1,2-glucooligosaccharide capture by a solute-binding protein in Listeria innocua
  Abe, The Journal of biological chemistry 2018
  • “...characteristics of the Sopn-binding protein (SO-BP, Lin1841) associated with the ATP-binding cassette (ABC) transporter from the Grampositive bacterium...”
  • “...putative ABC transporter components (Lin1841-1843) are encoded: Lin1841 and Lin1842-1843 encode an SBP and TMDs, respectively. However, it is unknown whether...”
• 1,2-β-Oligoglucan phosphorylase from Listeria innocua
  Nakajima, PloS one 2014
  • “...cluster is formed around the lin1839 gene. A putative ATP-binding protein ABC-type transporter gene ( lin1841 lin1843 ) may be involved in intake of Sop n s and/or 1,2--glucan. A putative GH3 -glucosidase gene ( lin1840 ) is thought to degrade the substrates with concerted action...”

5ysdB / Q92AS8 Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
26% identity, 64% coverage

• Ligands: alpha-d-glucopyranose; beta-d-glucopyranose (5ysdB)

SSA_1298 Maltose/maltodextrin ABC transporter, sugar-binding protein MalX, putative from Streptococcus sanguinis SK36
28% identity, 66% coverage

• Glucose Phosphotransferase System Modulates Pyruvate Metabolism, Bacterial Fitness, and Microbial Ecology in Oral Streptococci
  Zeng, Journal of bacteriology 2023 (secret)
• Pooled protein immunization for identification of cell surface antigens in Streptococcus sanguinis
  Ge, PloS one 2010
  • “...+ Zn-porter lipoprotein 8 SSA_1038 + Lipoprotein 9 SSA_0375 + D-methionine-binding lipoprotein (ABC-type transporter) 10 SSA_1298 + Maltose/maltodextrin ABC transporter, sugar-binding protein 11 SSA_2165 + + ABC-type oligopeptide transporter, periplasmic component 12 SSA_1066 + + ABC-type oligopeptide transport system 13 SSA_1948 + + Oligopeptide-binding lipoprotein precursor...”
• Contribution of lipoproteins and lipoprotein processing to endocarditis virulence in Streptococcus sanguinis
  Das, Journal of bacteriology 2009
  • “...SSA_1129 SSA_1198 SSA_1277 SSA_1298 MKIQKITFMALTALLTLSLGAC MNLKKTLKYFSLAAVSVLAIGALVAC MKKIFVIFLTIITLSSAMFLGGC MKKKIFAGAVTLLSVAVLAAC MNVKKIAMLVALIGISGFFLAAC...”

LMOf2365_1754 ABC transporter, substrate-binding protein from Listeria monocytogenes str. 4b F2365
26% identity, 64% coverage

• Catabolite control protein C contributes to virulence and hydrogen peroxide-induced oxidative stress responses in <i>Listeria monocytogenes</i>
  Ogunleye, Frontiers in microbiology 2024
  • “...LMOf2365_0772 YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein 2.3 4.2E-03 LMOf2365_1214 Cobalt transport protein 2.8 2.2E-02 LMOf2365_1754 Putative binding protein (Bacterial extracellular solute-binding protein) 1.6 1.6E-02 LMOf2365_1756 L-arabinose transport system permease protein 1.6 1.3E-02 LMOf2365_2032 Probable ABC transporter permease protein 2.7 3.7E-03 LMOf2365_2157 Maltodextrin transport system permease...”

3jzjA / B0B0V1 Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 70% coverage

• Ligands: alpha-d-glucopyranose; 4,6-dideoxy-4-{[(1s,4r,5s,6s)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-d-glucopyranose (3jzjA)

TC 3.A.1.1.27 / Q8DT28 MalX, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) from Streptococcus mutans (see paper)
SMU_1568 extracellular solute-binding protein from Streptococcus mutans UA159
29% identity, 65% coverage

• substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
• Cnm of Streptococcus mutans is important for cell surface structure and membrane permeability
  Naka, Frontiers in cellular and infection microbiology 2022
  • “...SMU_2149c Cobalt transporter ATP-binding subunit 1029326 SMU_2149c 3.115 malX Maltose ABC transporter substrate-binding protein 1028671 SMU_1568 2.836 SMU_100 PTS system sorbose transporter subunit IIB 1029681 SMU_100 2.743 SMU_1178c Amino acid ABC transporter ATP-binding protein 1028485 SMU_1178c 2.646 SMU_2150c Cobalt transporter ATP-binding subunit 1029324 SMU_2150c 2.609 SMU_1938c...”
• Remodeling of the Streptococcus mutans proteome in response to LrgAB and external stresses
  Ahn, Scientific reports 2017
  • “...and physiological changes (Supplemental Table S4 ). Multiple ABC transporters, including OpuBa, SMU_922, SMU_1194, and SMU_1568 also showed significantly ( p <0.05) increased abundance. Major functional categories that were uniquely upregulated in response to heat stress included energy metabolism and PTSs, whereas DNA metabolism and protein...”
• RNA-Seq Reveals Enhanced Sugar Metabolism in Streptococcus mutans Co-cultured with Candida albicans within Mixed-Species Biofilms
  He, Frontiers in microbiology 2017
  • “...both malG (SMU_1570) and malF (SMU_1569) encoding maltose/maltodextrin ABC transport permease, as well as malX (SMU_1568) encoding maltose/maltodextrin-binding protein were up-regulated in the presence of C. albicans (Supplementary Table S1 ). FIGURE 4 KEGG galactose metabolism pathway map (smu:00052) for S. mutans UA159. S. mutans genes...”
• Hyperosmotic response of streptococcus mutans: from microscopic physiology to transcriptomic profile
  Liu, BMC microbiology 2013
  • “...2.0849 0.083 SMU_930c GeneID:1028282 Putative transcriptional regulator 2.2036 0.101 SMU_1403c GeneID:1029503 Hypothetical protein 2.1238 0.1002 SMU_1568 GeneID:1028671 Putative maltose/maltodextrin ABC transporter 2.0175 0.0932 SMU_292 GeneID:1027867 Putative transcriptional regulator 2.0309 0.0987 SMU_1704 GeneID:1028933 Hypothetical protein 2.0003 0.0999 SMU_1286c GeneID:1029427 Putative permease; multidrug efflux protein 0.321 0.025 SMU_669c...”

SCO0538 probable sugar transporter sugar binding lipoprotein from Streptomyces coelicolor A3(2)
23% identity, 69% coverage

• Comparative genomics of Streptomyces avermitilis, Streptomyces cattleya, Streptomyces maritimus and Kitasatospora aureofaciens using a Streptomyces coelicolor microarray system
  Hsiao, Antonie van Leeuwenhoek 2008
  • “...SCO0895 RNA polymerase principal sigma factor HrdC SCO0536 hypothetical protein SCO0900 putative transmembrane efflux protein SCO0538 probable sugar transporter sugar binding lipoprotein SCO0905 putative membrane protein SCO0544 hypothetical secreted protein SCO0907 putative dehydrogenase SCO0546 pyruvate carboxylase SCO0925 putative lysR-family transcriptional regulator SCO0551 putative histidine kinase protein...”

SACE_1666 sugar ABC transporter substrate-binding protein from Saccharopolyspora erythraea NRRL 2338
25% identity, 54% coverage

• Nitrogen regulator GlnR controls uptake and utilization of non-phosphotransferase-system carbon sources in actinomycetes
  Liao, Proceedings of the National Academy of Sciences of the United States of America 2015
  • “...of the gene encoding the maltose-binding protein (SACE_1666) showed 27-42% sequence similarity to homologs from other actinomycetes. Quantitative real-time...”

D9QER5 Extracellular solute-binding protein from Corynebacterium pseudotuberculosis (strain C231)
Cp1002_0497, CpC231_0501 ABC transporter substrate-binding protein from Corynebacterium pseudotuberculosis C231
28% identity, 60% coverage

• Changes in protein abundance are observed in bacterial isolates from a natural host
  Rees, Frontiers in cellular and infection microbiology 2015
  • “...Energy production and conversion D9QEQ2 rbsR CpC231_0488 Ribose operon repressor 0.751 * 0.892 1.014 Transcription D9QER5 malE CpC231_0501 Maltose/maltodextrin transport system substrate-binding protein 0.901 * 1.401 * 0.334 Carbohydrate transport and metabolism D9QEV8 uvrD CpC231_0544 DNA helicase 1.812 * 0.666 Replication and repair D9Q9A8 amtR CpC231_0651...”
• Changes in protein abundance are observed in bacterial isolates from a natural host
  Rees, Frontiers in cellular and infection microbiology 2015
  • “...and conversion D9QEQ2 rbsR CpC231_0488 Ribose operon repressor 0.751 * 0.892 1.014 Transcription D9QER5 malE CpC231_0501 Maltose/maltodextrin transport system substrate-binding protein 0.901 * 1.401 * 0.334 Carbohydrate transport and metabolism D9QEV8 uvrD CpC231_0544 DNA helicase 1.812 * 0.666 Replication and repair D9Q9A8 amtR CpC231_0651 TetR family...”
• The Corynebacterium pseudotuberculosis in silico predicted pan-exoproteome
  Santos, BMC genomics 2012
  • “...Hypothetical protein PSE N CP001809 ADL20288 Cp1002_0388 L,D-transpeptidase catalytic domain, region YkuD SEC CP001809 ADL20391 Cp1002_0497 malE Maltose/maltodextrin transport system substrate-binding protein PSE E CP001809 ADL20455 Cp1002_0562 sprT Trypsin PSE C CP001809 ADL20477 Cp1002_0584 cynT Carbonic anhydrase PSE E CP001809 ADL20508 Cp1002_0615 Hypothetical protein SEC CP001809...”

MAP1769c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
24% identity, 50% coverage

• Genomic variations associated with attenuation in Mycobacterium avium subsp. paratuberculosis vaccine strains
  Bull, BMC microbiology 2013
  • “...like esterase Fatty acid Metabolism MAP1766c Cellobiose ABC transporter MAP1767c ABC transporter MAP1768c ABC transporter MAP1769c Transcriptional regulator MAP1770c Sigma-70 factor MAP1771c IS 900 MAP1772 Unknown MAP1773c Nuclear transport factor 2 Steroid metabolism MAP1774c pncA Isochorismatase Nicotinamide metabolism MAP1775 doxX Unknown MAP1776c Nucleotide phosphokinase-like MAP1777c Unknown...”

C6B9N9 Extracellular solute-binding protein family 1 from Rhizobium leguminosarum bv. trifolii (strain WSM1325)
25% identity, 73% coverage

• Physiological changes in rhizobia after growth in peat extract may be related to improved desiccation tolerance
  Casteriano, Applied and environmental microbiology 2013 (secret)

5ci5A / A8F7X5 Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
26% identity, 72% coverage

• Ligand: alpha-d-tagatopyranose (5ci5A)

Tlet_1705 extracellular solute-binding protein family 1 from Thermotoga lettingae TMO
26% identity, 72% coverage

• Molecular analysis of cyclic α-maltosyl-(1→6)-maltose binding protein in the bacterial metabolic pathway
  Kohno, PloS one 2020
  • “...374 21 GlyBP Thermus thermophilus -glucosides [ 27 ] 5CI5 (B) 41.0 3.8 369 27 Tlet_1705 Thermotoga lettingae - D -Tagatose TBP 4QRZ (A) 41.0 3.6 367 25 ATU4361 Agrobacterium fabrum Maltooligosaccharides TBP 5YSB (A) 41.0 2.6 365 21 SO-BP Listeria innocua -1,2-glucooligosaccharide [ 28 ]...”
• The CebE/MsiK Transporter is a Doorway to the Cello-oligosaccharide-mediated Induction of Streptomyces scabies Pathogenicity
  Jourdan, Scientific reports 2016
  • “...template the crystal structure of the ABC transporter Solute Binding Protein from Thermotoga Lettingae TMO (Tlet_1705, TARGET EFI-510544) bound with alpha-D-Tagatose (5CI5). Because of the low sequence identity with the model (21.8%), the overall quality Z-score is only ranked as satisfactory (1.929). The position of Trp303...”

CMN_00224 ABC transporter substrate-binding protein from Clavibacter nebraskensis NCPPB 2581
27% identity, 42% coverage

• Secretome Analysis of Clavibacter nebraskensis Strains Treated with Natural Xylem Sap In Vitro Predicts Involvement of Glycosyl Hydrolases and Proteases in Bacterial Aggressiveness
  Soliman, Proteomes 2021
  • “...response CCE74134.1 Rhodanese domain-containing protein 10 CMN_00157 + Stress response CCE74199.1 Sugar ABC transporter 43 CMN_00224 + Cell surface CCE75732.1 Rhodanese domain-containing protein 12 CMN_01787 + Stress response AJW79484.1 Exodeoxyribonuclease VII small subunit 9 xseB + DNA catabolic AJW78093.1 General stress protein CsbD 6 DZF93_05670 +...”

SAMN04515608_2488 ABC transporter substrate-binding protein from Caldicellulosiruptor bescii
27% identity, 55% coverage

• Gene targets for engineering osmotolerance in Caldicellulosiruptor bescii
  Sander, Biotechnology for biofuels 2020
  • “...sequence (B5X54_RS01120). Two genes incurred mutations which introduced amino acid substitutions into their coding sequences (SAMN04515608_2488 and B5X54_RS08370), and another gene exhibited a SNP which resulted in a silent mutation (B5X54_RS07295). One large region of gene loss found in the ORCB002 strain (B5X54_RS07480B5X54_RS07510) are genes affiliated...”
  • “...Frameshift B5X54_RS07295 Protein of unknown function No Silent mutation B5X54_RS08370 Molecular chaperone DnaK No Substitution SAMN04515608_2488, no analogous locus tag Carbohydrate ABC transporter substrate-binding protein, CUT1 family WP_105908637.1, WP_099716409.1 2 Adjacent substitutions Homologs were determined as>90% amino acid identity while utilizing>90% locus tag amino acid sequence...”

SAN_1556 maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Streptococcus agalactiae COH1
27% identity, 64% coverage

• Surface protein distribution in Group B Streptococcus isolates from South Africa and identifying vaccine targets through in silico analysis
  Gent, Scientific reports 2024
  • “...(600) SAN_1449 94.2 (1180) 89.1 (578) 99.8 (602) SAN_1519 53.1 (665) 53.8 (349) 52.4 (316) SAN_1556 98.3 (1231) 96.8 (628) 100 (603) SAN_1568 96.6 (1209) 93.5 (607) 99.8 (602) SAN_1577 99.6 (1247) 99.2 (644) 100 (603) SAN_1578 96.0 (1202) 92.9 (603) 99.3 (599) SAN_1597 99.5 (1246)...”

SAK_1475 carbohydrate uptake 1 (CUT1) family, carbohydrate-binding protein from Streptococcus agalactiae A909
SAG1441 maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein from Streptococcus agalactiae 2603V/R
gbs1510 Unknown from Streptococcus agalactiae NEM316
27% identity, 64% coverage

• The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
  Roux, Microbiology spectrum 2022
  • “...involved in carbon metabolism were downregulated by CcpA: SAK_0532-0539 , SAK_0166 - SAK_0171 , and SAK_1475 - SAK_1477 coding the transporters of N -acetylglucosamine, ribose, and cyclodextrin, respectively, for which a cre site was present. Several genes involved in glycolysis and gluconeogenesis were regulated by CcpA,...”
• Transcriptomic Analysis of Streptococcus pyogenes Colonizing the Vaginal Mucosa Identifies hupY, an MtsR-Regulated Adhesin Involved in Heme Utilization
  Cook, mBio 2019
  • “...- 0836 and sak_1908 to - 1910 ), maltose ( spy49_1028 to - 1030 and sak_1475 to - 1477 ), and galactose and fructose ( spy49_1327c to - 1329c and sak_1893 to - 1895 ). Genes and operons involved in degradation of sugars such as ascorbate...”
• Adaptive response of neonatal sepsis-derived Group B Streptococcus to bilirubin
  Hansen, Scientific reports 2018
  • “...SAG0795 Hypothetical protein 2.83 2.73E-04 4.02E-02 SAG1925 Sugar ABC transporter ATP-binding protein 2.02 3.37E-04 4.60E-02 SAG1441 Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 2.19 4.69E-04 5.91E-02 SAG1690 PTS system transporter subunit IIABC 2.01 5.22E-04 5.91E-02 SAG2072 Uridine phosphorylase 1.70 5.26E-04 5.91E-02 SAG0331 Formate acetyltransferase 1.65 8.21E-04 8.43E-02 SAG2014...”
• Adaptive response of Group B streptococcus to high glucose conditions: new insights on the CovRS regulation network
  Di, PloS one 2013
  • “...genes involved in the transport of complex carbohydrates were down-regulated, including: the region spanning from sag1441 to sag1443 ORFs, encoding for the maltose-maltodextrin transport system ( malE-F-G) ; sag0955 and sag1925 ( msmK ) genes, encoding a sugar-ABC transporter and a sugar transport ATP-binding protein, respectively;...”
• Transcriptional and proteomic profiles of group B Streptococcus type V reveal potential adherence proteins associated with high-level invasion
  Johri, Infection and immunity 2007
  • “...SAG0290 SAG1108 SAG1257 SAG1262 SAG1359 SAG0514 SAG1007 SAG1441 SAG1466 SAG1610 SAG1796 Unknown function SAG0019 SAG0306 SAG0886 SAG1186 SAG1350 SAG1126 SAG1381...”
• Transcriptome adaptation of group B Streptococcus to growth in human amniotic fluid
  Sitkiewicz, PloS one 2009
  • “...Galactose-6-phosphate isomerase lacA subunit gbs1507 glgP 2.4 5.1 Maltodextrin phosphorylase gbs1508 malM 2.9 5.9 4-alpha-glucanotransferase gbs1510 malE 3.8 Maltose maltodextrin-binding protein gbs1511 malF 4.6 Maltodextrin transport system permease protein malC gbs1512 malG 3.5 Maltose transport system permease protein malG gbs1692 2.7 Dihydroxyacetone kinase gbs1694 2.5 5.1...”

cg0834 extracellular solute-binding protein, fa from Corynebacterium glutamicum ATCC 13032
27% identity, 55% coverage

• Functional Genomics Uncovers Pleiotropic Role of Rhomboids in Corynebacterium glutamicum
  Luenenschloss, Frontiers in microbiology 2022
  • “...Components of an ABC-type maltose uptake system (Cg2704, Cg2705) and ABC-type trehalose uptake system (Cg0832, Cg0834) were less abundant in the CF as well as MF at 30 and/or 40C. Since 4-alpha-D-((1- > 4)-alpha-D-glucano)trehalose trehalohydrolase (Cg2333) was present at much higher amounts in the MF at...”
• Elastase digests: new ammunition for shotgun membrane proteomics
  Rietschel, Molecular & cellular proteomics : MCP 2009
  • “...35 36 37 38 39 15 14 14 2 13 9 1 4 14 7 Cg3186 Cg1314 Cg0834 Cg0957 Cg1081 40 41 42 13 13 12 5 4 10 Cg1556 Cg1362 Cg0924 43 44 45 46 47 48 12 12 12 1 0 11 9 1 1...”
• Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
  Follmann, BMC genomics 2009
  • “...permease components 5 -1.33 -0.40 - - - -0.4 - - - 1.0 1.1 37 cg0834 ABC-type transporter, periplasmic component 0 -2.46 -0.03 1.6 3.4 2.7 2.5 3.6 3.7 2.9 4.2 4.1 LexA 38 cg0842 Putative DNA helicase 0 -1.03 n.d. - - - - -...”
• Global gene expression during stringent response in Corynebacterium glutamicum in presence and absence of the rel gene encoding (p)ppGpp synthase
  Brockmann-Gretza, BMC genomics 2006
  • “...cg0414 1.66 wzz cell surface polysaccharide biosynthesis protein D cg0552 1.60 menD 2-oxoglutarate decarboxylase H cg0834 1.58 Bacterial extracellular solute-binding protein G cg0924 3.24 ABC-type cobalamin/Fe3+-siderophores transport system P cg0926 1.87 ABC-type cobalamin/Fe3+-siderophores transport system P cg0928 1.64 ABC-type cobalamin/Fe3+-siderophores transport system P cg1873 1.69 tesB2...”

alr4277 sugar ABC transporter sugar binding protein from Nostoc sp. PCC 7120
24% identity, 65% coverage

• Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
  Stebegg, Journal of bacteriology 2012
  • “...all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and alr5368) are currently annotated as components of...”

Bbr_1554 ABC transporter substrate-binding protein from Bifidobacterium breve UCC2003
25% identity, 51% coverage

• Selective human milk oligosaccharide utilization by members of the <i>Bifidobacterium pseudocatenulatum</i> taxon
  Sanchez-Gallardo, Applied and environmental microbiology 2024
  • “...regulator, LacI family lacI Bbr_1553 MM0196_1810 47.65 Solute-binding protein of ABC transporter system (lactose) nahS Bbr_1554 MM0196_1519 38.80 NagC/XylR-type transciptional regulator nahR Bbr_1555 MM0196_1731 46.65 GH20 nagZ Beta-N-acetylhexosaminidase nahA Bbr_1556 MM0196_1726 60.75 Phosphotransferase family protein nahK Bbr_1586 MM0196_1440 22.55 GH112 lacto-N-biose phorylase lnbP Bbr_1587 MM0196_0465 27.12...”
• Primary succession of Bifidobacteria drives pathogen resistance in neonatal microbiota assembly
  Shao, Nature microbiology 2024
  • “...and/or FL2_Blon2202-2204), lactose (GH2, LacS), fucose (FumC/D/E/F/G, FucP), LNT (GH42 or GH136, GltABC), LNnT (GH20, Bbr_1554) and LNB (GH112, GltABC). In silico screening of AMR and virulence factor genes was performed at the species level with species MAGs and at the sample level with raw metagenome...”
• Varied Pathways of Infant Gut-Associated Bifidobacterium to Assimilate Human Milk Oligosaccharides: Prevalence of the Gene Set and Its Correlation with Bifidobacteria-Rich Microbiota Formation
  Sakanaka, Nutrients 2019
  • “...B. infantis ATCC 15697 T CP001095.1 [ 40 ] 13 LN n T transporter SBP Bbr_1554 NahS B. breve UCC2003 CP000303.1 [ 48 ] Intracellular enzymes 14 1,2-- l -Fucosidase Blon_2335 AfcA B. infantis ATCC 15697 T CP001095.1 [ 49 ] 15 1,3/4-- l -Fucosidase Blon_2336...”
• Bifidobacterium breve UCC2003 Employs Multiple Transcriptional Regulators To Control Metabolism of Particular Human Milk Oligosaccharides
  James, Applied and environmental microbiology 2018
  • “...tags Bbr_0526 to Bbr_0530) and the nah locus (locus tags Bbr_1554 to Bbr_1560) (Table 1 and Fig. 1). The lnt locus encodes proteins that are responsible for the...”
  • “...Bbr_1247 Bbr_1248 Bbr_1249 Bbr_1250 Bbr_1251 Bbr_1252 Bbr_1554 Bbr_1555 Bbr_1556 Bbr_1558 Bbr_1559 Bbr_1560 Bbr_1585 Bbr_1586 Bbr_1587 Bbr_1588 Bbr_1589...”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...putative -N-acetylhexosaminidase (GH20). Upstream of nahR is a gene encoding a putative solute binding protein (Bbr_1554 and designated here as nahS ), while located downstream of nahA are Bbr_1558 ( nahP1 ), Bbr_1559 ( nahP2 ) and Bbr_1560 ( nahT ), which are predicted to specify...”
  • “...(465bp, representing codon numbers 61 through to 216 of the 420 codons of this gene), Bbr_1554 (designated here as nahS ) (488bp, representing codon numbers 92 through to 255 of the 442 codons of this gene), and Bbr_1556 (designated here as nahA ) (443bp, representing codon...”

lmo0768 similar to sugar ABC transporter, periplasmic sugar-binding protein from Listeria monocytogenes EGD-e
25% identity, 58% coverage

• Listeria monocytogenes differential transcriptome analysis reveals temperature-dependent Agr regulation and suggests overlaps with other regulons
  Garmyn, PloS one 2012
  • “..., lmo1901 , lmo2000 , bvrB ) [35] and putative sugar ABC transporters (for example lmo0768 , lmo0767 and lmo0766 ) had higher transcript levels in DG125A compared to EGD-e. Two genes with higher transcript level ( lmo1884 and pyrP ) encode permeases for xanthine and...”
• Listeria monocytogenes surface proteins: from genome predictions to function
  Bierne, Microbiology and molecular biology reviews : MMBR 2007
  • “...TSc Lmo0135 Lmo0152 Lmo0153 Lmo0181 Lmo0285 Lmo0541 Lmo0768 Lmo0859 Lmo1016 Lmo1041 Lmo1073 Lmo1388 Lmo1426 Lmo1671 Lmo1730 Lmo1738 Lmo1847 Lmo1959 Lmo2007...”

Atu4361 ABC transporter, substrate binding protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
25% identity, 48% coverage

• Molecular analysis of cyclic α-maltosyl-(1→6)-maltose binding protein in the bacterial metabolic pathway
  Kohno, PloS one 2020
  • “...20 UgpB Escherichia coli sn -Glycerol-3-phosphate [ 26 ] 4RJZ (A) 41.3 2.6 365 25 ATU4361 Agrobacterium fabrum Maltooligosaccharides TBP 6JAL (A) 41.1 2.5 374 21 GlyBP Thermus thermophilus -glucosides [ 27 ] 5CI5 (B) 41.0 3.8 369 27 Tlet_1705 Thermotoga lettingae - D -Tagatose TBP...”

MSMEG_0515 probable sugar transporter sugar binding lipoprotein from Mycobacterium smegmatis str. MC2 155
24% identity, 46% coverage

• Crystallization and preliminary crystallographic analysis of the putative sugar-binding protein Msmeg_0515 (AgaE) from Mycobacterium smegmatis
  Almourfi, Acta crystallographica. Section F, Structural biology communications 2015
  • “...putative sugar-binding protein Msmeg_0515 (AgaE) from Mycobacterium smegmatis Feras M. Almourfi, H. Fiona Rodgers, Svetlana E. Sedelnikova and Patrick J. Baker*...”
  • “...November 2014 Accepted 1 January 2015 Keywords: Msmeg_0515; AgaE; Mycobacterium smegmatis. Department of Molecular Biology and Biotechnology, University of...”
• A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
  McKenzie, Journal of bacteriology 2012
  • “...that of VapBC. With the exception of MSMEG_4182 and MSMEG_0515, the values of gene expression from qRT-PCR were statistically significant (, P value 0.05; , P...”
• A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
  Titgemeyer, Journal of bacteriology 2007
  • “...SugE BxlE SmoE XylE2 RbsB5 msmeg_0505 msmeg_0515 msmeg_0553 msmeg_1374 msmeg_1704 msmeg_1712 msmeg_3095 msmeg_3111 msmeg_3266 msmeg_3599 msmeg_3999 msmeg_4172...”

SYNW1282 ABC transporter, likely sugar solute binding protein from Synechococcus sp. WH 8102
24% identity, 60% coverage

• Computational prediction of the osmoregulation network in Synechococcus sp. WH8102
  Mao, BMC genomics 2010
  • “...(SYNW1916-1918), and KtrBA (SYNW2168-2169) already in our initial network are identified again. SYNW0689, SYNW0746, SYNW0853, SYNW1282, SYNW1526-1527, and SYNW1530-1531 are added since they have very similar phylogenetic profiles with those of GgtCDA (SYNW1283-1285). We believe that they may be candidates for GgtB (b0529) of E. coli...”
• Operon prediction by comparative genomics: an application to the Synechococcus sp. WH8102 genome
  Chen, Nucleic acids research 2004
  • “...1113, 1114) (SYNW1167, 1168); (SYNW1170, 1171) Exactly found (SYNW1282, 1283, 1284, 1285) Exactly found Not found Not found (SYNW1857, 1858, 1859, 1860) Exactly...”

4qrzA / A9CGI0 Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
26% identity, 43% coverage

• Ligands: beta-d-glucopyranose; alpha-d-glucopyranose (4qrzA)

LBA1866 maltose ABC transporter permease protein from Lactobacillus acidophilus NCFM
24% identity, 66% coverage

• Isolation and characterization of Lactobacillus-derived membrane vesicles
  Dean, Scientific reports 2019
  • “...X SlpX Q5FLN0_LACAC LBA0512 54kDa 28.92 115.67 4.00 0.01 Maltose ABC transporter permease protein Q5FI08_LACAC LBA1866 44kDa 27.33 8.20 0.30 0.37 L. casei putative family 15 glucoamylase S6CK93_LACCA 101kDa 431.11 129.33 0.30 0.04 putative major head protein S6C5N2_LACCA 42kDa 420.00 126.00 0.30 0.01 putative cell wall-associated...”
• Enzymology and structure of the GH13_31 glucan 1,6-α-glucosidase that confers isomaltooligosaccharide utilization in the probiotic Lactobacillus acidophilus NCFM
  Møller, Journal of bacteriology 2012
  • “...the maltooligosaccharide transport and catabolism gene cluster (LBA1866, LBA1867, and LBA1872) (34), and L. acidophilus NCFM 16S rRNA (LBA2071) transcripts,...”
  • “...glucose (Fig. 3). Similarly, LBA1872 and the permease (LBA1866) as well as the solute binding protein (LBA1867) components of the ATP-binding cassette (ABC)...”

7qhvAAA / A9CEY9 7qhvAAA (see paper)
26% identity, 64% coverage

• Ligand: [(2~{s},3~{s},4~{s},5~{r},6~{s})-6-[(2~{s})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid (7qhvAAA)

CMM_0359 putative sugar ABC transporter, substrate-binding protein from Clavibacter michiganensis subsp. michiganensis NCPPB 382
26% identity, 44% coverage

• A Proteomic Study of Clavibacter Michiganensis Subsp. Michiganensis Culture Supernatants
  Hiery, Proteomes 2015
  • “...protein +/+ CMM_0296 putative sugar ABC transporter substrate-binding protein +/+ CMM_0345 conserved secreted/exported protein +/+ CMM_0359 putative sugar ABC transporter substrate-binding protein +/+ CMM_0363 putative iron-siderophore ABC transporter substrate-binding protein +/+ CMM_0423 putative sugar ABC transporter substrate-binding protein +/+ CMM_0430 putative cell surface protein +/+ CMM_0431...”

CTN_0780 Extracellular solute-binding protein, family 1 precursor from Thermotoga neapolitana DSM 4359
30% identity, 41% coverage

• Hyperthermophilic Thermotoga species differ with respect to specific carbohydrate transporters and glycoside hydrolases
  Frock, Applied and environmental microbiology 2012
  • “...CTN_0664 CTN_1767 CTN_1367 CTN_0765 CTN_1348 CTN_1502-3 CTN_0780 CTN_0638 CTN_0622 CTN_0576 CTN_0378-9 CTN_1337 CTN_0067 CTN_1375 CTN_0777 CTN_0790 CTN_0252...”
  • “...TRQ2_0973 and TRQ2_0970 are homologous to CTN_0777 and CTN_0780, respectively). TM0031 was shown to bind cellobiose and laminaribiose (33), and TM1839 was shown...”

TEL01S_RS00175 sugar ABC transporter substrate-binding protein from Pseudothermotoga elfii DSM 9442 = NBRC 107921
23% identity, 50% coverage

• Adaptation Strategies to High Hydrostatic Pressures in Pseudothermotoga species Revealed by Transcriptional Analyses
  Fenouil, Microorganisms 2023
  • “...20 MPa ( Figure 1 ). Among the over-expressed genes, 14 (locus tags TEL01S_RS00165 to TEL01S_RS00175, TEL01S_RS00525 to TEL01S_RS00535, and TEL01S_RS08670 to TEL01S_RS08705) encode proteins of sugar transport and metabolism, while two genes (locus tags TEL01S_RS06345 and TEL01S_RS06350) encode an ABC-2 type transporter system. Furthermore, five...”

MSMEG_5145 extracellular solute-binding protein, family protein 1 from Mycobacterium smegmatis str. MC2 155
24% identity, 50% coverage

• A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
  Titgemeyer, Journal of bacteriology 2007
  • “...msmeg_3599 msmeg_3999 msmeg_4172 msmeg_4658 msmeg_5061 msmeg_5145 msmeg_5574 msmeg_6020 msmeg_6804 N-terminal sequence (no. of residues) *...”

6dtqA / G4FGN8 Maltose bound t. Maritima male3 (see paper)
27% identity, 56% coverage

• Ligands: alpha-d-glucopyranose; magnesium ion (6dtqA)

TC 3.A.1.1.41 / G4FGN8 Extracellular solute-binding protein family 1, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Tmari_1861 ABC transporter substrate-binding protein from Thermotoga maritima MSB8
27% identity, 56% coverage

• substrates: Trehalose
• Adaptive Evolution of Thermotoga maritima Reveals Plasticity of the ABC Transporter Network
  Latif, Applied and environmental microbiology 2015
  • “...genome for the genes spanning Tmari_1847 and Tmari_1861 to illustrate the gene duplication-amplification event observed in eTMglc1. The inset magnifies the...”
• Transcriptional regulation of the carbohydrate utilization network in Thermotoga maritima
  Rodionov, Frontiers in microbiology 2013
  • “...measured for four genes from the ATCC-derived strain of T. maritima MSB8: cbpA (Tmari_1862), treE (Tmari_1861), gluE (Tmari_1858) , and gluR (Tmari_1855) (Genbank Accession CP004077). Genomic RNA was isolated from cells grown on minimal medium supplied with either trehalose, D-glucose, or D-ribose and collected at the...”

HMPREF0421_20232 ABC transporter substrate-binding protein from Gardnerella vaginalis ATCC 14019
E3D881 ABC transporter, solute-binding protein from Gardnerella vaginalis (strain ATCC 14019 / 317)
25% identity, 69% coverage

• Phase variable colony variants are conserved across Gardnerella spp. and exhibit different virulence-associated phenotypes
  Garcia, mSphere 2024
  • “...wall synthesis (HMPREF0421_20394), DNA recombination and segregation (RecA, FtsK, HMPREF0421_20072), ABC (ATP-binding cassette) transport (HMPREF0421_20105, HMPREF0421_20232, HMPREF0421_20436, HMPREF0421_20240), and RNA posttranscriptional modification (HMPREF0421_20849). In addition to the similarly expressed proteins presented in Tables S2 and S3 , each strain displayed unique differences in protein expression between...”
• Transcriptomic and Proteomic Analysis of Gardnerella vaginalis Responding to Acidic pH and Hydrogen Peroxide Stress
  Zhang, Microorganisms 2023
  • “...cell dormancy (HMPREF0421_21052) [ 31 ]. The maltose-binding protein was responsible for the maltodextrin absorption (HMPREF0421_20232), which provided raw materials for the biofilm synthesis. The sugar ABC transporters transported monosaccharides or oligosaccharides, providing oligosaccharides units for cell growth or biofilm formation (HMPREF0421_20098) [ 32 ]. Therefore,...”
  • “...protein HMPREF0421_20979 0.76 0.001612 TM2 domain-containing protein HMPREF0421_20098 0.78 0.001898 Sugar ABC transporter membrane protein HMPREF0421_20232 0.81 0.003311 Maltose-binding protein HMPREF0421_20422 0.81 0.025688 Exopolyphosphatase HMPREF0421_20575 0.82 0.000581 Phosphate acetyltransferase HMPREF0421_21052 0.83 0.022516 RelE-family TA system toxin...”
• pH Stress Mediated Alteration in Protein Composition and Reduction in Cytotoxic Potential of Gardnerella vaginalis Membrane Vesicles
  Shishpal, Frontiers in microbiology 2021
  • “...promotes the refolding Ribose-5-phosphate isomerase A E3D8S4 1 Pentose phosphate pathway ABC transporter, solute-binding protein E3D881 1 Import of essential nutrients and export of toxic materials Peptidyl-prolyl cis -trans isomerase E3D8Z5 1 Protein Folding Alpha-1,4 glucan phosphorylase E3D7S8 1 Important allosteric enzyme in carbohydrate metabolism Uncharacterized...”

CpC231_0380 extracellular solute-binding protein from Corynebacterium pseudotuberculosis C231
26% identity, 71% coverage

• The Corynebacterium pseudotuberculosis in silico predicted pan-exoproteome
  Santos, BMC genomics 2012
  • “...CpC231_0360 oppA1 Oligopeptide-binding protein oppA PSE E CP001829 ADL09871 CpC231_0379 Hypothetical protein SEC CP001829 ADL09872 CpC231_0380 malE Maltotriose-binding protein PSE E CP001829 ADL09990 CpC231_0503 lytR Transcriptional regulator lytR PSE C CP001829 ADL10248 CpC231_0766 Hypothetical protein SEC CP001829 ADL10460 CpC231_0982 ciuA Iron ABC transporter substrate-binding PSE E...”

SGO_1305 substrate-binding protein MsmE from Streptococcus gordonii str. Challis substr. CH1
26% identity, 46% coverage

• Mass Spectrometric Analysis of Whole Secretome and Amylase-precipitated Secretome Proteins from Streptococcus gordonii.
  Maddi, Journal of proteomics & bioinformatics 2014
  • “...Cell wall binding protein * SGO_0478 Glucan-binding domain 37 9 38 Substrate-binding protein msmE * SGO_1305 Sugar transport 49 9 35.9 Branched-chain amino acid ABC transporter * SGO_1630 Amino acid-binding protein 41 9 25.3 Conserved domain protein * SGO_0018 Transglycosylase-like domain 21 8 25.5 Elongation factor...”
• Effect of starch and amylase on the expression of amylase-binding protein A in Streptococcus gordonii
  Nikitkova, Molecular oral microbiology 2012
  • “...al. , 2008 ). One Msm transporter candidate in S. gordonii is annotated as: msmE SGO_1305, msmF SGO_1304, and msmG SGO_1303 with transcriptional regulator msmR SGO_1306; another Msm-like ABC transporter SGO_0120, SGO_0121, SGO_0122 with each gene having up to 54% amino acid identity with Msm proteins...”

smoF / A9CEY9 3-(6-sulfo-α-D-quinovosyl)-sn-glycerol binding protein from Agrobacterium fabrum (strain C58 / ATCC 33970) (see paper)
SMOF_AGRFC / A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
Atu3282 ABC transporter, substrate binding protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
26% identity, 64% coverage

• function: Part of the ABC transporter complex SmoEFGH involved in sulfoquinovosyl glycerol (SQGro) uptake (Probable). Binds sulfoquinovosyl glycerol (SQGro) (PubMed:35074914). Can also bind sulfoquinovose (SQ), methyl alpha-sulfoquinovoside (SQMe) and a short- chain derivative of sulfoquinovosyl diacylglycerol (SQDG) (PubMed:35341160). Cannot bind D-glucose and D-glucuronic acid (PubMed:35074914).
  subunit: The complex is probably composed of two ATP-binding proteins (SmoE), two transmembrane proteins (SmoG and SmoH) and a solute-binding protein (SmoF).
• Oxidative desulfurization pathway for complete catabolism of sulfoquinovose by bacteria
  Sharma, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...We proceeded to biochemically validate this hypothesis and gain structural insights into the proteins involved. Atu3282 (smoF) Encodes an ABC Transporter Solute-binding Protein that Binds SQGro. Within the gene cluster identified through proteomics, Atu3281 ( smoE ), Atu3283 ( smoG ), and Atu3284 ( smoH )...”
  • “...D-glucose and D-glucuronic acid. Fig. 2. Biochemical and structural analyses of the SQGro-binding protein SmoF (Atu3282) and SQase SmoI (Atu3285). ( A ) Isothermal titration calorimogram for SmoF titrated against its cognate ligand 2 R -SQGro. The data are representative of two independent experiments ( SI...”

SSO1171 Maltose ABC transporter from Sulfolobus solfataricus P2
24% identity, 61% coverage

• Membrane Association and Catabolite Repression of the Sulfolobus solfataricus α-Amylase
  Soo, Microorganisms 2015
  • “...promoter fusion strain PBL2058 was constructed using plasmid pBN1062. A fragment containing a fusion between SSO1171 and malAp was obtained by PCR of pBN1081 using primers 1171-BamHI-F and MalAp-1172-OLE-R. Plasmid pBN1081 contained a 572 bp fragment extending 107 nt upstream of SSO1171 through 465 nt of...”
  • “...wild type allele of amyA were obtained by PCR using primers MalAp-1172-OLE-F and 1172-BamH1-R. The SSO1171 :: malAp fusion to the amyA start codon was created by OLEPCR using amplicons encoding the SSO1171 :: malA p fusion and amyA with primers MalAp-1172-OLE-F and MalA-1172-OLE-R. The resulting...”
• The Sulfolobus initiator element is an important contributor to promoter strength
  Ao, Journal of bacteriology 2013
  • “...mutations in the Inr sequences of the Sso1171, Sso1934, and Sso3180 (where Sso indicates S. solfataricus) promoters significantly reduced their activities,...”
  • “...shown on the right, and the activities of yjr Sso1171, Sso1934, and Sso3180 promoters are defined as 100%, respectively. All experiments were carried out in...”
• Inducible and constitutive promoters for genetic systems in Sulfolobus acidocaldarius
  Berkner, Extremophiles : life under extreme conditions 2010
  • “...0.3 27 10 lacS c saci_1849 0.3 sso3019 0.1 7 0 c mbp/mal saci_1165 1.3 sso1171 13.0 42 14 gdhA saci_0155 18.3 sso1907 36 1 sso2044 8.9 38 1 sac7d saci_0064 sso10610 159 10 sso9535 136 7 a Expression determined by the group of Bernander by...”
• Archaeal homolog of bacterial type IV prepilin signal peptidases with broad substrate specificity
  Albers, Journal of bacteriology 2003
  • “...SSO2152 SSO2323 SSO2681 SSO2847 SSO0037 SSO2684 SSO0489 SSO0117 SSO1171 SSO2846 SSO3066 SSO2712 SSO3140 Signal sequence 3924 ALBERS ET AL. PibD seems to be...”

A4XMD5 Extracellular solute-binding protein, family 1 from Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Csac_2493 extracellular solute-binding protein, family 1 from Caldicellulosiruptor saccharolyticus DSM 8903
27% identity, 55% coverage

• Part I: characterization of the extracellular proteome of the extreme thermophile Caldicellulosiruptor saccharolyticus by GeLC-MS2
  Andrews, Analytical and bioanalytical chemistry 2010
  • “...precursor 7 40 58 55 63 A4XM93 S-layer domain protein precursor 3 6 17 8 A4XMD5 Extracellular solute-binding protein, family 1 precursor 1 28 29 62 A4XME8 D-xylose ABC transporter, periplasmic substrate-binding protein precursor 2 3 A4XMZ6 Ferritin, Dps family protein 10 129 739 618 737...”
  • “...Yes Yes 1 Yes A4XGN5 Extracellular solute-binding protein, family 1 precursor Yes Yes 1 Yes A4XMD5 Extracellular solute-binding protein, family 1 precursor Yes Yes 1 A4XJP0 Cell wall hydrolase autolysin precursor Yes Yes 1 Yes A4XG54 Periplasmic binding protein Lacl transcriptional regulator precursor Yes Yes 1...”
• Part II: defining and quantifying individual and co-cultured intracellular proteomes of two thermophilic microorganisms by GeLC-MS2 and spectral counting
  Andrews, Analytical and bioanalytical chemistry 2010
  • “...region A4XM72 Rubrerythrin A4XM87 S-layer domain protein precursor x A4XM93 S-layer domain protein precursor x A4XMD5 Extracellular solute-binding protein, family 1 presursor x A4XMZ6 Ferritin, Dps family protein Following the protein description x defines if the protein was predicted for secretion (PS) or containing a transmembrane...”
• Hydrogenomics of the extremely thermophilic bacterium Caldicellulosiruptor saccharolyticus
  van, Applied and environmental microbiology 2008
  • “...Csac_0784), a maltose ABC transport system (Csac_2491 to Csac_2493), and a second pullulanase (Csac_0671). Thus, C. saccharolyticus is well equipped for starch...”
  • “...and the maltose ABC transport system (Csac_2491 to Csac_2493). As observed for certain T. maritima maltose transporters, both sets of transport proteins lack...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.