PaperBLAST
PaperBLAST Hits for metacyc::MONOMER-11684 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (Bacillus subtilis (strain 168)) (327 a.a., MSVMSYIDAI...)
Show query sequence
>metacyc::MONOMER-11684 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (Bacillus subtilis (strain 168))
MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE
SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG
GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI
KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVY
PLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAM
PYAPTMEKYFMVNPDKVEAAMRELAEF
Running BLASTp...
Found 250 similar proteins in the literature:
bfmBAB / P37941 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) from Bacillus subtilis (strain 168) (see 2 papers)
P37941 2-oxoisovalerate dehydrogenase subunit beta from Bacillus subtilis (strain 168)
100% identity, 100% coverage
EP10_001412 alpha-ketoacid dehydrogenase subunit beta from Geobacillus icigianus
89% identity, 100% coverage
- The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
Peltek, International journal of molecular sciences 2024 - “...of which encodes enzymes for the catabolism of branched-chain amino acids (EP10_001408, EP10_001409, EP10_001411, and EP10_001412) [ 58 ], which is a system participating in maintenance of the energetic and metabolic state of the G. icigianus cell; in the irradiated cell, according to our previous proteomic...”
- “...0.055198 Butyrate kinase 2 EP10_001411 1.15153 0.054138 2-oxoisovalerate dehydrogenase. subunit alpha 2-oxoisovalerate dehydrogenase. subunit beta EP10_001412 1.04791 0.01829 EP10_001436 1.11329 0.045419 Cell division protein DivIC EP10_001437 1.12787 0.019737 Spore protein YabQ EP10_001438 1.33076 0.001686 Spore protein YabP EP10_001951 1.91752 0.000381 ATP-dependent Clp protease proteolytic subunit EP10_001975...”
BC4158 2-oxoisovalerate dehydrogenase beta subunit from Bacillus cereus ATCC 14579
Q818T4 2-oxoisovalerate dehydrogenase beta subunit from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
HD73_4463 3-methyl-2-oxobutanoate dehydrogenase subunit beta from Bacillus thuringiensis serovar kurstaki str. HD73
89% identity, 100% coverage
- Cysteine Proteome Reveals Response to Endogenous Oxidative Stress in Bacillus cereus
Hamitouche, International journal of molecular sciences 2021 - “...R BC4604 Malate dehydrogenase LMEPTFGGVNLEDIAAPNC 141 FIIEER 2.1 2.5 DLSLAYSPGVAEPC 45 KEIYDDKSK DIIMC 215 DR BC4158 2-oxoisovalerate dehydrogenase beta subunit SNNDWTC 111 PVTIR 1.1 1.1 Carbohydrate transport and metabolism BC4599 Pyruvate kinase (Pyk) IVC 8 TIGPASESIEKLEQLIEAGMNVAR 2.8 C 265 NVLGKPVITATQMLDSMQR BC5135 Enolase (Eno B) TGLTSAEMVDFYEELC 279...”
- Redox proteomic study of Bacillus cereus thiol proteome during fermentative anaerobic growth
Hamitouche, BMC genomics 2021 - “...Apt Adenine phosphoribosyltransferase NS NS Q81IQ3 464 PurL Phosphoribosylformylglycinamidine synthase subunit NS NS Carbohydrate metabolism Q818T4 111 2-oxoisovalerate dehydrogenase beta subunit NS NS Q81IA3 123 Formate acetyltransferase NS NS Cofactors and vitamins metabolism Q818X5 92 RibH 6,7-dimethyl-8-ribityllumazine synthase NS NS Q818R9 405 Dxs 1-deoxy-D-xylulose-5-phosphate synthase NS...”
- Identification of metabolism pathways directly regulated by sigma(54) factor in Bacillus thuringiensis
Peng, Frontiers in microbiology 2015 - “...HD73_4467 Leucine dehydrogenase - HD73_4466 Branched-chain-fatty-acid kinase 2.728 HD73_4465 Dihydrolipoamide dehydrogenase - HD73_4464 BfmBAa - HD73_4463 2-oxoisovalerate dehydrogenase subunit beta - HD73_4462 Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex - HD73_5327 NADPH dehydrogenase, quinone - HD73_5613 PTS system cellobiose-specific IIC component 0.460 HD73_5614 PTS...”
LMOf2365_1390 2-oxoisovalerate dehydrogenase E1 component, beta subunit from Listeria monocytogenes str. 4b F2365
82% identity, 100% coverage
LMRG_00823 2-oxoisovalerate dehydrogenase E1 component, beta subunit from Listeria monocytogenes 10403S
82% identity, 100% coverage
- Identification of Listeria monocytogenes determinants required for biofilm formation
Alonso, PloS one 2014 - “...purN lmrg_02505 1000.57 1 1 Isocitrate dehydrogenase lmrg_01401 1000.38 1 1 2-oxovalerate dehydrogenase component E1 lmrg_00823 980.35 3 2 Xanthine ribosyltransferase lmrg_01032 900.21 1 1 Aconitate hydratase lmrg_01325 920.12 1 1 Homoserine dehydrogenase lmrg_01700 840.35 1 1 Peptidoglycan N-acetylglucosamine deacetylase lmrg_00107 990.06 1 1 Adenylosuccinate synthetase...”
lmo1373 similar to branched-chain alpha-keto acid dehydrogenase E1 subunit (2-oxoisovalerate dehydrogenase beta subunit) from Listeria monocytogenes EGD-e
81% identity, 100% coverage
SA1347 branched-chain alpha-keto acid dehydrogenase E1 from Staphylococcus aureus subsp. aureus N315
67% identity, 100% coverage
HMPREF0769_12162 alpha-ketoacid dehydrogenase subunit beta from Staphylococcus aureus subsp. aureus MN8
67% identity, 100% coverage
- Protein CoAlation and antioxidant function of coenzyme A in prokaryotic cells
Tsuchiya, The Biochemical journal 2018 - “...229.02 ppaC Probable manganese-dependent inorganic pyrophosphatase 34.068 SPTC*TQQDVK 163.33 AYM28_13750 Nicotianamine synthase 31.096 SLQYITAQC*VK 120.21 HMPREF0769_12162 Transketolase, pyridine binding domain protein 36.033 SNNDWQC*PLTIR 110.57 nos Nitric oxide synthase oxygenase 41.71 EC*HYETQIINK 55.899 nos Nitric oxide synthase oxygenase 41.71 YAGYDNC*GDPAEKEVTR 147.84 SAKOR_00998 Hydroxymethylpyrimidine transport ATP-binding protein 53.302...”
SACOL1561 2-oxoisovalerate dehydrogenase, E1 component, beta subunit from Staphylococcus aureus subsp. aureus COL
SAOUHSC_01612 2-oxoisovalerate dehydrogenase, E1 component, beta subunit, putative from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_1465 2-oxoisovalerate dehydrogenase, E1 component, beta subunit from Staphylococcus aureus subsp. aureus USA300_FPR3757
CH51_RS08625, SKAG_00613 alpha-ketoacid dehydrogenase subunit beta from Staphylococcus aureus
67% identity, 100% coverage
- Proteome of Staphylococcus aureus Biofilm Changes Significantly with Aging
Rahman, International journal of molecular sciences 2022 - “..., trxB , glyoxalase, katA , dps , etc.), and in 12-day biofilm (such as SACOL1561 , qoxC , SA1692 , SA0758 , glyoxal reductase, etc.). We observed that oxidative stress-associated proteins were more downregulated in 3-day biofilm; this has also been shown by Graf et...”
- A defect in menadione biosynthesis induces global changes in gene expression in Staphylococcus aureus
Kohler, Journal of bacteriology 2008 - “...kinase; SACOL1555, peptidase, M20/M25/M40 family; SACOL1561, 2-oxoisovalerate dehydrogenase, E1 component beta subunit; SACOL1588, proline dipeptidase;...”
- A new platform for ultra-high density Staphylococcus aureus transposon libraries
Santiago, BMC genomics 2015 - “...enriched in five genes involved in branched chain amino acid degradation, ilvE (SAOUHSC_00536), SAOUHSC_01611, bkdA2 (SAOUHSC_01612), bkdA1 (SAOUHSC_01613), and SAOUHSC_01614 (SAOUHSC_01611, bkdA1, bkdA2, and ilvE meet significance cutoffs) (Additional file 1 : Figure S5). Branched chain fatty acids are built from branched chain acyl-CoA primers, which...”
- Identification of Methicillin-Resistant Staphylococcus aureus (MRSA) Genetic Factors Involved in Human Endothelial Cells Damage, an Important Phenotype Correlated with Persistent Endovascular Infection
Xiao, Antibiotics (Basel, Switzerland) 2022 - “...ABC transporter substrate-binding protein 6.85 a 4.61 SAUSA300_1876 hypothetical DNA polymerase IV 6.91 a 9.59 SAUSA300_1465 hypothetical 2-oxoisovalerate dehydrogenase, E1 component, beta subunit 7.15 a 6.73 SAUSA300_1573 hypothetical Holliday junction resolvase-like protein 10.10 a 6.88 SAUSA300_1473 nusB transcription antitermination protein NusB 10.84 a 10.00 SAUSA300_1357 aroC...”
- Growth and Stress Tolerance Comprise Independent Metabolic Strategies Critical for Staphylococcus aureus Infection
Kim, mBio 2021 - “...+ SAUSA300_1720 2915 * 7935 9110 + + + + 3,325 1926 136,500 96,586 * SAUSA300_1465 bfmBAB 4858 248179 994 + + + 450193 *** 185,000 89,283 ** SAUSA300_1573 9164 5917 9310 + + +/ 3,000 1,555 ** 180,000 90,185 *** SAUSA300_0489 ftsH 11468 7616 1011...”
- “...**** 43.775.70 **** 32.513.56 0.580.27 SAUSA300_1356 aroB 5.12 1.060.04 3.3 98.518.10 87.1533.93 25.833.60 * 0.480.14 SAUSA300_1465 bfmBAB 5 0.640.01 **** 3.35 125.6741.29 ** 221.6175.28 **** 53.1820.27 ** 0.770.15 ** SAUSA300_1683 aroA2 5.62 1.020.02 3.23 95.515.95 97.6643.35 38.219.71 0.70.26 SAUSA300_2065 mnaA 6.29 1.090.03 ** 3.21 127.7132.97 *...”
- Short and Robust Anti-Infective Lipopeptides Engineered Based on the Minimal Antimicrobial Peptide KR12 of Human LL-37
Lakshmaiah, ACS infectious diseases 2021 - “...FmtC protein 1.6 Yes SAUSA300_0829 lipA Lipoyl synthase 3.1 No SAUSA300_1036 RNA methyltransferase 1.6-3.1 Yes SAUSA300_1465 2-oxoisovalerate dehydrogenase, E1 component, beta subunit 3.1 No SAUSA300_0186 argC N-acetyl-gamma-glutamyl-phosphate reductase 3.1 No SAUSA300_0988 trkA Potassium uptake protein 1.6 Yes SAUSA300_1089 lspA lipoprotein signal peptidase 1.6 Yes SAUSA300_1515 ABC...”
- Resistome of Staphylococcus aureus in Response to Human Cathelicidin LL-37 and Its Engineered Antimicrobial Peptides
Golla, ACS infectious diseases 2020 - “...all the mutants were found to grow well in the TSB medium and only the SAUSA300_1465 ( Figure 2A ) and SAUSA300_1097 ( Figure 2C ) mutants showed slightly reduced growth. Considering the growth differences are small and TSB is an artificial condition, we did not...”
- “...correspondence, meaning the higher the biomass the more live cells in biofilms. The biomasses of SAUSA300_1465 and 1967 appeared to be composed of more non-cell substances than live cells. For mutants SAUSA300_0186, 0646, 0647, 0829, 0988, 1036, 1867, 1898, and 1962, however, the major contributor to...”
- Staphylococcus aureus SufT: an essential iron-sulphur cluster assembly factor in cells experiencing a high-demand for lipoic acid
Mashruwala, Molecular microbiology 2016 - “...NARSA ( Fey et al. , 2013 ) JMB7505 bckA :: TN ( ermR ) (SAUSA300_1465) NARSA ( Fey et al. , 2013 ) JMB7714 clpQ::TN(ermR) (SAUSA300_1147) NARSA ( Fey et al. , 2013 ) JMB7911 gcv :: TN ( ermR ) (SAUSA300_1496) NARSA ( Fey...”
- Anthraquinones as Potential Antibiofilm Agents Against Methicillin-Resistant Staphylococcus aureus
Song, Frontiers in microbiology 2021 - “...SKAG_01383 and SKAG_001385 ), and other genes ( lrgA , mhqA , hrtA , and SKAG_00613 ) were selected to conduct the qRT-PCR analysis ( Figure 11 and Supplementary Tables 1 , 2 ). The results showed that isdC , lrgA , SKAG_00613 , SKAG_01383 ,...”
- Staphylococcus aureus PhoU Homologs Regulate Persister Formation and Virulence
Shang, Frontiers in microbiology 2020 - “...ligase 2.31 ND CH51_RS14750 Acetyl-CoA synthetase 2.17 ND CH51_RS00775 Aldehyde dehydrogenase 2.02 ND Propanoate metabolism CH51_RS08625 Alpha-ketoacid dehydrogenase subunit beta 2.2 ND CH51_RS08620 2-Oxo acid dehydrogenase subunit E2 2.44 ND Glyoxylate and dicarboxylate metabolism CH51_RS08725 Aminomethyltransferase 2.97 ND CH51_RS03045 HAD family hydrolase 2.01 ND Purine metabolism...”
SERP1077 2-oxoisovalerate dehydrogenase, E1 component, beta subunit from Staphylococcus epidermidis RP62A
66% identity, 100% coverage
- PhoU2 but Not PhoU1 as an Important Regulator of Biofilm Formation and Tolerance to Multiple Stresses by Participating in Various Fundamental Metabolic Processes in Staphylococcus epidermidis
Wang, Journal of bacteriology 2017 - “...dehydrogenase, E3 component, dihydrolipoamide dehydrogenase 1.55 ND serp1076 NC_002976.3 (11208851122205) 2-Oxoisovalerate dehydrogenase E2 0.51 ND serp1077 NC_002976.3 (11222171124192) 2-Oxoisovalerate dehydrogenase E1 0.40 ND serp1078 NC_002976.3 (11222171124192) 2-Oxoisovalerate dehydrogenase E1 0.32 ND lpdA NC_002976.3 (11242061125628) 2-Oxoisovalerate dehydrogenase E3 0.34 ND serp2381 NC_002976.3 (24281082431126) NADH:flavin oxidoreductase/fumarate reductase, flavoprotein...”
- “...16 fumC Fumarate hydratase 17 mqo-1 , mqo-3 Malate:quinone oxidoreductase, malate:quinone oxidoreductase 18 serp1076 , serp1077 , serp1078 , lpdA 2-Oxoisovalerate dehydrogenase E2, 2-oxoisovalerate dehydrogenase E1, 2-oxoisovalerate dehydrogenase E1, 2-oxoisovalerate dehydrogenase E3 19 zwf-2 Glucose-6-phosphate 1-dehydrogenase 20 rpe Ribulose-phosphate 3-epimerase 21 deoB Phosphopentomutase 22 deoC Deoxyribose-phosphate...”
EF1659 branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit from Enterococcus faecalis V583
60% identity, 100% coverage
- Using a genome-scale metabolic model of Enterococcus faecalis V583 to assess amino acid uptake and its impact on central metabolism
Veith, Applied and environmental microbiology 2015 - “...via the alpha-keto acid dehydrogenase complex (bkdABCD; EF1660, EF1659, EF1658, and EF1661) (53, 54). Thereby, one ATP is formed per branched-chain amino acid...”
- Comparison of OG1RF and an isogenic fsrB deletion mutant by transcriptional analysis: the Fsr system of Enterococcus faecalis is more than the activator of gelatinase and serine protease
Bourgogne, Journal of bacteriology 2006 - “...adenosyltransferase pduv Valine, leucine, and isoleucine degradation EF1658 EF1659 EF1660 EF1661 EF1662 EF1663 bkdC bkdB bkdA bkdD buk ptb 5 6 3 3 2...”
- “...the genes of the operon and 8- to 11-fold for ef1659 to -1660 and ef1663 at EAR-stat). The repression of the eut-pdu operon, described above, should also lead...”
WOU_01483 alpha-ketoacid dehydrogenase subunit beta from Enterococcus faecalis ATCC 6055
R3KY17 Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit from Enterococcus faecalis ATCC 6055
61% identity, 100% coverage
GK3216 pyruvate dehydrogenase E1 (lipoamide) beta subunit from Geobacillus kaustophilus HTA426
52% identity, 100% coverage
PAE2646 pyruvate dehydrogenase E1 beta subunit from Pyrobaculum aerophilum str. IM2
55% identity, 92% coverage
BC_3972 pyruvate dehydrogenase complex E1 component subunit beta from Bacillus cereus ATCC 14579
BC3972 Pyruvate dehydrogenase E1 component beta subunit from Bacillus cereus ATCC 14579
50% identity, 98% coverage
A9VUD3 Transketolase central region from Bacillus mycoides (strain KBAB4)
49% identity, 98% coverage
BAS3882 pyruvate dehydrogenase complex E1 component, beta subunit from Bacillus anthracis str. Sterne
49% identity, 98% coverage
P21874 pyruvate dehydrogenase (acetyl-transferring) (EC 1.2.4.1) from Geobacillus stearothermophilus (see paper)
50% identity, 98% coverage
- Evaluating Functional Annotations of Enzymes Using the Gene Ontology.
Holliday, Methods in molecular biology (Clifton, N.J.) 2017 - “...interface between pyruvate dehydrogenase E1 component subunit alpha (UniProtKB identifier P21873) and beta (UniProtKB identifier P21874), both of which are required for activity. Thus, transfer of annotation relating to this function to an unknown (and hence evaluation of misannotation) needs to include both proteins. Similarly, a...”
- From sequence to enzyme mechanism using multi-label machine learning
De, BMC bioinformatics 2014 - “...transfer ). For example, protein ODPB_GEOSE of Geobacillus stearothermophilus (pyruvate dehydrogenase E1 component subunit beta, P21874) is part of the dataset and has MACiE mechanism M0106 (pyruvate dehydrogenase) and InterPro IPR005475, IPR005476, IPR009014 and IPR015941. Hence, if we use direct transfer of mechanism labels, another protein...”
3dufD / P21874 Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
50% identity, 98% coverage
- Ligand: 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-[(1r)-1-hydroxyethyl]-3-methyl-2-thienyl}ethyl trihydrogen diphosphate (3dufD)
AK89_08915 alpha-ketoacid dehydrogenase subunit beta from Enterococcus mundtii CRL35
47% identity, 100% coverage
- Differential Proteomic Analysis of Lactic Acid Bacteria-Escherichia coli O157:H7 Interaction and Its Contribution to Bioprotection Strategies in Meat
Orihuel, Frontiers in microbiology 2018 - “...dehydrogenase gi|602619124 1230 Ldh 35809 4.74 3.1 C 12 2-oxoisovalerate dehydrogenase subunit beta gi|602618668 1240 AK89_08915 35393 4.70 2.7 Transcription K 13 DNA-directed RNA polymerase subunit alpha gi|602618530 445 rpoA 35276 4.98 2.3 Cell division D 14 Cell division protein DivIVA gi|602618177 549 AK89_10945 26893 4.61...”
- “...synthase subunit alpha gi|63091861 106 atpA 56590 5.01 2.0 C 40 2-oxoisovalerate dehydrogenase gi|736683518 243 AK89_08915 35393 4.70 1.9 C 41 F0F1 ATP synthase subunit beta gi|736681478 84 atpD 51170 4.72 2.0 a Functional category according to COG database. One letter abbreviations for the COG functional...”
D4GY17 2-oxo-3-methylvalerate dehydrogenase E1 component beta subunit from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
47% identity, 99% coverage
ODBB_THET8 / Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
TTHA0230 2-oxoisovalerate dehydrogenase, E1 component beta subunit from Thermus thermophilus HB8
55% identity, 93% coverage
- function: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity).
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] + 3-methyl-2-oxobutanoate + H(+) = N(6)- [(R)-S(8)-2-methylpropanoyldihydrolipoyl]-L-lysyl- [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + CO2 (RHEA:13457)
cofactor: thiamine diphosphate
subunit: Heterotetramer of two alpha and two beta chains. Directly associated with ODBA in the E1 complex. - Lysine propionylation is a prevalent post-translational modification in Thermus thermophilus
Okanishi, Molecular & cellular proteomics : MCP 2014 - “...conversion TTHA0027 TTHA0089 TTHA0185 TTHA0206 TTHA0229 TTHA0230 TTHA0232 TTHA0233 TTHA0278 TTHA0287 TTHA0288 TTHA0466 TTHA0506 TTHA0520 TTHA0537 TTHA0538...”
Awo_c01710 alpha-ketoacid dehydrogenase subunit beta from Acetobacterium woodii DSM 1030
50% identity, 99% coverage
1umbD / Q5SLR3 Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
55% identity, 92% coverage
- Ligand: thiamine diphosphate (1umbD)
TTC1756 No description from Thermus thermophilus HB27
55% identity, 93% coverage
- Genome-scale metabolic network reconstruction and in silico flux analysis of the thermophilic bacterium Thermus thermophilus HB27
Lee, Microbial cell factories 2014 - “...No. of reactions Genes involved Major metabolic precursors Branched fatty acids 19 ilvE (TTC1870), vorA (TTC1756) and vorB (TTC1757), FabF (TTC0049 or TTC0045), FabG (TTC0047 or TTC0394), FabZ (TTC1463), FabI (TTC0343) Leucine, valine, isoleucine and acetyl-coA (i-15:0, ai-15:0, i-16:0, i-17:0, ai-17:1) Carotenoids 18 CrtE (TTC1986), CrtB...”
ODPB_BACSU / P21882 Pyruvate dehydrogenase E1 component subunit beta; S complex, 36 kDa subunit; EC 1.2.4.1 from Bacillus subtilis (strain 168) (see 2 papers)
pdhB / AAC24933.1 pyruvate decarboxylase E-1 beta subunit from Bacillus subtilis (see 3 papers)
BSU14590 pyruvate dehydrogenase (E1 beta subunit) from Bacillus subtilis subsp. subtilis str. 168
48% identity, 100% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)
function: The B.subtilis PDH complex possesses also branched-chain 2- oxoacid dehydrogenase (BCDH) activity
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Heterodimer of an alpha and a beta chain - The Blueprint of a Minimal Cell: MiniBacillus
Reuß, Microbiology and molecular biology reviews : MMBR 2016 - “...subtilis G. stearothermophilus G. stearothermophilus pdhB pdhC BSU14590 BSU14600 No No Yes Yes 1.2.4.1 2.3.1.12 3DUF 3DUF G. stearothermophilus G....”
- Comprehensive analysis of temporal alterations in cellular proteome of Bacillus subtilis under curcumin treatment
Reddy, PloS one 2015 - “...D-7 P52996 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB 30 3 -1.94 NS -1.92 328 284 0.037 D-8 * P21882 Pyruvate dehydrogenase E1 component subunit beta PdhB 35.47 26 -1.69 NS NS 317 171 0.015 D-9 * Q9KWU4 Pyruvate carboxylase Pyc 127.9 30 -2.75 NS NS 315 188 0.0012 D-10...”
- Proteomic analysis reveals differential protein expression by Bacillus cereus during biofilm formation
Oosthuizen, Applied and environmental microbiology 2002 - “...MKKGINRVVL 82 34 4.80 5.50 34.79 4.99 P21882 RZC01921 35.23 4.90 36 QMTMIQAITD Pyruvate lipoamide 3 Sacetyl-dihydro-lipoamide CO2 Pyruvate dehydrogenase E1...”
lmo1053 highly similar to pyruvate dehydrogenase (E1 beta subunit) from Listeria monocytogenes EGD-e
LMRG_00515 pyruvate dehydrogenase complex, E1 component, pyruvate dehydrogenase beta subunit from Listeria monocytogenes 10403S
46% identity, 100% coverage
- Integrative analysis of transcriptomic and immunoproteomic data reveals stress response mechanisms in <i>Listeria monocytogenes</i>
D'Onofrio, Heliyon 2024 - “...reductase Oxidative stress 2868 3651 0,00307804 lmo2157 sepA Hypotetical protein Acidic stress 2495 2815 0,00551796 lmo1053 PdhB pyruvate dehydrogenase subunit E1 beta DNA damage 2975 3457 0,00448443 FPKM Value converted to -Log 2 . a FPKM : Fragments Per Kilobase of Transcript per Million Mapped Reads....”
- “...Interestingly, thioredoxin reductase (TrxB), encoded by lmo2478 and pyruvate dehydrogenase E1 beta-subunit (PdhB), encoded by lmo1053, are also significantly upregulated at transcriptomic level (3457 and 3651 respectively) and are uniques to C-stress [ 17 ]. TrxB is associated with oxidative stress responses and is regulated by...”
- The ribonuclease PNPase is a key regulator of biofilm formation in Listeria monocytogenes and affects invasion of host cells
Quendera, NPJ biofilms and microbiomes 2023 - “...lmo1052 Pyruvate dehydrogenase subunit E1 alpha, PdhA Energy production and conversion 0.10 4.9410 6 0.56 lmo1053 Pyruvate dehydrogenase subunit E1 beta, PdhB 0.13 8.5410 5 0.56 lmo1054 Dihydrolipoamide acetyltransferase E2, PdhC 0.16 5.5710 4 lmo1055 Dihydrolipoamide dehydrogenase E3, PdhD 0.26 2.4010 2 Fold changes were calculated...”
- The transcriptional response of Listeria monocytogenes during adaptation to growth on lactate and diacetate includes synergistic changes that increase fermentative acetoin production
Stasiewicz, Applied and environmental microbiology 2011 - “...genes (pgk, gap, gapR), pyruvate dehydrogenase gene (lmo1053 pdhB), twocomponent response regulator genes (lmo1021, lmo1377, lmo2500), ABC-2 transport protein...”
- Transcriptome analysis of alkali shock and alkali adaptation in Listeria monocytogenes 10403S
Giotis, Foodborne pathogens and disease 2010 - “...lmo0210 lmo2458 lmo1567 lmo1641 lmo2122 lmo1293 lmo1538 lmo1407 LMOf2365_1073 lmo1053 lmo2124 4.67 8.21 10.4 8.09 2.42 2.51 2.04 2 10.4 5.35 3.52 8.93 4.62 12...”
- Deep RNA sequencing of L. monocytogenes reveals overlapping and extensive stationary phase and sigma B-dependent transcriptomes, including multiple highly transcribed noncoding RNAs
Oliver, BMC genomics 2009 - “...IIB component 378.5 LMRG_01737 lmo2511 lmo2511 similar to B. subtilis YvyD protein 377.1 LMRG_00515 pdhB lmo1053 highly similar to pyruvate dehydrogenase (E1 beta subunit) 356.4 LMRG_00704 lmo1255 lmo1255 similar to PTS system trehalose-specific enzyme IIBC 353.6 LMRG_00516 pdhC lmo1054 highly similar to pyruvate dehydrogenase (dihydrolipoamide acetyltransferase...”
- Intracellular gene expression profile of Listeria monocytogenes
Chatterjee, Infection and immunity 2006 - “...lmo0136 lmo0152 lmo0210 2.20 5.56 2.14 lmo0972 lmo0974 lmo1053 lmo1055 2.66 4.95 4.03 2.74 lmo1293 lmo1407 lmo1538 lmo1934 lmo2032 lmo2114 lmo2115 lmo2468 2.25...”
- Deep RNA sequencing of L. monocytogenes reveals overlapping and extensive stationary phase and sigma B-dependent transcriptomes, including multiple highly transcribed noncoding RNAs
Oliver, BMC genomics 2009 - “...beta-glucoside-specific enzyme IIB component 378.5 LMRG_01737 lmo2511 lmo2511 similar to B. subtilis YvyD protein 377.1 LMRG_00515 pdhB lmo1053 highly similar to pyruvate dehydrogenase (E1 beta subunit) 356.4 LMRG_00704 lmo1255 lmo1255 similar to PTS system trehalose-specific enzyme IIBC 353.6 LMRG_00516 pdhC lmo1054 highly similar to pyruvate dehydrogenase...”
PPE_02531 alpha-ketoacid dehydrogenase subunit beta from Paenibacillus polymyxa E681
46% identity, 100% coverage
lpp1516 hypothetical protein from Legionella pneumophila str. Paris
46% identity, 100% coverage
SMc03202 branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4) from Sinorhizobium meliloti 1021
SMc03202 PROBABLE 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT PROTEIN from Sinorhizobium meliloti 1021
47% identity, 97% coverage
Atu3472 2-oxoisovalerate dehydrogenase beta subunit from Agrobacterium tumefaciens str. C58 (Cereon)
46% identity, 97% coverage
SE37_03100 alpha-ketoacid dehydrogenase subunit beta from Geobacter soli
GSU2436 dehydrogenase complex, E1 component, beta subunit from Geobacter sulfurreducens PCA
49% identity, 98% coverage
- Genome sequence of a dissimilatory Fe(III)-reducing bacterium Geobacter soli type strain GSS01(T)
Yang, Standards in genomic sciences 2015 - “...G. soli possesses two sets of genes encoding pyruvate dehydrogenase complexes (SE37_03080, SE37_02045, SE37_02040, and SE37_03100; SE37_03105 and SE37_02035) to irreversibly convert pyruvate to acetyl-CoA. The reverse reaction in G. soli from acetyl-CoA is attributed to a homodimeric pyruvate-ferredoxin/flavodoxin oxidoreductase (SE37_14040). In addition to pyruvate, ethanol...”
- Comparative proteomics of Geobacter sulfurreducens PCAT in response to acetate, formate and/or hydrogen as electron donor
Mollaei, Environmental microbiology 2021 - “...vs Fo, 2.7 fold vs Mix). The alternative reactions using pyruvate dehydrogenase (PdhA; GSU2443, PdhB; GSU2436) were present in all the conditions but were the highest in the hydrogen condition i.e. PdhA (3.6 fold vs Ac, 2.7 fold vs Fo, 3.9 fold vs Mix) and PdhB...”
EF_1354, P027_00306 alpha-ketoacid dehydrogenase subunit beta from Enterococcus faecalis EnGen0427
EF1354 pyruvate dehydrogenase complex, E1 component, beta subunit from Enterococcus faecalis V583
46% identity, 100% coverage
- Biochemical characterization of extracellular polymeric substances from endodontic biofilms
Ramirez-Mora, PloS one 2018 - “...Cytoplasmic Q839Q5 Ornithine carbamoyltransferase (OTCase), catabolic arcB Transferase Cytoplasmic Q9MTM3 DNA-directed RNA polymerase subunit beta P027_00306 Oxidoreductase Cytoplasmic A8MHG9 30S ribosomal protein S2 rpsB Ribonucleoprotein Cytoplasmic J5JNN7 Phosphate acetyltransferase HMPREF1342_00604 Acyltransferase Cytoplasmic J6CLQ9 PTS system mannose-fructose-sorbose IID component HMPREF1335_01036 Transmembrane Membrane L2L4B1 D-alanyl-lipoteichoic acid biosynthesis protein...”
- The Enterococcus faecalis exoproteome: identification and temporal regulation by Fsr
Shankar, PloS one 2012 - “...51 21a L-lactate dehydrogenase Ldh (EF_0255) 35.52/4.77 14/38 47 22a Pyruvate dehydrogenase E1 component, PdhB (EF_1354) 35.37/4.67 12/46 37 23a Basic membrane protein family (EF_0177) 37.78/4.88 8/15 21 24a Basic membrane protein family (EF_0177) 37.78/4.88 4/15 14 25a Arginine deiminase, ArcB (EF_0105) 38.13/5.02 19/28 46 26a...”
- Enterococcus faecalis Glycolipids Modulate Lipoprotein-Content of the Bacterial Cell Membrane and Host Immune Response
Theilacker, PloS one 2015 - “...protein lipoprotein EF1534 2.870 Peptidyl prolyl cis/trans isomerase lipoprotein EF3198 2.258 Lipoprotein. YaeC family lipoprotein EF1354 2.230 Pyruvate dehydrogenase complex. E1 component. beta subunit cytoplasmic EF1353 2.207 Pyruvate dehydrogenase complex. E1 component. alpha subunit cytoplasmic EF2191 1.983 dTDP-4-dehydrorhamnose reductase cytoplasmic EF3082 1.955 Iron compound ABC transporter....”
- Growth rate-dependent control in Enterococcus faecalis: effects on the transcriptome and proteome, and strong regulation of lactate dehydrogenase
Mehmeti, Applied and environmental microbiology 2012 - “...EF0020 EF0195 EF0949 EF1125 EF1131 EF1167 EF1353 EF1354 EF1356 EF1416 EF1526 EF1612 EF1962 EF1963 EF1964 EF0283 Phosphotransferase system, mannose-specific IIAB...”
- Transcriptome, proteome, and metabolite analyses of a lactate dehydrogenase-negative mutant of Enterococcus faecalis V583
Mehmeti, Applied and environmental microbiology 2011 - “...EF0949 EF1017 EF1018 EF1019 EF1213 EF1214 EF1343 EF1353 EF1354 EF1355 EF1356 EF1612 EF1613 EF1712 ldh-1 Putative function pdhA pdhB aceF lpdA pflA pflB pyrE...”
- “...2409 EF1213 [acetolactate synthetase gene], EF1353 and EF1354 [pyruvate dehydrogenase complex genes], EF1612 [pyruvate formate lyase activating enzyme gene],...”
BAU10_20475, N646_4476 alpha-ketoacid dehydrogenase subunit beta from Vibrio alginolyticus
47% identity, 100% coverage
- Identification of the global regulatory roles of RraA via the integrative transcriptome and proteome in Vibrio alginolyticus
Chen, mSphere 2024 - “...for catalyzing the conversion of pyruvate to acetyl-CoA and is encoded by PdhAB (BAU10_20470 and BAU10_20475), were also significantly reduced by more than 12.17- and 22-fold, respectively, in the mutant (Table S4). Positive role in amino acid transport and metabolism Branched-chain amino acids (BCAAs) are initially...”
- Functional proteomics identify mannitol metabolism in serum resistance and therapeutic implications in Vibrio alginolyticus
Kou, Frontiers in immunology 2022 - “...whose abundance was significantly increased, while two altered proteins related with pyruvate metabolism (PdhA and N646_4476) were largely decreased in terms of abundance. Seven proteins involved in the biosynthesis of amino acids were significantly increased. Interestingly, in addition to glycine, serine, and threonine metabolism, fructose and...”
UE46_11895 alpha-ketoacid dehydrogenase subunit beta from Listeria weihenstephanensis
46% identity, 100% coverage
- Complete Circular Genome Sequence and Temperature Independent Adaptation to Anaerobiosis of Listeria weihenstephanensis DSM 24698
Ferrari, Frontiers in microbiology 2017 - “...atgggtaacagaatcaatcg UE46_08310_qRT_R agtcgaccaaagtacggtta UE46_08610, gcvPA UE46_08610_qRT_F acaagaaattgagccgttag UE46_08610_qRT_R cttgggaatctcctacaaca UE46_10735, gltB UE46_10735_qRT_F cgattgacgtctttacgaat UE46_10735_qRT_R caattttcgacatcaccttc UE46_11895, pdhB UE46_11895_qRT_F aaggtcttttgatctcagca UE46_11895_qRT_R ctttaccgatttcgattgtg UE46_11930, moaC UE46_11930_qRT_F tattaaagaagggcaaatcg UE46_11930_qRT_R actttcgtcgtcataattgg UE46_11975, narH UE46_11975_qRT_F caactggaaaacgaataagg UE46_11975_qRT_R cataaagcatcacaccaaga UE46_14170 UE46_14170_qRT_F attgcaccgaatatcttcac UE46_14170_qRT_R aaatgctttcgtcaaactgt UE46_14320 UE46_14320_qRT_F cgaataaaatcgacttcgtg UE46_14320_qRT_R cgaccgacttaatatccgta Results Complete genome...”
Q9HIA4 branched-chain-2-oxoacid decarboxylase (subunit 2/2) (EC 4.1.1.72) from Thermoplasma acidophilum (see paper)
47% identity, 99% coverage
BMEII0747 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT from Brucella melitensis 16M
47% identity, 97% coverage
BruAb2_0699 2-oxoisovalerate dehydrogenase E1 component, beta subunit from Brucella abortus biovar 1 str. 9-941
BAB2_0714 Transketolase, central region:Transketolase, C terminal from Brucella melitensis biovar Abortus 2308
47% identity, 97% coverage
VP_RS18300 alpha-ketoacid dehydrogenase subunit beta from Vibrio parahaemolyticus RIMD 2210633
VPA0646 putaive pyruvate dehydrogenase E1 component, beta subunit from Vibrio parahaemolyticus RIMD 2210633
47% identity, 100% coverage
SE37_02040 alpha-ketoacid dehydrogenase subunit beta from Geobacter soli
48% identity, 100% coverage
- Genome sequence of a dissimilatory Fe(III)-reducing bacterium Geobacter soli type strain GSS01(T)
Yang, Standards in genomic sciences 2015 - “...30 ], G. soli possesses two sets of genes encoding pyruvate dehydrogenase complexes (SE37_03080, SE37_02045, SE37_02040, and SE37_03100; SE37_03105 and SE37_02035) to irreversibly convert pyruvate to acetyl-CoA. The reverse reaction in G. soli from acetyl-CoA is attributed to a homodimeric pyruvate-ferredoxin/flavodoxin oxidoreductase (SE37_14040). In addition to...”
TTE0689 Thiamine pyrophosphate-dependent dehydrogenases, E1 component beta subunit from Thermoanaerobacter tengcongensis MB4
49% identity, 95% coverage
Q46143 acetoin dehydrogenase system (EC 2.3.1.190) from Clostridium magnum (see paper)
acoB TPP-dependent acetoin dehydrogenase complex, E1 component, beta subunit; EC 1.1.1.- from Clostridium magnum (see paper)
AAA21745.1 TPP-dependent acetoin dehydrogenase beta-subunit from Clostridium magnum (see paper)
49% identity, 93% coverage
MXAN_2667 pyruvate dehydrogenase complex, E1 component, pyruvate dehydrogenase, beta subunit from Myxococcus xanthus DK 1622
47% identity, 99% coverage
- Peripheral rods: a specialized developmental cell type in Myxococcus xanthus
Whitfield, Genomics 2020 - “...Rods. Protein function or tag MxDK1622 tag Stationary/Peripheral PdhC dehydrogenase MXAN_2666 2.47 PdhC dihydrolipoate dehydrogenase MXAN_2667 2.21 PdhC dihydrolipoamide acetyltransferase MXAN_2668 3.29 Malate dehydrogenase MXAN_3538 3.01 Succinate CoA ligase MXAN_3542 2.21 Cytochrome c MXAN_5560 2.20 The numbers in the final column represent log2FoldChange. Positive values demonstrate...”
WP_017724146 alpha-ketoacid dehydrogenase subunit beta from Staphylococcus xylosus
44% identity, 100% coverage
ODPB_STAAU / P0A0A3 Pyruvate dehydrogenase E1 component subunit beta; EC 1.2.4.1 from Staphylococcus aureus (see paper)
SAOUHSC_01041 pyruvate dehydrogenase complex, E1 component, pyruvate dehydrogenase beta subunit, putative from Staphylococcus aureus subsp. aureus NCTC 8325
P0A0A1 Pyruvate dehydrogenase E1 component subunit beta from Staphylococcus aureus (strain Mu50 / ATCC 700699)
P99063 Pyruvate dehydrogenase E1 component subunit beta from Staphylococcus aureus (strain N315)
Q6GAC0 Pyruvate dehydrogenase E1 component subunit beta from Staphylococcus aureus (strain MSSA476)
Q6GHZ1 Pyruvate dehydrogenase E1 component subunit beta from Staphylococcus aureus (strain MRSA252)
SA0944 pyruvate dehydrogenase E1 component beta subunit from Staphylococcus aureus subsp. aureus N315
SAV1094 pyruvate dehydrogenase E1 component beta subunit from Staphylococcus aureus subsp. aureus Mu50
SAUSA300_0994 pyruvate dehydrogenase E1 component, beta subunit from Staphylococcus aureus subsp. aureus USA300_FPR3757
SAR1068 putative pyruvate dehydrogenase E1 component, beta subunit from Staphylococcus aureus subsp. aureus MRSA252
44% identity, 100% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity).
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Heterodimer of an alpha and a beta chain - Impact of Environmental Conditions on the Protein Content of Staphylococcus aureus and Its Derived Extracellular Vesicles
da, Microorganisms 2022 - “...J SAOUHSC_00206 L-lactate dehydrogenase ldh1 Cyt C SAOUHSC_01040 pyruvate dehydrogenase subunit, putative pdhA Cyt C SAOUHSC_01041 pyruvate dehydrogenase subunit, putative pdhB Cyt C SAOUHSC_01042 branched-chain -keto acid dehydrogenase pdhC Cyt C SAOUHSC_00796 phosphoglycerate kinase pgk Cyt F SAOUHSC_01002 quinol oxidase AA3, subunit II, putative qoxA PSE...”
- Proteomic and Metabolomic Analyses of a Tea-Tree Oil-Selected Staphylococcus aureus Small Colony Variant
Torres, Antibiotics (Basel, Switzerland) 2019 - “...and secondary metabolites 1.4 SAOUHSC_01040 PdhA pyruvate dehydrogenase complex, E1 subunit alpha carbohydrate metabolism 1.5 SAOUHSC_01041 PdhB pyruvate dehydrogenase complex, E1 subunit beta carbohydrate metabolism 1.5 SAOUHSC_01043 PdhD dihydrolipoamide dehydrogenase carbohydrate metabolism 1.3 SAOUHSC_01058 TypA GTP-binding protein unclassified 1.7 SAOUHSC_01064 PycA pyruvate carboxylase carbohydrate metabolism 1.7...”
- Copper stress in Staphylococcus aureus leads to adaptive changes in central carbon metabolism
Tarrant, Metallomics : integrated biometal science 2019 - “...<0.00010 Phosphoribosylformylglycinamidine synthase purS SAOUHSC_01011 gi|446771094 1.9 0.00012 Pyruvate dehydrogenase E1 component subunit beta pdhB SAOUHSC_01041 gi|445990321 1.6 <0.00010 Glyceraldehyde-3-phosphate dehydrogenase A gapA SAOUHSC_00795 gi|446201559 1.4 <0.00010 Proteins with decreased abundance in cells cultured in 1 mM Cu in TSB medium Formate acetyltransferase pflB SAOUHSC_00187 gi|446817404...”
- MgrA Negatively Regulates Biofilm Formation and Detachment by Repressing the Expression of psm Operons in Staphylococcus aureus
Jiang, Applied and environmental microbiology 2018 - “...protein; DNA binding; similar to ParB, probably involved in chromosome partitioning and cell division processes SAOUHSC_01041 Pyruvate dehydrogenase complex, E1 component subunit 35,246 Pyruvate dehydrogenase complex, putative E1 component subunit; pyruvate dehydrogenase (acetyl group-transferring) activity SAOUHSC_00472 RPPK 35,284 Ribose phosphate pyrophosphokinase; ATP binding; kinase activity; magnesium...”
- Genome-wide screen for genes involved in eDNA release during biofilm formation by Staphylococcus aureus
DeFrancesco, Proceedings of the National Academy of Sciences of the United States of America 2017 - “...SAOUHSC_02273 SAOUHSC_00798 SAOUHSC_01042 SAOUHSC_01040 SAOUHSC_01041 SAOUHSC_01743 SAOUHSC_00467 SAOUHSC_02353 SAOUHSC_02341 SAOUHSC_02346 SAOUHSC_02343...”
- Advantage of upregulation of succinate dehydrogenase in Staphylococcus aureus biofilms
Gaupp, Journal of bacteriology 2010 - “...dehydrogenase complex E1 component, beta-subunit (SAOUHSC_01041); PdhC, pyruvate dehydrogenase component E2 (SAOUHSC_01042); CitZ, citrate synthase...”
- The C-terminal region of the RNA helicase CshA is required for the interaction with the degradosome and turnover of bulk RNA in the opportunistic pathogen Staphylococcus aureus
Giraud, RNA biology 2015 - “...Proteins identified in the mock sample (Elongation factor Tu, A5IQA2 (14peptides) and Pyruvate dehydrogenase E1 P0A0A1 (5peptides)) are not indicated gene name Identified Proteins CshA CshACter RNase J1 CshB MW + () RNase + () RNase () RNase + () RNase RNA METABOLISM CshA CshA (used...”
- Impacts of the Type I Toxin-Antitoxin System, SprG1/SprF1, on Staphylococcus aureus Gene Expression
Chlebicka, Genes 2021 - “...6 Uracil phosphoribosyltransferase (Upp) P67396 2.19 Stationary phase 1 Pyruvate dehydrogenase E1 component subunit (PdhB) P99063 2.19 1.82 2 Succinate--CoA ligase (ADP-forming) subunit (SucD) P99070 1.55 3 Putative peptidyl-prolyl cis-trans isomerase (PpiB) Q7A6I1 2.19 1.82 4 3-hydroxyacyl-(acyl-carrier-protein) dehydrataseFabZ (FabZ) P64108 2.36 5 6,7-dimethyl-8-ribityllumazine synthase (RibH) P99141...”
- “...of pyruvate dehydrogenase complex (PdhC) P65636 2.71 2.00 11 Pyruvate dehydrogenase E1 component subunit (PdhB) P99063 1.84 2.23 12 Dihydrolipoyl dehydrogenase (PdhD) P99084 1.66 1.60 13 Fructose-bisphosphate aldolase class 1 (Fda) P99117 1.68 1.56 14 Triosephosphate isomerase (TpiA) P99133 1.59 1.92 15 Glyceraldehyde-3-phosphate dehydrogenase 1 (GapA1)...”
- Slightly acidic electrolyzed water inhibits inflammation induced by membrane vesicles of <i>Staphylococcus aureus</i>
Shimamura, Frontiers in microbiology 2023 - “...MW Accession Mascot search accession No. Pyruvate dehydrogenase E1 component subunit beta pdh B 35,246 Q6GAC0 WP_000068176.1 Delta-aminolevulinic acid dehydratase hem B 36,583 Q2FXR3 WP_000667126.1 Enolase eno 47,117 O69174 O69174.1 Glyceraldehyde-3-phosphate dehydrogenase 1 gap A1 36,281 Q6GB58 WP_000279414.1 Pyruvate dehydrogenase E1 component subunit alpha pdh A...”
- Structural and Functional Dynamics of Staphylococcus aureus Biofilms and Biofilm Matrix Proteins on Different Clinical Materials
Hiltunen, Microorganisms 2019 - “...Q6GIL4 Phosphoglycerate kinasePGK Q6GIL7 Pyruvate kinasePYK Q6GG09 Fructose-bisphosphate aldolase class 1FBA Q6GDJ7 Pyruvate dehydrogenase E1PDHB Q6GHZ1 Triosephosphate isomeraseTPI Q6GIL6 ATP-dependent 6-phosphofructokinasePFK Q6GG08 2,3-phosphoglycerate mutasePPGM Q6GE17 Aconitase AAcnA Q6GH55 L-lactate dehydrogenase 1L-LDH Q6GK73 D-lactate dehydrogenaseD-LDH Q6GDS2 Alkaline shock protein 23Asp23 Q6GEP7 Alcohol dehydrogenaseADH Q99W07 Trigger factorTf Q6GG30...”
- The DEAD-box RNA helicase CshA is required for fatty acid homeostasis in Staphylococcus aureus
Khemici, PLoS genetics 2020 - “...8, 10 and 20 min after rifampicin addition at 400 g/ml. The mRNA levels of SA0944, the second gene of the pdh operon encoding PdhB, were quantified by RT-qPCR using 16S rRNA as reference. Expression is shown in arbitrary units, where time 0 after rifampicin addition...”
- “...(PR01-cshA), cshA/pdhA A2P (C43), cshA/ahrC R44C (C57) and cshA/rny 224 (SVK7). The mRNA levels of SA0944, the second gene of the pdh operon encoding PdhB, were quantified by RT-qPCR using 16S rRNA as reference gene. Expression is shown as arbitrary units, where wt was set to...”
- Respiration and Small Colony Variants of Staphylococcus aureus
Proctor, Microbiology spectrum 2019 (secret) - Secretome analysis revealed adaptive and non-adaptive responses of the Staphylococcus carnosus femB mutant
Nega, Proteomics 2015 - “...SA1170 katA SACOL0866 2.9 57.2 5.3 PdhB Pyruvate dehydrogenase E1 component beta subunit homolog Sca_0720 SA0944 pdhB SACOL1103 10 35.2 4.6 RplC 50S ribosomal protein L3 homolog Sca_1735 SA2047 rplC SACOL_2239 2.2 + 23.7 9.6 RplE 50S ribosomal protein P5 homolog Sca_1723 SA2035 rplE SACOL2227 5.1...”
- Biofilm matrix exoproteins induce a protective immune response against Staphylococcus aureus biofilm infection
Gil, Infection and immunity 2014 - “...15927699 c SA1927 15926449 c SA0727 15926679 c SA0944 15928148 c SA2356 15927884 15925944c SA2097 SA0232 15926229 15927133c 15927879c SA0509 SA1382 SA2093...”
- Eukaryote-like serine/threonine kinases and phosphatases in bacteria
Pereira, Microbiology and molecular biology reviews : MMBR 2011 - “...toxin expression CovR SA1499 SA2340 SA2399 SA1359 SA0729 SA0731 SA0944 NA Ser(s), Thr(s) Thr(s) Thr(s) NA Thr(s) NA Thr(s) NA Thr(s) Ser(s) NA T65 Thr(s),...”
- An RpoB mutation confers dual heteroresistance to daptomycin and vancomycin in Staphylococcus aureus
Cui, Antimicrobial agents and chemotherapy 2010 - “...SA1615 SA1614 menD menE menC Citrate cycle (TCA cycle) SA0944 SA0945 phdB pdhC SA0946 pdhD SA0994 SA0995 SA0996 SA1088 SA1089 SA1131 SA1132 SA1184 SA1244 SA1245...”
- Staphylococcal major autolysin (Atl) is involved in excretion of cytoplasmic proteins
Pasztor, The Journal of biological chemistry 2010 - “...SA0731 SA1927 SA0727 SA1142 SA1836 SA1036 SA1579 SA2400 SA1245 SA0944 SA0945 00505 01683 00529 00530 00799 02366 00795 01278 02254 01159 01875 02927 01418 01041...”
- Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
Anderson, FEMS immunology and medical microbiology 2010 - “...sa_c8588s7547_a_at 2.2 2.5 5 SA0932 D-isomer specific 2-hydroxyacid dehydrogenase family protein sa_c8625s7576_a_at 3.7 5 15 SA0944 putative NADH dehydrogenase sa_c871s671_a_at 2.9 2.5 5 SA1130 putative glycerophosphoryl diester phosphodiesterase sa_c2220s1920_a_at * 5.5 2.5 2.5 SA1514 glycerol-3-phosphate dehydrogenase, NAD-dependent sa_c2448s2032_a_at 2.5 2.5 2.5 SA1545 short chain dehydrogenase/reductase family...”
- More
- Borosilicate bioactive glass synergizing low-dose antibiotic loaded implants to combat bacteria through ATP disruption and oxidative stress to sequentially achieve osseointegration
Fan, Bioactive materials 2025 - “...respiratory chain on cell membranes [ 47 , 48 ]. In our results, SACOL1102 , SAV1094 , SAV1114 , BSU28450 , etc., relative to genes involved in the TCA cycle, were significantly downregulated in S. aureus in the B/G/PMMA group. The expression of NADP binding-related genes...”
- Defining the Roles of Pyruvate Oxidation, TCA Cycle, and Mannitol Metabolism in Methicillin-Resistant Staphylococcus aureus Catheter-Associated Urinary Tract Infection
Paudel, Microbiology spectrum 2023 - “...three additional catalytic peptides, PDH E1 ( pdhA , SAUSA300_0993), PDH E1 ( pdhB , SAUSA300_0994), and dihydrolipoamide acetyltransferase (SAUSA300_0995) ( 17 ). The PDH complex bridges glycolysis with TCA cycle by catalyzing oxidative decarboxylation of pyruvate to acetyl-CoA and shares homology with the branched-chain -keto...”
- Identification of Methicillin-Resistant Staphylococcus aureus (MRSA) Genetic Factors Involved in Human Endothelial Cells Damage, an Important Phenotype Correlated with Persistent Endovascular Infection
Xiao, Antibiotics (Basel, Switzerland) 2022 - “...7.21 SAUSA300_0049 hypothetical hypothetical protein 11.30 0.62 SAUSA300_1667 hypothetical putative glycerophosphoryl diester phosphodiesterase 11.30 7.51 SAUSA300_0994 pdhB pyruvate dehydrogenase E1 component, beta subunit 11.20 8.12 SAUSA300_0974 purN phosphoribosylglycinamide formyltransferase 11.07 8.08 SAUSA300_0067 hypothetical universal stress protein 11.02 9.02 SAUSA300_1590 rsh (relA) GTP pyrophosphokinase 10.95 7.18 SAUSA300_0526...”
- “...8.08 20.58 a SAUSA300_1563 accC 16.73 11.04 11.82 0.72 SAUSA300_0041 hypothetical 10.41 2.09 3.30 a SAUSA300_0994 pdhB 11.20 8.12 19.36 a SAUSA300_0186 argC 12.92 16.00 15.20 2.13 SAUSA300_1992 agrA 5.34 14.81 3.82 1.77 SAUSA300_0355 hypothetical 0.68 4.44 1.20 a SAUSA300_0690 saeS 4.89 14.01 12.80 1.77 a...”
- Growth and Stress Tolerance Comprise Independent Metabolic Strategies Critical for Staphylococcus aureus Infection
Kim, mBio 2021 - “...+ + 4,150 1945 301,000 260,178 SAUSA300_1193 glpD 11662 12741 1041 + + + + SAUSA300_0994 pdhB 320216 * 14872 992 + + + + 4,014 2,778 ** 177,143 107,968 *** SAUSA300_2439 galU 6941 4718 974 + + + + SAUSA300_1902 6630 11137 963 + +...”
- “...*** 0.830.47 ** SAUSA300_0993 pdhA 10 0.510.12 **** 10 35.335.26 **** 48.367.94 *** NA NA SAUSA300_0994 pdhB 13.4 0.560.02 **** 11.21 75.429.72 89.4935.07 NA NA SAUSA300_0995 pdhC 5.66 0.980.04 1.88 97.527.89 111.2115 31.989.28 0.580.03 SAUSA300_0996 lpdA NA 0.380.3 **** 7.64 89.6123.13 72.9018.45 * NA NA SAUSA300_2067...”
- Heparin Mimics Extracellular DNA in Binding to Cell Surface-Localized Proteins and Promoting Staphylococcus aureus Biofilm Formation
Mishra, mSphere 2017 - “...DNA-binding protein HU 3 12 56 None SAUSA300_0099 1 -Phosphatidylinositol phosphodiesterase 7 7 21 None SAUSA300_0994 Pyruvate dehydrogenase E1 component beta subunit 4 11 43 None SAUSA300_1382 LukS 4 7 17 None SAUSA300_1381 LukF 7 9 30 AKKSKI SAUSA300_0618 ABC transporter substrate-binding protein 10 5 16...”
- “...surface protein 4 5 42 None SAUSA300_2195 30S ribosomal protein S17 2 2 24 YKTHKLGKRVKYSKKYKT SAUSA300_0994 Putative pyruvate dehydrogenase E1 beta subunit 3 7 65 None SAUSA300_2164 Surface protein 2 2 24 None Cell wall fraction SAUSA300_0113 Immunoglobulin G-binding protein A 21 31 45 None SAUSA300_2192...”
- The Staphylococcus aureus response to unsaturated long chain free fatty acids: survival mechanisms and virulence implications
Kenny, PloS one 2009 - “...eno enolase 3.09 4.60E-03 SAR0832 eno enolase 2.07 5.15E-03 SAR0924 pgi glucose-6-phosphate isomerase 2.31 2.73E-02 SAR1068 pdhB putative pyruvate dehydrogenase E1 component 2.72 2.29E-04 SAR1068 pdhB putative pyruvate dehydrogenase E1 component 2.72 2.29E-04 SAR1121 sdhA putative succinate dehydrogenase flavoprotein 2.24 1.36E-02 SAR1451 ald2 alanine dehydrogenase 2...”
BSQ49_00270 alpha-ketoacid dehydrogenase subunit beta from Liquorilactobacillus hordei
46% identity, 100% coverage
SACOL1103 pyruvate dehydrogenase complex E1 component, beta subunit from Staphylococcus aureus subsp. aureus COL
44% identity, 100% coverage
Rta_10490 alpha-ketoacid dehydrogenase subunit beta from Ramlibacter tataouinensis TTB310
44% identity, 90% coverage
Caur_1334 Transketolase central region from Chloroflexus aurantiacus J-10-fl
48% identity, 99% coverage
- Complete genome sequence of the filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus
Tang, BMC genomics 2011 - “...E2 (EC 2.3.1.12), and E3 (EC 1.8.1.4) convert pyruvate to acetyl-CoA in pyruvate metabolism E1 (Caur_1334, 1335, 1972, 1973, 2805, 3121, 3671, and 3672), E2 (Caur_1333, Caur_1974), E3 ( dld , Caur_0170, Caur_2840) Central carbon metabolism pyruvate:ferredoxin oxidoreductase (or pyruvate synthase) (EC 1.2.7.1) convert acetyl-CoA to...”
LSA1084 Pyruvate dehydrogenase complex, E1 component, beta subunit from Lactobacillus sakei subsp. sakei 23K
45% identity, 98% coverage
- Global transcriptome response in Lactobacillus sakei during growth on ribose
McLeod, BMC microbiology 2011 - “...2.8 2.5 2.1 LSA1083 pdhC Puruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase 3.4 3.7 2.7 LSA1084 pdhB Pyruvate dehydrogenase complex, E1 component, beta subunit 3.2 3.3 2.2 LSA1085 pdhA Pyruvate dehydrogenase complex, E1 component, alpha subunit 2.9 3.5 2.4 LSA1141* ppdK Pyruvate phosphate dikinase 1.0 0.9...”
- Analysis of Lactobacillus sakei mutants selected after adaptation to the gastrointestinal tracts of axenic mice
Chiaramonte, Applied and environmental microbiology 2010 - “...0.002 0.030 0.005 34 6.2 4.3 8.5 6.5 2.7 LSA1084 0.041 3.2 LSA0463 LSA0494 0.003 0.007 3.2 4.0 Universal stress protein (Usp6) Oligopeptide ABC transporter,...”
- “...the beta subunit of the pyruvate dehydrogenase complex (LSA1084), are involved in the metabolism of pyruvate. The remaining proteins are involved in amino acid...”
ING2E5A_1490 alpha-ketoacid dehydrogenase subunit beta from Petrimonas mucosa
50% identity, 97% coverage
- The Role of Petrimonas mucosa ING2-E5AT in Mesophilic Biogas Reactor Systems as Deduced from Multiomics Analyses
Maus, Microorganisms 2020 - “...pyruvate + HCO 3 - <=> ADP + phosphate + oxaloacetate pyc B1, pyc B3 ING2E5A_1490, ING2E5A_1805, ING2E5A_1806, 1.2.4.1 Pyruvate dehydrogenase Pyruvate + [dihydrolipoyllysine-residue acetyltransferase] lipoyllysine <=> [dihydrolipoyllysine-residue acetyltransferase] S-acetyldihydrolipoyllysine + CO(2) pdh B1, pdh B3, pdh A ING2E5A_1158, ING2E5A_1264, ING2E5A_1491, ING2E5A_1804 2.3.1.12 Dihydrolipoyllysine-residue acetyltransferase Acetyl-CoA...”
Q39S03 Pyruvate dehydrogenase complex, E1 protein, beta subunit from Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
47% identity, 99% coverage
SO2340 alpha keto acid dehydrogenase complex, E1 component, beta subunit from Shewanella oneidensis MR-1
46% identity, 100% coverage
LOC21388555 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Morus notabilis
47% identity, 86% coverage
- Genome-Wide Identification of Candidate Genes Associated with Heat Stress in Mulberry (Morus alba L.)
Jin, Current issues in molecular biology 2023 - “...2-oxoisovalerate dehydrogenase subunit alpha (LOC21403577), methylcrotonoyl-CoA carboxylase beta chain (LOC21410135), 2-oxoisovalerate dehydrogenase subunit beta 1 (LOC21388555), aldehyde dehydrogenase family 3 (LOC21398387), probable 3-hydroxybutyrate dehydrogenase (LOC21408668), branched-chain amino acid aminotransferase 1 (LOC21390509), isovaleryl-CoA dehydrogenase (LOC21397545), methylcrotonoyl-CoA carboxylase subunit alpha (LOC21385626), probable enoyl-CoA hydratase 1 (LOC21392597), aldehyde dehydrogenase...”
F9UQ92 Pyruvate dehydrogenase complex, E1 component,beta subunit from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_2153 pyruvate dehydrogenase complex, E1 component, beta subunit from Lactobacillus plantarum WCFS1
44% identity, 100% coverage
- Inorganic phosphate modifies stationary phase fitness and metabolic pathways in Lactiplantibacillus paraplantarum CRL 1905
Araoz, Frontiers in microbiology 2024 - “...Energy production and conversin pdhA F9UQ93 Pyruvate dehydrogenase complex, E1 component, alpha subunit * pdhB F9UQ92 Pyruvate dehydrogenase complex, E1 2.8 pdhC F9UQ91 Component, beta subunit Pyruvate dehydrogenase complex, 4.9 pox3 F9URC8 Dihydrolipoamide acetyltransferase * ack2 F9UTR4 Pyruvate oxidase * glpK1 Q88ZF1 Acetate kinase 1.8 pflB...”
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...E3 component; dihydrolipoamide dehydrogenase 1.90 F9UQ91 pdhC; pyruvate dehydrogenase complex, E2 component; dihydrolipoamide S-acetyltransferase 2.30 F9UQ92 pdhB; pyruvate dehydrogenase complex, E1 component, beta subunit 2.21 F9UQ93 pdhA; pyruvate dehydrogenase complex, E1 component, alpha subunit 2.12 Pyruvate metabolism F9UTR4 ack2; acetate kinase 1.59 F9UM63 pox1; pyruvate oxidase...”
- Oleuropein Transcriptionally Primes Lactobacillus plantarum to Interact With Plant Hosts
Santamaría, Frontiers in microbiology 2019 - “...( lp_3589 ), which produces acetyl-P from pyruvate and the pyruvate dehydrogenase complex ( lp_2151, lp_2153, lp_2154 ) which forms acetyl-CoA (the precursor of acetyl-P) from pyruvate. In addition, genes coding for enzymes of the acetyl-CoA complex ( accB2 or lp_1676, accC2 or lp_1678, accD2 or...”
- Functional analysis of the role of CggR (central glycolytic gene regulator) in Lactobacillus plantarum by transcriptome analysis
Rud, Microbial biotechnology 2011 - “...pdhD Pyruvate dehydrogenase complex, E3 component 2.8 lp_2152 pdhC Pyruvate dehydrogenase complex, E2 component 3.0 lp_2153 pdhB Pyruvate dehydrogenase complex, E1 component, beta subunit 3.7 1.0 lp_2154 pdhA Pyruvate dehydrogenase complex, E1 component, alpha subunit 4.1 0.9 1.1 lp_2629 pox3 Pyruvate oxidase 2.5 1.5 lp_3045 Shortchain...”
- Identification of prebiotic fructooligosaccharide metabolism in Lactobacillus plantarum WCFS1 through microarrays
Saulnier, Applied and environmental microbiology 2007 - “...lp_1481 lp_1498 lp_1499 lp_2096 lp_2097 lp_2151 lp_2152 lp_2153 lp_2154 lp_2371 lp_2757 lp_2684 lp_2776 lp_2794 lp_2920 lp_2969 lp_3010 lp_3011 lp_3045 lp_3092...”
LCAZH_1300 alpha-ketoacid dehydrogenase subunit beta from Lacticaseibacillus paracasei
46% identity, 100% coverage
- Roles of adenine methylation in the physiology of Lacticaseibacillus paracasei
Zhao, Nature communications 2023 - “...PDH (acetyl-transferring) E1 component subunit alpha (LCAZH_1299, pdhA ), the PDH E1 component beta subunit (LCAZH_1300, pdhB ), the dihydrolipoamide acetyltransferase (LCAZH_1301, pdhC ), and the dihydrolipoyl dehydrogenase (LCAZH_1302, pdhD ), contained a non-methylated motif that was highly similar to the CcpA binding site present in...”
- “...(LCAZH_0190), PDH (acetyl-transferring) E1 component subunit alpha (LCAZH_1299, pdhA ), PDH E1 component beta subunit (LCAZH_1300, pdhB ), dihydrolipoamide acetyltransferase (LCAZH_1301, pdhC ), dihydrolipoyl dehydrogenase (LCAZH_1301, pdhD ), and L-lactate dehydrogenase (LCAZH_0554). Class II fructose-bisphosphate aldolase, triose-phosphate isomerase, and aldose 1-epimerase are enzymes of the glycolytic...”
- Proteomics analysis of Lactobacillus casei Zhang, a new probiotic bacterium isolated from traditional home-made koumiss in Inner Mongolia of China
Wu, Molecular & cellular proteomics : MCP 2009 - “...(E1, pyruvate dehydrogenase, LCAZH_1299 and LCAZH_1300; E2, dihydrolipoamide dehydrogenase transacetylase, LCAZH_1301; and E3, lipoamide dehydrogenase,...”
- “...pyruvate dehydrogenase complex E1 component (spot 14, LCAZH_1300) showed enhanced expression in the stationary phase. We also identified acid stress-associated...”
OEOE_0329 acetoin dehydrogenase complex, E1 component, beta subunit from Oenococcus oeni PSU-1
47% identity, 100% coverage
LSEI_1306 alpha-ketoacid dehydrogenase subunit beta from Lacticaseibacillus paracasei ATCC 334
LSEI_1306 acetoin dehydrogenase complex, E1 component, beta subunit from Lactobacillus casei ATCC 334
46% identity, 100% coverage
- Regulatory Mechanisms of L-Lactic Acid and Taste Substances in Chinese Acid Rice Soup (Rice-Acid) Fermented With a Lacticaseibacillus paracasei and Kluyveromyces marxianus
Liu, Frontiers in microbiology 2021 - “...dehydrogenase/alcohol dehydrogenase 2.07 4.35 2.00 LSEI_1305 [EC:1.2.4.1] K00161 pyruvate dehydrogenase E1 component alpha subunit 1.82 LSEI_1306 [EC:1.2.4.1] K00162 pyruvate dehydrogenase E1 component beta subunit 1.83 1.60 LSEI_1307 [EC:2.3.1.12] K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) 1.95 1.96 LSEI_1308 [EC:1.8.1.4] K00382 dihydrolipoamide dehydrogenase 1.54 1.80 LSEI_1310 [EC:1.1.1.27]...”
- “...1.71 LSEI_1305 [EC:1.2.4.1] Energy production and conversion K00161 pyruvate dehydrogenase E1 component alpha subunit 1.83 LSEI_1306 [EC:1.2.4.1] K00162 pyruvate dehydrogenase E1 component beta subunit 1.83 1.60 LSEI_1307 [EC:2.3.1.12] K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) 1.95 1.96 LSEI_1308 [EC:1.8.1.4] K00382 dihydrolipoamide dehydrogenase 1.54 1.80 LSEI_1315 [EC:6.4.1.1]...”
TGME49_314400 pyruvate dehydrogenase E1 component, beta subunit, putative from Toxoplasma gondii ME49
46% identity, 76% coverage
- Dual transcriptional profiling of mice and Toxoplasma gondii during acute and chronic infection
Pittman, BMC genomics 2014 - “...TGME49_222170 dense-granule antigen DG32 8 TGME49_293430 hypothetical protein 8 TGME49_262730 rhoptry protein ROP16 (ROP16) 8 TGME49_314400 pyruvate dehydrogenase E1 component 8 TGME49_315320 SAG-related sequence SRS52A (SRS52A) 7 TGME49_200360 hypothetical protein 7 TGME49_285870 SAG-related sequence SRS20A (SRS20A) 7 TGME49_269950 hypothetical protein 7 TGME49_247280 hypothetical protein 7 TGME49_294800...”
Q69LD2 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) from Oryza sativa subsp. japonica
46% identity, 88% coverage
ODBB2_ARATH / Q9LDY2 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; Protein DARK INDUCIBLE 4; EC 1.2.4.4 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
AT3G13450 DIN4 (DARK INDUCIBLE 4); 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)/ catalytic from Arabidopsis thaliana
46% identity, 91% coverage
- function: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). Required during sugar starvation and acts under the control of a sugar-sensing mechanism involving Ser/Thr kinases and phosphatases (PubMed:11080291, PubMed:11917081).
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] + 3-methyl-2-oxobutanoate + H(+) = N(6)- [(R)-S(8)-2-methylpropanoyldihydrolipoyl]-L-lysyl- [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + CO2 (RHEA:13457)
cofactor: thiamine diphosphate
subunit: Heterotetramer of alpha and beta chains. - Identification of Small RNAs During High Light Acclimation in Arabidopsis thaliana
Tiwari, Frontiers in plant science 2021 - “...-value 3 h Ath-miR169i 1.22 AT5G42120 Lectin receptor kinase S.6 -1.59 0.00 0.00 Ath-miR864-3p 1.87 AT3G13450 Dark inducible 4 -1.22 0.00 0.00 Ath-miR172b-3p 1.32 AT3G47360 Hydroxysteroid dehydrogenase 3 -1.05 0.01 0.04 6 h Ath-miR163 1.58 AT1G15125 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein -1.12 0.01 0.04 Ath-miR156d-5p 1.29 AT2G33810...”
- HSFA2 Functions in the Physiological Adaptation of Undifferentiated Plant Cells to Spaceflight
Zupanska, International journal of molecular sciences 2019 - “...X BP cellular response to sucrose starvation GO:0043617 AT3G06850 DIN3 2-oxoacid dehydrogenases acyltransferases X 1.2 AT3G13450 DIN4 branched chain alpha-keto acid dehydrogenase E1 beta X 1.3 AT1G21400 E1 Thiamin diphosphate-binding fold (THDP-binding) X 1.6 Valine, leucine and isoleucine degradation GO:0009083 AT3G06850 DIN3 2-oxoacid dehydrogenases acyltransferase family...”
- In vivo evidence for a regulatory role of phosphorylation of Arabidopsis Rubisco activase at the Thr78 site
Kim, Proceedings of the National Academy of Sciences of the United States of America 2019 (secret) - Low CO2 induces urea cycle intermediate accumulation in Arabidopsis thaliana
Blume, PloS one 2019 - “...GCAGGACATCTTGATGCGACTACTC CCTTTTGAGACGCAAACTCCAACTAG ASSY AT4G24830 GGAAAAGGAAATGACCAGGTTCGG TCAATAGCATCTTCTCGGCCTTGG CARA AT3G27740 TGCACGAAGACACTTGCTGA CTGTGCTCAACACCCCGATA CLPD AT5G51070 CCGTCCAGAGTTGTTGAACCG CCACGAGCCTCGACTTCAAGTC DIN4 AT3G13450 GACACTCCTTTCCCTCTAGTGTTCG ATTCACAGTGGATCTGATTGCATCC dOAT AT5G46180 TGTCCCCGGTTTCAGCTTAC AGCCTCAGATCCATCTCGGA IMD AT5G14200/AT1G31180 CGATGCTTCTCAAGTATGGACTTGG CCATTTCCTTGCATCCCACCAG NAGS2 AT4G37670 GAAGGAACCCGTGATGCCAGAG GCTCGCAGTAACTCCTCATCAGTTC OTC AT1G75330 CAAAGGCAAAGCAAGCTGGA CGGCTTCATCCTTTTGACCC P5CDH AT5G62530 GATAGGGACACCAGAGGCTATA GTAGATGGAGGAAGTTCCCAAC P5CS1 AT2G39800 GGTTGAGACTTGAGGAGAGACAC CCACTACATAAGCGAGGGTTTCAA PII AT4G01900 CCATCTTGCCTCGATTTGGTCAC CAGTAAAGCCGATGAAACTTGCTGG...”
- Primed primary metabolism in systemic leaves: a functional systems analysis
Schwachtje, Scientific reports 2018 - “...1 AT4G35770 SEN1 2.4 2.2 rhodanese/cell cycle control phosphatase superfamily protein induced by sugar starvation AT3G13450 BCKDH E1 0.5 0.6 transketolase family protein AT1G03090 MCCA sub1 0.9 0.7 methylcrotonyl-CoA carboxylase alpha chain AT2G42540 COR15A 2.4 2.1 1.7 cold-regulated 15a cold acclimation AT2G42530 COR15B 1.7 1.5 1.6...”
- “...(Table 2 ). Moreover, senescence- and sugar starvation-associated genes, such as SEN1 (At4g35770), BCKDH E1 (At3g13450), MCCA sub1 (At1g03090) and ASN1 (At3g47340) were significantly downregulated during day 3 and 4 (Table 2 ). Priming induces persistent medium-term metabolic re-organization in systemic leaves Defense responses do not...”
- Activation of senescence-associated Dark-inducible (DIN) genes during infection contributes to enhanced susceptibility to plant viruses
Fernández-Calvino, Molecular plant pathology 2016 (secret) - The Brassicaceae-specific EWR1 gene provides resistance to vascular wilt pathogens
Yadeta, PloS one 2014 - “...binding protein SALK_020621 Similar Similar At3g13445 TATA binding protein SALK_084279C Induced in A2 mutant Similar At3g13450 Alpha-keto acid dehydrogenase E1 SALK_042796C Similar Similar At3g13460 ECT2 like (Physically interacts with CIPK1) SALK_002225C Similar Similar 1 Gene expression in mutant A2 relative to the expression in wild-type. 2...”
- From dusk till dawn: the Arabidopsis thaliana sugar starving responsive network
Arias, Frontiers in plant science 2014 - “...Asparagine synthetase Hanson et al., 2008 At3g45300 IVD Isovaleryl-CoA-dehydrogenase Binder et al., 2007 BCAA degradation At3g13450 BCKDH E1 BC -keto acid dehydrogenase Binder et al., 2007 At3g06850 BCKDH E2 BC -keto acid dehydrogenase Binder et al., 2007 At1g03090 MCCA sub1 3-methylcrotonyl-CoA carboxylase Binder et al., 2007...”
- More
SSU1636 pyruvate dehydrogenase E1 component, beta subunit from Streptococcus suis P1/7
SSU05_1840 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit from Streptococcus suis 05ZYH33
48% identity, 96% coverage
LLKF_0037 pyruvate dehydrogenase E1 component subunit beta from Lactococcus lactis subsp. lactis KF147
L0034 PDH E1 component beta subunit (EC 1.2.4.1) from Lactococcus lactis subsp. lactis Il1403
46% identity, 100% coverage
MHJ_0112 pyruvate dehydrogenase from Mycoplasma hyopneumoniae J
Q4AAL7 Pyruvate dehydrogenase from Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
mhp264 pyruvate dehydrogenase (lipoamide) e1-beta chain from Mycoplasma hyopneumoniae 232
MHP7448_0116 pyruvate dehydrogenase from Mycoplasma hyopneumoniae 7448
46% identity, 97% coverage
- Pathogenicity & virulence of Mycoplasma hyopneumoniae
Leal, Virulence 2020 - “...prolipoprotein P65 mhp677 MHP7448_0656 MHJ_0656 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase mhp264 MHP7448_0116 MHJ_0112 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase E1-alpha subunit mhp265 MHP7448_0115 MHJ_0111 Fibronectin, heparin Y [ 78 ] Uncharacterized protein mhp009 MHP7448_0009 MHJ_0009 Heparin Y [ 78 ] Uncharacterized...”
- N-terminomics identifies widespread endoproteolysis and novel methionine excision in a genome-reduced bacterial pathogen
Berry, Scientific reports 2017 - “...2 MHJ_0349 HIT-like protein 1 MHJ_0242 Enolase 6 MHJ_0157 Phosphopentomutase 1 MHJ_0122 Pyruvate kinase 5 MHJ_0112 Pyruvate dehydrogenase 13 MHJ_0111 Pyruvate dehydrogenase E1-alpha subunit 12 MHJ_0107 ATP-dependent 6-phosphofructokinase 1 MHJ_0031 Glyceraldehyde-3-phosphate dehydrogenase 4 MHJ_0145 Trigger factor 3 MHJ_0631 Putative 5-nucleotidase 1 MHJ_0071 Adenine phosphoribosyltransferase 4 MHJ_0436...”
- Post-translational processing targets functionally diverse proteins in Mycoplasma hyopneumoniae
Tacchi, Open biology 2016 (no snippet) - Pathogenicity & virulence of Mycoplasma hyopneumoniae
Leal, Virulence 2020 - “...] Putative prolipoprotein P65 mhp677 MHP7448_0656 MHJ_0656 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase mhp264 MHP7448_0116 MHJ_0112 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase E1-alpha subunit mhp265 MHP7448_0115 MHJ_0111 Fibronectin, heparin Y [ 78 ] Uncharacterized protein mhp009 MHP7448_0009 MHJ_0009 Heparin Y [ 78...”
- Pathogenicity & virulence of Mycoplasma hyopneumoniae
Leal, Virulence 2020 - “...Putative prolipoprotein P65 mhp677 MHP7448_0656 MHJ_0656 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase mhp264 MHP7448_0116 MHJ_0112 Fibronectin, heparin Y [ 78 ] Pyruvate dehydrogenase E1-alpha subunit mhp265 MHP7448_0115 MHJ_0111 Fibronectin, heparin Y [ 78 ] Uncharacterized protein mhp009 MHP7448_0009 MHJ_0009 Heparin Y [ 78 ]...”
- Comparative proteomics of two Mycoplasma hyopneumoniae strains and Mycoplasma flocculare identified potential porcine enzootic pneumonia determinants
Paes, Virulence 2018 - “...- [ 76 ] MHP7448_0005 Putative MgpA-like protein 2.84 - - - [ 10 ] MHP7448_0116 Pyruvate dehydrogenase - 16.00 - 4.35 [ 41 ] MHP7448_0115 Pyruvate dehydrogenase E1-alpha subunit - 2.61 - 12.91 [ 41 ] MHP7448_0037 Ribonuclease R 3.60 3.03 - - [ 10...”
- “...namely lactate dehydrogenase (LDH, MHP7448_0137), and pyruvate dehydrogenase (represented by three of its four subunits: MHP7448_0116, MHP7448_0115, and MHP7448_0507), a chaperone DnaJ (MHP7448_0068), and three translation elongation factors (MHP7448_0075, MHP7448_0056 and MHP7448_0523) were from 2.6 to ~63 times more abundant in M. hyopneumoniae 7448. Overall, these...”
SGO_RS05565 alpha-ketoacid dehydrogenase subunit beta from Streptococcus gordonii str. Challis substr. CH1
SGO_1132 acetoin dehydrogenase from Streptococcus gordonii str. Challis substr. CH1
49% identity, 97% coverage
- Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
Liu, Frontiers in cellular and infection microbiology 2021 - “...acoA (SGO_RS05570, thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha), sucB (SGO_RS05560, dihydrolipoamide acetyltransferase), and SGO_1132 (SGO_RS05565, alpha-ketoacid dehydrogenase subunit beta). Genes sucB and SGO_1132 potentially interacted with fabH (SGO_RS08325, ketoacyl-ACP synthase III) from the green cluster. All but one of the genes in the green cluster...”
- “...changes of at least 2.0 following coaggregation. A gene that encodes alpha-ketoacid dehydrogenase subunit beta (SGO_RS05565) was also significantly up-regulated, suggesting that the TCA cycle activity was enhanced ( Table S2 ). Since pyruvate was mostly converted to primary products for the TCA cycle, less pyruvate...”
- Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
Liu, Frontiers in cellular and infection microbiology 2021 - “...dehydrogenase), acoA (SGO_RS05570, thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha), sucB (SGO_RS05560, dihydrolipoamide acetyltransferase), and SGO_1132 (SGO_RS05565, alpha-ketoacid dehydrogenase subunit beta). Genes sucB and SGO_1132 potentially interacted with fabH (SGO_RS08325, ketoacyl-ACP synthase III) from the green cluster. All but one of the genes in the green...”
Pf6N2E2_480 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) (EC 1.2.4.4) from Pseudomonas fluorescens FW300-N2E2
43% identity, 91% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine. Automated validation from mutant phenotype: the predicted function (1.2.4.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Sca_0720 pyruvate dehydrogenase E1 component beta subunit from Staphylococcus carnosus subsp. carnosus TM300
47% identity, 91% coverage
SP_1163 acetoin dehydrogenase, E1 component, beta subunit, putative from Streptococcus pneumoniae TIGR4
49% identity, 97% coverage
- Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
Ayoola, Frontiers in microbiology 2019 - “...N -acetylglucosamine-6-phosphate deacetylase 2.9 nagB SP_1415 Glucosamine-6-phosphate deaminase 3.9 pyrR SP_1278 Bifunctional protein PyrR 1.9 SP_1163 SP_1163 Putative acetoin dehydrogenase, beta subunit 1.5 SP_1164 SP_1164 Putative acetoin dehydrogenase, alpha subunit 1.4 TABLE 2 Differentially expressed genes in cadA involved in PG and choline binding protein synthesis,...”
- “...required to form UDP-sugars. There was also lower expression of the pyruvate dehydrogenase complex ( SP_1163 and SP_1164 ) responsible for the production of acetyl-CoA that is needed for the acetylation of sugars in the repeat unit of TIGR4. Impaired Polyamine Synthesis Regulates the Expression of...”
- Pyruvate Oxidase as a Critical Link between Metabolism and Capsule Biosynthesis in Streptococcus pneumoniae
Echlin, PLoS pathogens 2016 - “.... Bacterial Constructs The spxB (Sp_0730), lctO (Sp_0715), and pdhc (E1 alpha and beta subunits; Sp_1163 and Sp_1164) mutants were created via splicing by overhang extension PCR (SOE-PCR) [ 57 ]. Briefly, 1-kb upstream and downstream fragments of the target gene were amplified and spliced to...”
tll0204 pyruvate dehydrogenase E1 component beta subunit from Thermosynechococcus elongatus BP-1
47% identity, 98% coverage
Pfl01_3464 branched-chain alpha-keto acid dehydrogenase E1 component from Pseudomonas fluorescens Pf0-1
43% identity, 91% coverage
SYNPCC7002_A0655 pyruvate dehydrogenase E1 beta chain from Synechococcus sp. PCC 7002
46% identity, 97% coverage
AO356_22985 branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4) from Pseudomonas fluorescens FW300-N2C3
43% identity, 91% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine.
llmg_0073 pyruvate dehydrogenase E1 component beta subunit from Lactococcus lactis subsp. cremoris MG1363
45% identity, 100% coverage
PflSS101_3348 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas lactis
43% identity, 91% coverage
- Lipopeptide biosynthesis in Pseudomonas fluorescens is regulated by the protease complex ClpAP
Song, BMC microbiology 2015 - “...PflSS101_2196 AP endonuclease, family 2 1.65 2.12 PflSS101_3195 cold shock domain protein CspD 2.14 3.15 PflSS101_3348 bkdA2 2-oxoisovalerate dehydrogenase E1 component, beta subunit 1.26 1.23 PflSS101_3776 flagellin domain protein 1.21 2.14 PflSS101_3786 phhA phenylalanine-4-hydroxylase 1.24 1.81 PflSS101_3936 transcriptional regulator, GntR family 1.25 1.35 PflSS101_4181 conserved hypothetical...”
PS417_17550 branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4) from Pseudomonas simiae WCS417
43% identity, 91% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine; L-Leucine.
Riean_0589 pyruvate dehydrogenase complex E1 component subunit beta from Riemerella anatipestifer ATCC 11845 = DSM 15868
43% identity, 99% coverage
AT1G55510 BCDH BETA1 (BRANCHED-CHAIN ALPHA-KETO ACID DECARBOXYLASE E1 BETA SUBUNIT); 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)/ catalytic from Arabidopsis thaliana
44% identity, 92% coverage
- Transcript and metabolite changes during the early phase of abscisic acid-mediated induction of crassulacean acid metabolism in Talinum triangulare
Maleckova, Journal of experimental botany 2019 - “...7 Amino acid metabolism KMT00186 AT1G29900 CARB 1.06 5 KMT12470 AT1G64660 MGL 2.67 5 KMT14300 AT1G55510 BCDH BETA1 1.50 6 KMT10213 AT1G03090 MCCA 1.57 6 KMT12470 AT1G64660 MGL 2.67 5 KMS98028 AT1G08630 THA1 1.49 5 Solute transport KMT02985 AT2G26900 BASS2 1.05 6 KMT13799 AT1G08960 CAX11 1.02...”
- A Conserved Carbon Starvation Response Underlies Bud Dormancy in Woody and Herbaceous Species
Tarancón, Frontiers in plant science 2017 - “...superfamily protein III At5g18630 /-Hydrolases superfamily protein IV At3g60340 /-Hydrolases superfamily protein IV Aminoacid degradation At1g55510 2-OXOISOVALERATE DEHYDROGENASE 1 IV At4g33150 -AMINOADIPIC SEMIALDEHYDE SYNTHASE II-III At5g53970 AMINOTRANSFERASE TAT2 II At5g54080 HOMOGENTISATE 1,2-DlOXYGENASE II-III-IV At3g45300 ISOVALERYL-COA DEHYDROGENASE II-III-IV At1g64660 METHIONINE GAMMA-LYASE II-III At4g34030 METHYLCROTONOYL-COA CARBOXYLASE IV At1g03090...”
- Utility and Limitations of Using Gene Expression Data to Identify Functional Associations
Uygun, PLoS computational biology 2016 - “...S4 Table ) that are over-represented with 12 annotated leucine degradation genes. Among these genes, AT1G55510, a branched-chain alpha-keto acid decarboxylase E1 beta subunit, was recently shown to be involved in leucine degradation [ 82 ] but has not yet been annotated as such. The fact...”
- Respiratory electron transfer pathways in plant mitochondria
Schertl, Frontiers in plant science 2014 - “...NADH At1g55510: 150 kDa/39 kDa Fujiki et al., 2000 At1g21400 (E1) Mooney et al., 2000 At1g55510 (E1) (0.95 MDa complex) Fujiki et al., 2001 At3g13450 (E1) Fujiki et al., 2002 At3g06850 (E2) Taylor et al., 2004 At3g13930 (E3) Binder, 2010 At3g17240 (E3) At1g48030 (E3) Formate dehydrogenase...”
- Articulation of three core metabolic processes in Arabidopsis: fatty acid biosynthesis, leucine catabolism and starch metabolism
Mentzen, BMC plant biology 2008 - “...BCDH_E1a2 0.72 At1g18270 ketose-bisphosphate aldolase class-II family protein 0.71 At5g49450* bZIP family transcription factor 0.71 At1g55510 BCDH BETA1, E1 beta subunit of branched-chain alpha-keto acid dehydrogenase 0.7 At3g49790 expressed protein Hub Gene: DE2, At2g40840, disproportionating enzyme, starch metabolism Corr. GeneID Description 0.89 At3g46970 PHS2, starch phosphorylase...”
BCAL1213 2-oxoisovalerate dehydrogenase beta subunit from Burkholderia cenocepacia J2315
42% identity, 97% coverage
- Transcriptional responses of Burkholderia cenocepacia to polymyxin B in isogenic strains with diverse polymyxin B resistance phenotypes
Loutet, BMC genomics 2011 - “...Genes differentially regulated in RSF34 4000B compared to RSF34 BCAL1083 (Exported alkaline phosphatase) -16.7 -3.2 BCAL1213 (2-oxoisovalerate dehydrogenase subunit) 29.9 19.7 BCAL1270 (Phosphate transport, periplasmic) -23.5 -17.9 BCAM0537 (Serine peptidase) -28.2 -4.1 BCAM0855 (UDP-glucose dehydrogenase) -5.0 -4.2 BCAM2195 (AMP-binding enzyme) 22.8 4.9 BCAM2453 (Redoxin) -22.5 -1.9...”
- “...encodes a predicted exported alkaline phosphatase. qRT-PCR analysis of representative genes from these clusters ( BCAL1213 , BCAL2195 , BCAL1270 , and BCAL1083 ) confirmed these patterns of expression (Table 3 ). These genes are of interest because their changes in expression could contribute to the...”
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...ACID TRANSPORT AND METABOLISM BCAL0446 Putative aminotransferase 2.9 BCAL1212 bkdA1, 2-oxoisovalerate dehydrogenase alpha subunit 3.0 BCAL1213 bkdA2, 2-oxoisovalerate dehydrogenase beta subunit 2.9 BCAL1214 bhdB, lipoamide acyltransferase 3.7 BCAL1215 lpdV, dihydrolipoamide dehydrogenase 2.2 BCAL1749 Putative CoA-transferase 2.4 BCAL1750 Conserved hypothetical protein, pyruvate decarboxylase 2.4 BCAL1751 Glyoxalase/bleomycin resistance,...”
- “...BCAL1103 Putative OsmB-like lipoprotein 2.13 BCAL1121 Hypothetical protein 1.65 BCAL1212 2-Oxoisovalerate dehydrogenase alpha subunit 3.02 BCAL1213 2-Oxoisovalerate dehydrogenase beta subunit 2.91 BCAL1214 Lipoamide acyltransferase component of 3.68 BCAL1215 Dihydrolipoamide dehydrogenase 2.22 BCAL1226 Major facilitator superfamily protein 1.52 BCAL1279 Putative exported protein 1.64 BCAL1468 Putative electron transport...”
PfGW456L13_3541 branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4) from Pseudomonas fluorescens GW456-L13
43% identity, 91% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine.
PP4402 2-oxoisovalerate dehydrogenase, beta subunit from Pseudomonas putida KT2440
42% identity, 96% coverage
all0122 pyruvate dehydrogenase E1 beta subunit from Nostoc sp. PCC 7120
45% identity, 99% coverage
ECH_0149 putative pyruvate dehydrogenase complex, E1 component, beta subunit from Ehrlichia chaffeensis str. Arkansas
45% identity, 98% coverage
- Molecular characterization of Ehrlichia interactions with tick cells and macrophages
Ganta, Frontiers in bioscience (Landmark edition) 2009 - “...VirB11 ECH_0041 36,698 M 36 Octaprenyl-diphosphate synthase ECH_0088 36,312 M 37 Putative dehydrogenase subunit beta ECH_0149 36,281 M 38 Prolipoprotein diacylglyceryl transferase ECH_1101 32,539 M T 39 Hypothetical protein ECH_0895 ECH_0895 31,573 T 40 p28-omp 14 (Omp-1B) ECH_1136 30,886 M T 41 p28-omp 19 (Omp-p28) ECH_1143...”
- Total, membrane, and immunogenic proteomes of macrophage- and tick cell-derived Ehrlichia chaffeensis evaluated by liquid chromatography-tandem mass spectrometry and MALDI-TOF methods
Seo, Infection and immunity 2008 - “...subunit D ECH_0726 ECH_0988 ECH_0326 ECH_0900 ECH_0041 ECH_0149 ECH_0798 ECH_0042 ECH_0088 ECH_0016 ECH_0617 ECH_0407 ECH_1101 ECH_0160 83,000 85,000 85,000...”
XAC0445 pyruvate dehydrogenase E1 beta subunit from Xanthomonas axonopodis pv. citri str. 306
46% identity, 94% coverage
Ava_1491 Transketolase from Anabaena variabilis ATCC 29413
45% identity, 99% coverage
- Computational prediction of cAMP receptor protein (CRP) binding sites in cyanobacterial genomes
Xu, BMC genomics 2009 - “...AM1_3534 AM1_4901 AM1_2335 AM1_5208 AM1_5107 AM1_2792 AM1_5169 AM1_3844 AM1_4185 AM1_5140 AM1_0632 ATCC29413 Ava_4451 Ava_3710 Ava_0640 Ava_1491 Ava_4669 Ava_0687 Ava_4995 Ava_1172 Ava_0874 Ava_4457 Ava_0873 Ava_0613 Ava_4753 Ava_1559 Ava_3542 Ava_1149 Ava_3207 Ava_3867 Ava_4503 Ava_3009 Ava_3703 Ava_1629 Ava_2629 Ava_1558 Ava_1021 A-prime CYA_0295 CYA_2315 B-prime CYB_2824 CYB_0465 CYB_2795 PCC7120 asr0847...”
Q4KDP3 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
43% identity, 91% coverage
E5E91_05090 alpha-ketoacid dehydrogenase subunit beta from Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539
48% identity, 95% coverage
- Structural Differences between the Genomes of Deinococcus radiodurans Strains from Different Laboratories
Zahradka, Genes 2024 - “...hypothetical protein, [iii] 1734..2879, pdhA, E5E91_05085, pyruvate dehydrogenase (acetyl-transferring) E1 component subunit , [iv] 3132..4157, E5E91_05090, -ketoacid dehydrogenase subunit , [v] 4404..5663, E5E91..05095, Glu/Leu/Phe/Val dehydrogenase, [vi] 5728..>6065, E5E91_05100, Glu/Leu/Phe/Val dehydrogenase 24 genome-1999 Chromosome I 1960529 526 bp [i]complement(<1..>24), DR_1939, putative; polyphosphate kinase, authentic frameshift 917 genome-1999...”
bkdA2 / GI|790516 2-oxoisovalerate dehydrogenase subunit beta; EC 1.2.4.4 from Pseudomonas putida (see 2 papers)
P09061 2-oxoisovalerate dehydrogenase subunit beta from Pseudomonas putida
42% identity, 96% coverage
SSA_1176 Acetoin dehydrogenase, E1 component, beta subunit, putative from Streptococcus sanguinis SK36
49% identity, 96% coverage
Synpcc7942_0143 pyruvate/2-oxoglutarate dehydrogenase complex dehydrogenase (E1) component from Synechococcus elongatus PCC 7942
47% identity, 97% coverage
1qs0B / P09061 Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
42% identity, 96% coverage
- Ligand: 2-oxo-4-methylpentanoic acid (1qs0B)
BPSS2272 2-oxoisovalerate dehydrogenase beta subunit from Burkholderia pseudomallei K96243
42% identity, 94% coverage
PVLB_17455 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas sp. VLB120
42% identity, 91% coverage
Npun_F3849 transketolase, central region from Nostoc punctiforme
44% identity, 99% coverage
BV82_0840 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas donghuensis
43% identity, 91% coverage
Pput_1452 transketolase, central region from Pseudomonas putida F1
PP_4402 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas putida KT2440
42% identity, 91% coverage
Mfl040 pyruvate dehydrogenase E1 beta subunit from Mesoplasma florum L1
41% identity, 99% coverage
- Genome-scale metabolic modeling reveals key features of a minimal gene set
Lachance, Molecular systems biology 2021 - “...in the protein expression levels compared with genes of the pyruvate dehydrogenase complex (PDH: Mfl039, Mfl040, Mfl041, and Mfl042). We thus used an 8:1 initial ratio (lactate:acetate) for further phenotypic phase plane analysis (Materials and Methods). For lactate production, this analysis revealed a positive linear relationship...”
PP0554 acetoin dehydrogenase, beta subunit from Pseudomonas putida KT2440
PP_0554 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas putida KT2440
42% identity, 95% coverage
- UEG Week 2024 Poster Presentations
, United European gastroenterology journal 2024 - UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023 - Dehydrogenation Mechanism of Three Stereoisomers of Butane-2,3-Diol in Pseudomonas putida KT2440
Liu, Frontiers in bioengineering and biotechnology 2021 - “...P. aeruginosa PAO1 ( Liu et al., 2018 ). Comparative genomics analysis indicated that PP0555, PP0554, and PP0553 exhibit strikingly high homology to AcoA, AcoB, and AcoC in AC dehydrogenase enzyme system (AoDH ES) of P. aeruginosa PAO1. R , R -BDH and (2 S ,3...”
- “...MSM supplemented with 2gL 1 mixed 2,3-BDO as the sole carbon source. Since pp0555 , pp0554 , pp0553 and pp0552 were located adjacent to acoX ( pp0556 ) and acoR ( pp0557 ) gene homologues of AC utilization operons in other bacteria, we hypothesized that these...”
- Integrated analysis of gene expression and metabolic fluxes in PHA-producing Pseudomonas putida grown on glycerol
Beckers, Microbial cell factories 2016 - “...1.24 0.29 1.65 0.98 Pyruvate metabolism acoA PP0555 Pyruvate dehydrogenase 1.16 1.86 1.03 0.33 acoB PP0554 Pyruvate dehydrogenase 1.5 1.88 1.04 0.66 acoC PP0553 Pyruvate dehydrogenase 1.57 1.81 0.96 0.72 PP0545 Aldehyde dehydrogenase 0.2 0.11 0.91 1.01 acsA PP4487 Acetyl-CoA synthetase 0.13 0.23 0.15 3.56 accC...”
- “...pathway and increased flux through the pyruvate node, associated with significant upregulation of pyruvate metabolism (PP0554, acoA ) (Fig. 2 a, b; Table 5 ). Also, catabolism and anabolism appear to be tightly coupled as no by-product (citrate, succinate, or malate) formation is found (Table 2...”
- Production of medium chain length polyhydroxyalkanoate in metabolic flux optimized Pseudomonas putida
Borrero-de, Microbial cell factories 2014 - “...eda PP1024 KDPG aldolase 0.0 -0.5 Pyruvate metabolism acoA PP0555 Pyruvate dehydrogenase 12.4 5.3 acoB PP0554 Pyruvate dehydrogenase 1.5 1.0 acoC PP0553 Pyruvate dehydrogenase 0.7 0.7 PP0545 Aldehyde dehydrogenase 0.1 -1.0 acsA PP4487 Acetyl-CoA synthetase 0.8 1.4 accC-2 PP5347 Pyruvate carboxylase 0.5 0.2 ppsA PP2082 Phosphoenolpyruvate...”
- “...eda PP1024 KDPG aldolase 0.4 -0.2 Pyruvate metabolism acoA PP0555 Pyruvate dehydrogenase 1.3 -2.7 acoB PP0554 Pyruvate dehydrogenase 0.7 -0.8 acoC PP0553 Pyruvate dehydrogenase 0.5 -1.2 PP0545 Aldehyde dehydrogenase 0.5 -0.9 acsA PP4487 Acetyl-CoA synthetase -0.3 -0.6 accC-2 PP5347 Pyruvate carboxylase 0.8 2.3 ppsA PP2082 Phosphoenolpyruvate...”
- The metabolic response of P. putida KT2442 producing high levels of polyhydroxyalkanoate under single- and multiple-nutrient-limited growth: highlights from a multi-level omics approach
Poblete-Castro, Microbial cell factories 2012 - “...3.1 1.3 PP0555 Acetoin dehydrogenase alpha subunit -6.7 -8.3 PP0556 Acetoin catabolism protein -3.7 -4.6 PP0554 Acetoin dehydrogenase beta subunit -4.6 -4.2 PP0553 Acetoin dehydrogenase dihydrolipoamide -5.3 -4.0 PP0557 Acetoin catabolism regulatory protein -3.4 -3.6 PP2149 Glyceraldehyde 3-phospate dehydrogenase 1.5 -3.7 PP4715 Triosephosphate isomerase 1.9 -3.3...”
- “...28 -1.4 n.s. Acetoin dehydrogenase -sub PP0555 AcoA -4.0 7 -8.3 0 Acetoin dehydrogenase -sub PP0554 AcoB -5.6 23 -4.2 0 Acetoin dehydrogenase PP0553 AcoC -3.7 10 -4.0 0 Nitrogen metabolism Nitrogen regulatory protein P-II PP5234 GlnK only in CN 6 10.4 0 Protein synthesis Elongation...”
- Light Response of Pseudomonas putida KT2440 Mediated by Class II LitR, a Photosensor Homolog
Sumi, Journal of bacteriology 2020 (secret) - The Cellular Response to Lanthanum Is Substrate Specific and Reveals a Novel Route for Glycerol Metabolism in Pseudomonas putida KT2440
Wehrmann, mBio 2020 - “...GarK Glycerate kinase 1.77 2.85 PP_3621 IorA-II Isoquinoline 1-oxidoreductase subunit alpha (2Fe-2S clusters) 1.60 2.34 PP_0554 AcoB Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta 1.54 2.27 PP_3623 AdhB Alcohol dehydrogenase cytochrome c subunit 1.54 3.67 PP_2484 Transcriptional regulator, ArsR family 1.52 2.37 PP_0734 HemK Release factor-(glutamine-N5) methyltransferase 1.51 2.67...”
- Production of medium chain length polyhydroxyalkanoate in metabolic flux optimized Pseudomonas putida
Borrero-de, Microbial cell factories 2014 - “...up-regulated gene in both variant strains overexpressing acoA was PP_0555 ( acoA ). Interestingly, also PP_0554 ( acoB ) was found upregulated, however to a lesser extent (Table 4 ). Most of the genes encoding for enzymes related to the central and PHA synthesis metabolic pathways...”
- “...Furthermore, expression differences were detected for the pyruvate metabolism, where the genes encoding pyruvate dehydrogenase (PP_0554), pyruvate carboxylase (PP_5347) and phosphoenoylpyruvate (PP_1505) showed differential expression levels (Table 5 ). At least for the wild type strain harboring the overexpressed pgl a problematic rearrangement of pyruvate metabolization...”
- Transcriptome dynamics of Pseudomonas putida KT2440 under water stress
Gülez, Applied and environmental microbiology 2012 - “...PP_0103 PP_0104 PP_0105 PP_0106 PP_0490 PP_0552 PP_0553 PP_0554 PP_0555 PP_0556 PP_0557 PP_0596 PP_0989 PP_0999 PP_1000 PP_1001 PP_1157 PP_2351 PP_2422 PP_2674...”
Slin_5165 Transketolase central region from Spirosoma linguale DSM 74
44% identity, 96% coverage
- Morphological change of coiled bacterium Spirosoma linguale with acquisition of β-lactam resistance
Maeda, Scientific reports 2021 - “...encoding glutamyl-tRNA amidotransferase B subunit, whereas the small, horseshoe-shaped clones commonly had mutations in either Slin_5165 or Slin_5509 encoding pyruvate dehydrogenase (PDH) components. Two clones, CFP1ESL11 and CFL5ESL4, which carried only one mutation in Slin_5958, showed almost perfectly straight, rod-shaped cells in the presence of amoxicillin....”
- “...in genes encoding the pyruvate dehydrogenase (PDH) E1 componentthat is, Slin_5509 encoding the subunit or Slin_5165 encoding the transketolase central region. Among the four strains, the CFP5ESL9 strain carried only one frameshift mutation in Slin_5509. This result suggests that inactivation of pyruvate dehydrogenase results in decreased...”
O34591 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta from Bacillus subtilis (strain 168)
44% identity, 94% coverage
BC2778 Acetoin dehydrogenase E1 component beta-subunit from Bacillus cereus ATCC 14579
43% identity, 94% coverage
GBAA2775 TPP-dependent acetoin dehydrogenase E1 beta-subunit from Bacillus anthracis str. 'Ames Ancestor'
43% identity, 94% coverage
P73405 pyruvate dehydrogenase system (subunit 1/2) (EC 1.2.1.104); pyruvate dehydrogenase (acetyl-transferring) (subunit 1/2) (EC 1.2.4.1) from Synechocystis sp. PCC 6803 (see 2 papers)
sll1721 pyruvate dehydrogenase E1 beta subunit from Synechocystis sp. PCC 6803
46% identity, 96% coverage
- Sustainable production of photosynthetic isobutanol and 3-methyl-1-butanol in the cyanobacterium Synechocystis sp. PCC 6803
Xie, Biotechnology for biofuels and bioproducts 2023 - “...S286T -T)-Km R This study HX80 ddh ::(P trc BCD- kivd S286T -T)-Cm R , sll1721 ::(P trc BCD- kivd S286T -T)-Sp R , slr0168 ::(P trc BCD- kivd S286T -T)-Em R , pEEK2-(P trc BCD- kivd S286T -T)-Km R This study HX81 ddh ::(P trc...”
- “...Lactococcus lactis ); PEPc (encoded by sll0920 ), phosphoenolpyruvate carboxylase; PDH (encoded by slr1934 and sll1721 ), pyruvate dehydrogenase E1 component; Ddh (encoded by slr1556 ), D-lactate dehydrogenase; LeuA (encoded by slr0186 and sll1564 ), 2-isopropylmalate synthase. Abbreviations of intermediates: PEP, phosphoenolpyruvate. D The relative 3M1B...”
- Expressing 2-keto acid pathway enzymes significantly increases photosynthetic isobutanol production
Xie, Microbial cell factories 2022 - “...S286T -T)-Km R This study HX46 ddh ::(P trc BCD- kivd S286T -T)-Cm R , sll1721 ::(P trc BCD- kivd S286T -T)-Sp R , pEEK2-(P trc BCD- kivd S286T -T)-Km R This study HX47 ddh ::(P trc BCD- kivd S286T -T)-Cm R , glgC ::(P trc...”
- “...S286T . slr0168 : encodes a hypothetical protein; sll1564 and slr0186 : encode 2-isopropylmalate synthase; sll1721 and slr1934 : encode pyruvate dehydrogenase; PEPc : encodes phosphoenolpyruvate carboxylase; glgC : encodes glucose-1-phosphate adenylyltransferase. HX16 was generated as a control strain. kivd S286T : encodes -ketoisovalerate decarboxylase (...”
- Regulatory Diversity and Functional Analysis of Two-Component Systems in Cyanobacterium Synechocystis sp. PCC 6803 by GC-MS Based Metabolomics
Shi, Frontiers in microbiology 2020 - “...be resulted from the combined effects of the down-regulated slr0721 ( me ) and up-regulated sll1721 ( pdhB ). Table 1 RT-qPCR confirmation of the metabolic changes in seven most regulated RR mutants. Mutants Responsive metabolites Metabolomic_fold change * Production gene ID Function and pathways RT-PCR_fold...”
- “...Pyruvic acid 4.83 slr0721 me , encoding a malic enzyme, involved in pyruvate metabolism 3.58 sll1721 pdhB , pyruvate dehydrogenase E1 component beta subunit 1.14 Porphine 3.49 slr0839 hemH , chlorophyll biosynthesis 15.16 sll1899 ctaB , cytochrome c oxidase folding protein 4.02 slr1030 chlI , chlorophyll...”
- Diurnal Regulation of Cellular Processes in the Cyanobacterium Synechocystis sp. Strain PCC 6803: Insights from Transcriptomic, Fluxomic, and Physiological Analyses
Saha, mBio 2016 - “...mutase ( gpm / slr1945 ), and two isoforms of pyruvate dehydrogenase ( pdh / sll1721 and slr1934 ) that were upregulated at the beginning of the light period. The second category includes just one gene, encoding fructose-1,6-bisphosphatase ( fbp / slr0952 ), that was upregulated...”
- rre37 Overexpression alters gene expression related to the tricarboxylic acid cycle and pyruvate metabolism in Synechocystis sp. PCC 6803
Iijima, TheScientificWorldJournal 2014 - “...ddh (slr1556, encoding a D-lactate dehydrogenase), pdhA (slr1934, encoding a subunit of pyruvate dehydrogenase), pdhB (sll1721, encoding a subunit of pyruvate dehydrogenase), pdhC (sll1841, encoding a subunit of pyruvate dehydrogenase), pdhD (slr1096, encoding a subunit of pyruvate dehydrogenase), pta (slr2131, encoding a phosphoacetyltransferase), ackA (sll1299, encoding...”
- Pathway alignment: application to the comparative analysis of glycolytic enzymes
Dandekar, The Biochemical journal 1999 - “...YDR148C 1231 271 0449 YFL018C 0871 3138 MT 1100 1850 slr1934 sll1721 HP 0476 0902 0823 0179 0180 0903 0180 1861 1450 0808 0345 1227 0346 1586 1449 1241 0024...”
ZMO_RS07205 pyruvate dehydrogenase complex E1 component subunit beta from Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
ZMO1605 pyruvate dehydrogenase subunit beta from Zymomonas mobilis subsp. mobilis ZM4
45% identity, 69% coverage
- Improvement of Acetaldehyde Production in Zymomonas mobilis by Engineering of Its Aerobic Metabolism
Kalnenieks, Frontiers in microbiology 2019 - “...I of bd cytochrome quinol oxidase CCTTCCCCGATCCTGTTTTTCTCT AGCCCGACGGTGCCATCAATA pdc (ZMO_RS06080) Pyruvate decarboxylase AGCTTCTTCCGGGGTGTAAATC GTGGCGCCTATGCAGAAAACCT pdh (ZMO_RS07205) Pyruvate dehydrogenase, subunit E1 CATTGGGCCCACGGAAGACGAT GTGGGTGCCGCAATGGAAGGTT Measurement of Intracellular Metabolites Cells from aerobic bioreactor experiments were sampled in exponential phase at an OD 600 of ~1. About 5 ml cells...”
- Characterization of a Dimeric Arginase From Zymomonas mobilis ZM4
Hwangbo, Frontiers in microbiology 2019 - “...an arginase (zmo0432) and two referenced genes of a pyruvate dehydrogenase E1 component beta subunit (zmo1605) and a CRISPR-associated protein Csy3 family (zmo0684) and made their expression constructs for E. coli. For the arginase activity of the purified recombinant proteins, 0.2 mg of each protein was...”
- “...of the arginase activity obtained in endpoint assays of the recombinant ZMO0423 protein, the recombinant ZMO1605 (pyruvate dehydrogenase E1 component beta subunit), and the ZMO0684 protein (CRISPR-associated protein Csy3 family). The arginase activity of each sample was calculated using the absorbance measured at 450 nm. Right:...”
- Elucidation of Zymomonas mobilis physiology and stress responses by quantitative proteomics and transcriptomics
Yang, Frontiers in microbiology 2014 - “...gnl (ZMO1649), pyruvate decarboxylase gene pdC (ZMO1360), and pyruvate dehydrogenase gene pdhA and pdhB (ZMO1606, ZMO1605) (Additional Files 13 , 14B ). Genes involved in amino acid biosynthesis, encoding ribosomal proteins and genes for nucleotide biosynthesis, as well as genes related to energy metabolism such as...”
- Systems biology analysis of Zymomonas mobilis ZM4 ethanol stress responses
Yang, PloS one 2013 - “...Cobaltochelatase 2.6 4.50E-05 0.5 2.75E-15 1 ZMO1576 putative short-chain dehydrogenase/oxidoreductase 2.5 1.80E-05 0.2 9.55E-05 1 ZMO1605 pyruvate dehydrogenase subunit beta 2.3 4.10E-06 1.0 5.62E-23 1 ZMO1741 GTP-binding protein LepA 2.0 4.90E-03 0.4 1.62E-08 1 ZMO0811 methionyl-tRNA formyltransferase 1.9 2.20E-03 0.1 1.91E-02 1 ZMO0734 3'(2'),5'-bisphosphate nucleotidase 1.9...”
APA386B_2084 alpha-ketoacid dehydrogenase subunit beta from Acetobacter pasteurianus 386B
43% identity, 95% coverage
Dshi_2159 Transketolase central region from Dinoroseobacter shibae DFL 12
44% identity, 72% coverage
PA2248 2-oxoisovalerate dehydrogenase (beta subunit) from Pseudomonas aeruginosa PAO1
PA14_35520 2-oxoisovalerate dehydrogenase, beta subunit' from Pseudomonas aeruginosa UCBPP-PA14
42% identity, 93% coverage
- RNA is a key component of extracellular DNA networks in Pseudomonas aeruginosa biofilms
Mugunthan, Nature communications 2023 - “...and higher negative log10 p-value such as PA3724 ( lasB ), PA2250 ( IpdV ), PA2248 ( bkDA-2 ) and PA2513 ( antB ), are more abundant in the extracellular biofilm matrix and are highlighted in bold in the right-hand part of the image. A higher...”
- Catabolite repression control protein antagonist, a novel player in Pseudomonas aeruginosa carbon catabolite repression control
Sonnleitner, Frontiers in microbiology 2023 - “...PA-number Fold change padj Gene name Description PA2247 2.66 3.14E-08 bkdA1 2-oxoisovalerate dehydrogenase (alpha subunit) PA2248 2.64 3.32E-07 bkdA2 2-oxoisovalerate dehydrogenase (beta subunit) PA2249 2.51 9.12E-07 bkdB Branched-chain alpha-keto acid dehydrogenase (lipoamide component) PA2250 2.78 4.13E-06 lpdV Lipoamide dehydrogenase-Val PA2338 4.24 9.03E-16 PA 2338 Probable binding...”
- The development of a new parameter for tracking post-transcriptional regulation allows the detailed map of the Pseudomonas aeruginosa Crc regulon
Corona, Scientific reports 2018 - “...2,19 1,23 1,3 Catabolism bkdA1 PA2247 2-oxoisovalerate dehydrogenase (alpha subunit) 3,61 1,96 5,58 Catabolism bkdA2 PA2248 2-oxoisovalerate dehydrogenase (beta subunit) 3,98 2,79 7,95 Catabolism bkdB PA2249 Branched-chain alpha-keto acid dehydrogenase (lipoamide component) 3,99 2,17 6,18 Catabolism lpdV PA2250 Lipoamide dehydrogenase-Val 4,12 2,35 6,69 Transport PA2252 Probable...”
- Mitochondrial targeting increases specific activity of a heterologous valine assimilation pathway in Saccharomyces cerevisiae
Solomon, Metabolic engineering communications 2016 - “...2001 ) and plasmids were maintained in E. coli XL1B. acd1 (PA0746), bkdA1 (PA2247), bkdA2 (PA2248), bkdB (PA2249), and lpdV (PA2250), encoding the acyl-CoA dehydrogenase and branched chain keto acid dehydrogenase complex, respectively, from Pseudomonas aeruginosa PA01, were PCR amplified from plasmid template (pMMA202) provided by...”
- Small Colony Variants and Single Nucleotide Variations in Pf1 Region of PB1 Phage-Resistant Pseudomonas aeruginosa
Lim, Frontiers in microbiology 2016 - “...Beta subunit of geranoyl-CoA carboxylase -2.3 2.E-02 PA2247 bkdA1 2-oxoisovalerate dehydrogenase (alpha subunit) -2.7 1.E-02 PA2248 bkdA2 2-oxoisovalerate dehydrogenase (beta subunit) -3.4 4.E-03 PA2249 bkdB Branched-chain alpha-keto acid dehydrogenase (lipoamide component) -3.4 1.E-03 PA2250 lpdV Lipoamide dehydrogenase-Val -3.0 4.E-03 PA2553 Probable acyl-CoA thiolase -5.6 3.E-03 PA2554...”
- Inhibition of Pseudomonas aeruginosa swarming motility by 1-naphthol and other bicyclic compounds bearing hydroxyl groups
Oura, Applied and environmental microbiology 2015 - “...PA1984 PA2007 PA2008 PA2009 PA2014 PA2015 PA2016 PA2247 PA2248 PA2249 PA2250 PA2321 PA2554 PA2555 PA3183 PA3194 PA3195 PA3559 PA3584 PA3723 PA3924 PA4022 PA5056...”
- Comparative systems biology analysis to study the mode of action of the isothiocyanate compound Iberin on Pseudomonas aeruginosa
Tan, Antimicrobial agents and chemotherapy 2014 - “...PA1334 PA1493 PA1999 PA2000 PA2008 PA2009 PA2197 PA2247 PA2248 PA2249 ahpF PA2277 PA2278 PA2310 PA2311 PA2312 PA2327 PA2359 PA2444 PA2445 PA2483 PA2490 PA2491...”
- The Pseudomonas aeruginosa CreBC two-component system plays a major role in the response to β-lactams, fitness, biofilm growth, and global regulation
Zamorano, Antimicrobial agents and chemotherapy 2014 - “...PA0524 PA0525 PA1431 PA1596 PA1901 PA1903 PA1905 PA2247 PA2248 PA2300 PA3126 PA3328 PA3329 PA3330 PA3331 PA3332 PA3333 PA3334 PA3874 PA3875 PA3876 PA3877 PA3392...”
- More
- Gene Expression Profiling of <i>Pseudomonas aeruginosa</i> Upon Exposure to Colistin and Tobramycin
Cianciulli, Frontiers in microbiology 2021 - “...Dihydrolipoamide dehydrogenase 104.5 6.56 bkdB PA14_35500 Branched-chain alpha-keto acid dehydrogenase subunit E2 91.67 5.51 bkdA2 PA14_35520 2-oxoisovalerate dehydrogenase subunit beta 104.31 4.84 bkdA1 PA14_35530 2-oxoisovalerate dehydrogenase subunit alpha 5.23 X gnyR PA14_38430 Regulatory gene of gnyRDBHAL cluster. GnyR 12.88 ND gnyD PA14_38440 Citronelloyl-CoA dehydrogenase. GnyD 30.42...”
CSUI_009934 branched-chain alpha-keto acid dehydrogenase e1 component beta from Cystoisospora suis
47% identity, 77% coverage
- Unravelling the sexual developmental biology of Cystoisospora suis, a model for comparative coccidian parasite studies
Cruz-Bustos, Frontiers in cellular and infection microbiology 2023 - “...enzymes related to the tricarboxylic acid cycle (TCA). Specifically, branched-chain -keto acid dehydrogenase E1 (BCKDH; CSUI_009934) in the mitochondrion and the pyruvate dehydrogenase complex (PDHC; CSUI_004282, CSUI_001749) in the apicoplast exhibited one- to threefold increased expression compared to merozoites. Additionally, increased levels of pyruvate carboxylase (CSUI_009794,...”
- “...2.157 1.864 0.868 CSUI_004282 Pyruvate dehydrogenase complex subunit pdh-e2 Pyruvate metabolism 2.519 3.515 3.358 -0.589 CSUI_009934 Branched-chain alpha-keto acid dehydrogenase e1 component beta Pyruvate metabolism 0.814 2.043 1.950 -0.467 CSUI_009794 Pyruvate carboxylase Pyruvate metabolism 1.056 2.404 1.901 0.413 CSUI_001749 Dihydrolipoamide dehydrogenase Pyruvate metabolism 1.331 2.525 1.808...”
SPRG_04186 2-oxoisovalerate dehydrogenase subunit beta from Saprolegnia parasitica CBS 223.65
47% identity, 86% coverage
- Analysis of Saprolegnia parasitica Transcriptome following Treatment with Copper Sulfate
Hu, PloS one 2016 - “...SPRG_00691, SPRG_19437, SPRG_17560, SPRG_13611, SPRG_08603, SPRG_09764, and SPRG_01617) were upregulated, while SPRG_11730, SPRG_04491, SPRG_10490, SPRG_12259, SPRG_04186, SPRG_18377, SPRG_18063, SPRG_06771, SPRG_16261, and SPRG_02541 genes were downregulated after copper sulfate treatment. These findings were consistent with the GO enrichment analysis, which indicated that copper sulfate mostly prevented the...”
PA14_19910 putative pyruvate dehydrogenase E1 component, beta subunit from Pseudomonas aeruginosa UCBPP-PA14
44% identity, 95% coverage
RSP_4049 Pyruvate dehydrogenase E1 component, beta subunit from Rhodobacter sphaeroides 2.4.1
44% identity, 70% coverage
- Regulation of Reactive Oxygen Species Promotes Growth and Carotenoid Production Under Autotrophic Conditions in Rhodobacter sphaeroides
Lee, Frontiers in microbiology 2022 - “...chaperones 1.3 RSP_4047 pdhAa Pyruvate dehydrogenase E1 component subunit alpha Energy production and conversion 1.5 RSP_4049 pdhAb Pyruvate dehydrogenase E1 component subunit beta Energy production and conversion 1.4 RSP_0979 sdhB Succinate dehydrogenase catalytic subunit Energy production and conversion 1.0 RSP_1559 icd Isocitrate dehydrogenase Energy production and...”
- A cluster of four homologous small RNAs modulates C1 metabolism and the pyruvate dehydrogenase complex in Rhodobacter sphaeroides under various stress conditions
Billenkamp, Journal of bacteriology 2015 - “...pdhD (RSP_2968, dihydrolipoamide dehydrogenase), pdhAb (RSP_4049, dehydrolipoamide acetyltransferase), and pdhB (RSP_4050, deydrolipoamide acetyltransferase E2...”
- “...18.2 3 RSP_4047 (pdhAa), 1 RSP_2876 18.4 RSP_4049 (pdhAb), 2 4 Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex Pyruvate...”
- Effects of the cryptochrome CryB from Rhodobacter sphaeroides on global gene expression in the dark or blue light or in the presence of singlet oxygen
Frühwirth, PloS one 2012 - “...harvesting B875 subunit Citric acid cycle RSP_4047 pdhAa 0.62 0.42 0.40 Pyruvate dehydrogenase E1 component RSP_4049 pdhAb 0.58 0.36 0.35 Dihydrolipoamide acetyltransferase RSP_4050 pdhB 0.55 0.39 0.39 Dihydrolipoamide acetyltransferase Oxidative phosphorylation RSP_0296 cycA 0.90 0.70 0.54 Cytochrome c2 RSP_0693 ccoP 1.12 0.59 0.61 Cbb3-type cytochrome c...”
bll4782 pyruvate dehydrogenase beta subunit from Bradyrhizobium japonicum USDA 110
BJA_RS24020 pyruvate dehydrogenase complex E1 component subunit beta from Bradyrhizobium diazoefficiens USDA 110
45% identity, 67% coverage
- Isolation and Characterization of High-Temperature-Tolerant Mutants of Bradyrhizobium diazoefficiens USDA110 by Carbon-Ion Beam Irradiation
Satoh, Microorganisms 2024 - “...of the genes on either side of this breakpoint. The four genes pdhA (bll4783), BJA_RS24020 (bll4782), BJA_RS24005 (bll4779), and lpdA (bll0449) are considered to be involved in the process of pyruvic acid decarboxylation resulting in the synthesis of acetyl-CoA, which is needed at the first step...”
- Pleiotropic Effects of PhaR Regulator in Bradyrhizobium diazoefficiens Microaerobic Metabolism
Quelas, International journal of molecular sciences 2024 - “...), for instance, phosphoenolpyruvate carboxykinase (Bll8141, PckA), ABC transporters (Bll6453), pyruvate dehydrogenase E1 component subunit (Bll4782, PdhB), pyruvate dehydrogenase E1 component subunit (Bll4783, PdhA), and acetyltransferase component of pyruvate dehydrogenase complex (Bll4779) [ 34 ]. Whether these proteins specifically bind to PHB has not yet been...”
- Proteomic Characterization of Bradyrhizobium diazoefficiens Bacteroids Reveals a Post-Symbiotic, Hemibiotrophic-Like Lifestyle of the Bacteria within Senescing Soybean Nodules
Strodtman, International journal of molecular sciences 2018 - “...Proteins of glycolysis and gluconeogensis were well represented in the decreasing data set; pyruvate dehydrogenase (bll4782), phosphoenolpyruvate carboxykinase (bll8141), fructose bisphosphate aldolase (bll1520), and enolase (bll4794). Pyruvate dehydrogenase (bll4782) provides a link between glycolysis to branched chain amino acid biosynthesis. Citric acid cycle enzymes succinyl-CoA synthetase...”
- “...Cystathionine beta lyase bll4445 NP_771085 Cytoplasm Hypothetical protein bll4781 NP_771421 Cytoplasm Pyruvate dehydrogenase beta subunit bll4782 NP_771422 Cytoplasm Enolase bll4794 NP_771434 Cytoplasm Translation elongation factor Ts bll4860 NP_771500 Periplasm Prolyl-tRNA synthetase bll4877 NP_771517 Cytoplasm ATP-dependent protease LA bll4942 NP_771582 Cytoplasm Trigger factor bll4945 NP_771585 Cytoplasm 50S...”
- Isolation and Characterization of High-Temperature-Tolerant Mutants of Bradyrhizobium diazoefficiens USDA110 by Carbon-Ion Beam Irradiation
Satoh, Microorganisms 2024 - “...level of the genes on either side of this breakpoint. The four genes pdhA (bll4783), BJA_RS24020 (bll4782), BJA_RS24005 (bll4779), and lpdA (bll0449) are considered to be involved in the process of pyruvic acid decarboxylation resulting in the synthesis of acetyl-CoA, which is needed at the first...”
BP0628 putative pyruvate dehydrogenase E1 beta subunit from Bordetella pertussis Tohama I
43% identity, 99% coverage
- Comparative Omics Analysis of Historic and Recent Isolates of Bordetella pertussis and Effects of Genome Rearrangements on Evolution
Dienstbier, Emerging infectious diseases 2021 - “...Group_2604 BP0625 2.3 3.3 Acyl-CoA dehydrogenase toh_00609 Group_2725 BP0627 2.0 3.3 Enoyl-CoA hydratase/isomerase toh_00610 Group_895 BP0628 2.4 2.8 Pyruvate dehydrogenase component toh_00611 pdhA BP0629 2.3 2.8 Pyruvate dehydrogenase component toh_01576 Group_23 WP_003811211.1 6.8 3.3 Capsular biosynthesis protein toh_01584 wza BP1628 6.8 2.2 Capsular polysaccharide export protein...”
- The multifaceted RisA regulon of Bordetella pertussis
Coutte, Scientific reports 2016 - “...non-modulated BPSM ( Fig. 3 ). Only 6 genes fall in this cluster ( bp0627, bp0628, bp1704, bp2496, bp3501, bp3871 ), all of unknown function. Based on their expression in modulated BPSM, these genes would be classified as vrg s. However, their expression does not appear...”
ING2E5A_1805 alpha-ketoacid dehydrogenase subunit beta from Petrimonas mucosa
47% identity, 97% coverage
- The Role of Petrimonas mucosa ING2-E5AT in Mesophilic Biogas Reactor Systems as Deduced from Multiomics Analyses
Maus, Microorganisms 2020 - “...+ HCO 3 - <=> ADP + phosphate + oxaloacetate pyc B1, pyc B3 ING2E5A_1490, ING2E5A_1805, ING2E5A_1806, 1.2.4.1 Pyruvate dehydrogenase Pyruvate + [dihydrolipoyllysine-residue acetyltransferase] lipoyllysine <=> [dihydrolipoyllysine-residue acetyltransferase] S-acetyldihydrolipoyllysine + CO(2) pdh B1, pdh B3, pdh A ING2E5A_1158, ING2E5A_1264, ING2E5A_1491, ING2E5A_1804 2.3.1.12 Dihydrolipoyllysine-residue acetyltransferase Acetyl-CoA +...”
HD73_3215 acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta from Bacillus thuringiensis serovar kurstaki str. HD73
43% identity, 94% coverage
- Identification of metabolism pathways directly regulated by sigma(54) factor in Bacillus thuringiensis
Peng, Frontiers in microbiology 2015 - “...protein 37.362 HD73_3213 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha 25.424 HD73_3214 TPP-dependent acetoin dehydrogenase E1 alpha-subunit 19.979 HD73_3215 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta 9.610 HD73_3216 Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system 9.326 HD73_3217 Dihydrolipoyl dehydrogenase 4.337 HD73_4161 Proline dipeptidase 103.525 HD73_4468 Phosphate butyryltransferase 6.110 HD73_4467 Leucine dehydrogenase -...”
Lreu_0632, WP_003668267 alpha-ketoacid dehydrogenase subunit beta from Limosilactobacillus reuteri subsp. reuteri
A5VJ73 Transketolase domain protein from Limosilactobacillus reuteri (strain DSM 20016)
Lreu_0632 transketolase domain-containing protein from Lactobacillus reuteri DSM 20016
43% identity, 100% coverage
BQ04920 Pyruvate dehydrogenase E1 component beta subunit from Bartonella quintana str. Toulouse
42% identity, 71% coverage
PA3416 probable pyruvate dehydrogenase E1 component, beta chain from Pseudomonas aeruginosa PAO1
44% identity, 95% coverage
- Quorum-sensing regulation of phenazine production heightens Pseudomonas aeruginosa resistance to ciprofloxacin
Xia, Antimicrobial agents and chemotherapy 2024 (secret) - Integrated metabolomic and transcriptomic analyses of the synergistic effect of polymyxin-rifampicin combination against Pseudomonas aeruginosa
Mahamad, Journal of biomedical science 2022 - “...cycle (Fig. 6 ). Several essential genes involved in glycolysis and the TCA cycle, namely PA3416, PA3417, lpdV , and icd , were also significantly downregulated at 1h following combination therapy (Fig. 6 and Additional file 1 : Table S7). Collectively, these results indicate that glycolysis...”
- “...(levels of which were increased) to pyruvate (levels decreased) by downregulating several associated genes (e.g. PA3416, PA3417). RpoS is a sigma factor and a general stress response regulator in bacteria; and is positively regulated as a counter-measure to conditions that include osmotic and oxidative stress [...”
- ECF Sigma Factor HxuI Is Critical for In Vivo Fitness of Pseudomonas aeruginosa during Infection
Cai, Microbiology spectrum 2022 - “...PA2446 gcvH2 Glycine cleavage system protein H 2.14 3.3E-10 PA3415 Probable dihydrolipoamide acetyltransferase 3.76 3.12E-36 PA3416 Pyruvate dehydrogenase E1 component subunit beta 2.9 5.1E-10 PA3417 Pyruvate dehydrogenase E1 component subunit alpha 2.69 5.91E-22 PA3582 glpK Glycerol kinase GlpR binding site 2.23 2.07E-06 PA4792 Putative glycerolphosphodiesterase 2.83...”
- TpiA is a Key Metabolic Enzyme That Affects Virulence and Resistance to Aminoglycoside Antibiotics through CrcZ in Pseudomonas aeruginosa
Xia, mBio 2020 - “..., dihydrolipoamide dehydrogenase gene lpd3 in the TCA cycle, the pyruvate dehydrogenase component subunit genes PA3416 and PA3417 , and the cytochrome c oxidase subunit genes coxA , coxB , coIII , coiA , and PA4133 in oxidative phosphorylation ( Fig.6A and TableS2 ). In addition,...”
- NtrBC Regulates Invasiveness and Virulence of Pseudomonas aeruginosa During High-Density Infection
Alford, Frontiers in microbiology 2020 - “...6-phosphogluconolactonase 1.80 1.63 PA3183 zwf Glucose-6-phosphate 1-dehydrogenase 1.55 1.52 PA3415 Probable dihydrolipoamide acetyltransferase 2.61 2.80 PA3416 pdhB Prob. pyruvate dehydrogenase E1 component, chain 2.28 2.55 PA3417 Pyruvate dehydrogenase E1 component subunit alpha 2.39 2.53 PA3570 mmsA Methylmalonate-semialdehyde dehydrogenase 1.92 2.44 PA3635 eno Phosphopyruvate hydratase 1.61 1.61...”
- Understanding the antimicrobial mechanism of TiO₂-based nanocomposite films in a pathogenic bacterium
Kubacka, Scientific reports 2014 - “...pha C2 as evidenced by transcriptome data. Notably, the expression of a pyruvate dehydrogenase ( PA3416 ) was also found to be significantly higher (10.1-fold) in TiO 2 -UV treated samples, which suggests that PAO1 cells also have a higher capacity to transform pyruvate into acetyl-CoA,...”
- A non-classical LysR-type transcriptional regulator PA2206 is required for an effective oxidative stress response in Pseudomonas aeruginosa
Reen, PloS one 2013 - “...lectin PA-IIL 0.51 PA3369 hypothetical protein 0.36 PA3370 hypothetical protein 0.32 PA3371 hypothetical protein 0.35 PA3416 pyruvate dehydrogenase E1 component, chain 0.48 PA3417 pyruvate dehydrogenase E1 component, subunit 0.50 PA3451 hypothetical protein 0.50 PA3788 hypothetical protein 0.40 PA4141 hypothetical protein 0.50 PA4738 conserved hypothetical protein 0.44...”
- Transcriptional and proteomic responses of Pseudomonas aeruginosa PAO1 to spaceflight conditions involve Hfq regulation and reveal a role for oxygen
Crabbé, Applied and environmental microbiology 2011 - “...PA3001 PA3162 PA3307 PA3361 PA3369 PA3391 PA3392 PA3415 PA3416 PA3417 PA0200 PA0492 PA0493 nirM nirS norC norB PA0525 PA0534 PA0567 rpsU ostA PA0788 PA0856...”
- “...rpsA PA3307 lecB PA3369 nosR nosZ PA3415 PA3416 PA3417 Function Hypothetical protein Hypothetical protein Acetyl coenzyme A carboxylase Cytochrome c551...”
- More
PA14_10250 acetoin catabolism protein AcoB from Pseudomonas aeruginosa UCBPP-PA14
43% identity, 95% coverage
NP_001116691 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial from Sus scrofa
41% identity, 82% coverage
2j9fD / P21953 Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
41% identity, 98% coverage
- Ligand: c2-1-hydroxy-3-methyl-propyl-thiamin diphosphate (2j9fD)
Q9HWN0 acetoin dehydrogenase system (subunit 1/2) (EC 2.3.1.190) from Pseudomonas aeruginosa (see paper)
PA4151 acetoin catabolism protein AcoB from Pseudomonas aeruginosa PAO1
43% identity, 95% coverage
- Parallel evolutionary paths to produce more than one Pseudomonas aeruginosa biofilm phenotype
Thöming, NPJ biofilms and microbiomes 2020 - “...PA0513 nirG 2.9 PA14_10240 PA4152 acoC 2.8 PA14_38970 PA1976 2.9 PA14_06700 PA0514 nirL 3.3 PA14_10250 PA4151 acoB 3.0 PA14_38990 PA1975 3.1 PA14_06710 PA0515 nirD 3.3 PA14_10260 PA4150 acoA 3.1 PA14_39000 PA1974 4.9 PA14_06720 PA0516 nirF 3.1 PA14_10270 PA4149 acoX 3.5 PA14_39050 PA1971 braZ 2.5 PA14_06730 PA0517...”
- Novel targets of the CbrAB/Crc carbon catabolite control system revealed by transcript abundance in Pseudomonas aeruginosa
Sonnleitner, PloS one 2012 - “...AACAACAA (30 to 23) PA4150 acoA 2,77 probable dehydrogenase E1 component AACAACAA (9 to 2) PA4151 acoB 4,1 acetoin catabolism protein AcoB AACAAGAA (22 to 15) PA4306 flp 2,9 6,66 8,64 Type IVb pilin, Flp AACAAGAA (22 to 15) PA4496 2,54 2,55 2,9 2,73 8,18 probable...”
- Pseudomonas aeruginosa PAO1 virulence factors and poplar tree response in the rhizosphere
Attila, Microbial biotechnology 2008 - “...the promoter region of PA3278 gene, hence, PA3278 function may not be completely disrupted), PA4150, PA4151, PA4153, PA4295 and PA4549. Two of the most induced genes (PA2461 and PA2459) are part of a putative haemolysin operon; hence, we investigated pathogenesis with isogenic mutations in PA2462 (putative...”
- “...1.140.02 PA2663 2912 0.050.01 0.090.03 0.290.08 1.80.2 0.980.01 PA4150 4211 0.60.1 0.70.1 0.40.1 1.70.5 1.150.06 PA4151 184 0.60.1 0.60.2 0.370.04 1.80.2 1.110.00 PA4295 8474 0.50.1 0.70.2 0.420.07 1.90.2 1.100.04 PA4549 4521 0.70.1 0.80.2 0.50.1 2.20.1 1.110.07 UBC indicates wildtype P. aeruginosa from the University of British...”
Q6P3A8 branched-chain alpha-keto acid dehydrogenase system (subunit 1/2) (EC 1.2.1.25) from Mus musculus (see paper)
41% identity, 83% coverage
- Redox Proteomic Profile of Tirapazamine-Resistant Murine Hepatoma Cells
Nemeikaitė-Čėnienė, International journal of molecular sciences 2023 - “...1.27 26 Vkorc1 Q0VGU5 Vitamin K epoxide reductase complex subunit 1-like protein 0.66 27 Bckdhb Q6P3A8 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 0.65 28 Pycrl Q9DCC4 Pyrroline-5-carboxylate reductase 3 0.65 29 Mthfd1 Q922D8 C-1-tetrahydrofolate synthase, cytoplasmic 0.65 30 Cyp51a1 Q8K0C4 Lanosterol 14-alpha demethylase 0.62 31 Mdh2 P08249...”
- Diminazene Aceturate Stabilizes Atherosclerotic Plaque and Attenuates Hepatic Steatosis in apoE-Knockout Mice by Influencing Macrophages Polarization and Taurine Biosynthesis.
Stachowicz, International journal of molecular sciences 2021 - “...1.20 Q9D379 Ephx1 Epoxide hydrolase 1 1.15 P80315 Cct4 T-complex protein 1 subunit delta 1.15 Q6P3A8 Bckdhb 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 1.15 P48036 Anxa5 Annexin A5 1.13 Q921I1 Tf Serotransferrin 1.13 Q923D2 Blvrb Flavin reductase (NADPH) 1.12 P24456 Cyp2d10 Cytochrome P450 2D10 1.12 Q9EQK5 Mvp...”
- Simultaneous Pathoproteomic Evaluation of the Dystrophin-Glycoprotein Complex and Secondary Changes in the mdx-4cv Mouse Model of Duchenne Muscular Dystrophy
Murphy, Biology 2015 - “...Fold Change P11531 Dystrophin Dp427 15 744.3 5.95E-05 16.01 Q62165 Dystroglycan 9 396.3 4.50E-06 9.17 Q6P3A8 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 2 172.9 0.007920 7.24 P68040 Guanine nucleotide-binding protein subunit beta-2-like 1 2 113.4 0.007929 6.53 P51667 Myosin regulatory light chain 2, ventricular/cardiac muscle isoform 3...”
- CypD(-/-) hearts have altered levels of proteins involved in Krebs cycle, branch chain amino acid degradation and pyruvate metabolism
Menazza, Journal of molecular and cellular cardiology 2013 - “...Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial DHSA_MOUSE 55.42 323 0.957 0.044 0.823 0.030 0.046 14 (Q6P3A8) 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial ODBB_MOUSE 12.05 5 0.981 0.023 0.844 0.034 0.017 14 (P41216) Long-chain-fatty-acid--CoA ligase 1 ACSL1_MOUSE 38.63 83 0.918 0.034 0.793 0.011 0.013 14 (Q8BMF3) NADP-dependent malic...”
- Mitochondrial acetylome analysis in a mouse model of alcohol-induced liver injury utilizing SIRT3 knockout mice.
Fritz, Journal of proteome research 2012 - “...Transport/Respiratory Chain Myelin basic protein P04370 1 2 1 2 Myelination 2-oxoisovalerate dehydrogenase subunit beta Q6P3A8 0 1 0 1 Amino Acid Catabolism 4-hydroxyphenylpyruvate dioxygenase P49429 1 1 1 1 Amino Acid Catabolism Dimethylglycine dehydrogenase Q9DBT9 2 2 2 2 Amino Acid Catabolism/Oxidation-Reduction Sarcosine dehydrogenase Q99LB7...”
P35738 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) (subunit 1/2) (EC 1.2.4.4) from Rattus norvegicus (see paper)
NP_062140 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor from Rattus norvegicus
41% identity, 83% coverage
D820_RS09005 alpha-ketoacid dehydrogenase subunit beta from Streptococcus mutans ATCC 25175
44% identity, 96% coverage
- Transcriptomic Stress Response in Streptococcus mutans following Treatment with a Sublethal Concentration of Chlorhexidine Digluconate
Muehler, Microorganisms 2022 - “...to the untreated control ( Table 5 ). In comparison, expression levels were upregulated in D820_RS09005, ssrA and glgA in CHX-treated bacteria compared to the untreated control ( Table 5 ), which is in line with the DE results from the RNA-Seq experiment. 4. Discussion Despite...”
- “...Size gyrB F: GCACAAGAGTACGATGCCAGT 119 bp R: TCCCAAACAAGGTGATGCAGC D820_RS03005 F: CGTGGTTATCAAGTATCGTGTGA 148 bp R: AAAGAATTGGTCCTGCATCCA D820_RS09005 F: CAGTAGGTGCCGCTCAAACT 128 bp R: AAGTCCGCCGCCAAACATAT glgA F: GTGCCTTGCCCAAATCCCTT 145 bp R: ACATATTCACGACGCCAGCC ssrS F: CGGAAGCAACTAAAGTCAGAGCG 80 bp R: TGGCACCGATGATTCACGTT microorganisms-10-00561-t002_Table 2 Table 2 The 10 most up- and downregulated...”
MMCAP2_0226 alpha-ketoacid dehydrogenase subunit beta from Mycoplasma mycoides subsp. capri str. GM12
41% identity, 99% coverage
- Disruption of the S41 peptidase gene in mycoplasma mycoides capri impacts proteome profile, H(2)O(2) production, and sensitivity to heat shock
Allam, PloS one 2012 - “...lyase Dec 0.6370.006 0.0010.002 MMCAP2_0225 Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit Dec 0.8070.032 <0.0015.03E05 MMCAP2_0226 Pyruvate dehydrogenase E1 component, beta subunit Dec 0.8230.006 <0.0010.001 MMCAP2_0519 Isoleucyl-tRNA synthetase Dec 0.6570.040 0.0030.002 MMCAP2_0628 Putrescine carbamoyltransferase Inc 1.5230.045 <0.0011.15E05 MMCAP2_0765 Adenylosuccinate lyase Dec 0.5600.044 0.0020.002 MMCAP2_0766 Adenylosuccinate synthetase...”
- “...hydratase Dec 0.6030.021 <0.0015.77E06 MMCAP2_0225 Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit Dec 0.8070.032 <0.0015.03E05 MMCAP2_0226 Pyruvate dehydrogenase E1 component, beta subunit Dec 0.8230.006 <0.0010.001 MMCAP2_0336 PTS system, IIA component Dec 0.6000.010 <0.0011.15E05 MMCAP2_0451 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase Dec 0.5600.010 00 MMCAP2_0606 Phosphoglycerate kinase Dec 0.5030.006 00...”
ODBB_BOVIN / P21839 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Bos taurus (Bovine) (see paper)
41% identity, 83% coverage
- function: Together with BCKDHA forms the heterotetrameric E1 subunit of the mitochondrial branched-chain alpha-ketoacid dehydrogenase (BCKD) complex. The BCKD complex catalyzes the multi-step oxidative decarboxylation of alpha-ketoacids derived from the branched-chain amino-acids valine, leucine and isoleucine producing CO2 and acyl-CoA which is subsequently utilized to produce energy. The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate. A reductive acylation mediated by the lipoylamide cofactor of E2 extracts the acyl group from the E1 active site for the next step of the reaction.
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] + 3-methyl-2-oxobutanoate + H(+) = N(6)- [(R)-S(8)-2-methylpropanoyldihydrolipoyl]-L-lysyl- [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + CO2 (RHEA:13457)
cofactor: thiamine diphosphate
subunit: Heterotetramer of 2 alpha/BCKDHA and 2 beta chains/BCKDHB that forms the branched-chain alpha-keto acid decarboxylase (E1) component of the BCKD complex (PubMed:1730724). The branched-chain alpha-ketoacid dehydrogenase is a large complex composed of three major building blocks E1, E2 and E3. It is organized around E2, a 24-meric cubic core composed of DBT, to which are associated 6 to 12 copies of E1, and approximately 6 copies of the dehydrogenase E3, a DLD dimer (By similarity).
BCKDHB / P21953 branched-chain α-keto acid dehydrogenase E1 component β subunit (EC 1.2.4.4) from Homo sapiens (see 15 papers)
ODBB_HUMAN / P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 5 papers)
P21953 branched-chain alpha-keto acid dehydrogenase system (subunit 1/2) (EC 1.2.1.25) from Homo sapiens (see 5 papers)
NP_898871 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial isoform 1 precursor from Homo sapiens
41% identity, 83% coverage
- function: Together with BCKDHA forms the heterotetrameric E1 subunit of the mitochondrial branched-chain alpha-ketoacid dehydrogenase (BCKD) complex. The BCKD complex catalyzes the multi-step oxidative decarboxylation of alpha-ketoacids derived from the branched-chain amino-acids valine, leucine and isoleucine producing CO2 and acyl-CoA which is subsequently utilized to produce energy. The E1 subunit catalyzes the first step with the decarboxylation of the alpha-ketoacid forming an enzyme-product intermediate. A reductive acylation mediated by the lipoylamide cofactor of E2 extracts the acyl group from the E1 active site for the next step of the reaction.
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] + 3-methyl-2-oxobutanoate + H(+) = N(6)- [(R)-S(8)-2-methylpropanoyldihydrolipoyl]-L-lysyl- [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] + CO2 (RHEA:13457)
cofactor: thiamine diphosphate
subunit: Heterotetramer of 2 alpha/BCKDHA and 2 beta chains/BCKDHB that forms the branched-chain alpha-keto acid decarboxylase (E1) component of the BCKD complex (PubMed:10745006, PubMed:9582350). The branched- chain alpha-ketoacid dehydrogenase is a large complex composed of three major building blocks E1, E2 and E3. It is organized around E2, a 24- meric cubic core composed of DBT, to which are associated 6 to 12 copies of E1, and approximately 6 copies of the dehydrogenase E3, a DLD dimer (PubMed:10745006). - Epstein-Barr Virus miR-BARTs 7 and 9 modulate viral cycle, cell proliferation, and proteomic profiles in Burkitt lymphoma
Caetano, Tumour virus research 2024 - “...enzyme 3.65 0.689 P08473 MME Neprilysin 4.04 0.632 E9PFT6 HBD Hemoglobin subunit delta 4.16 0.039 P21953 BCKDHB 2-oxoisovalerate dehydrogenase subunit beta 5.41 0.034 P56279 TCL1A T-cell leukemia/lymphoma protein 1A 7.65 0.035 P04004 VTN Vitronectin 8.86 0.645 a FC = Fold change (log2). b False Discovery Rate....”
- “...3.41 0.299 F5GZQ3 HADHB Trifunctional enzyme subunit beta 3.52 0.114 P08473 MME Neprilysin 3.86 0.951 P21953 BCKDHB 2-oxoisovalerate dehydrogenase subunit beta 4.75 0.070 a FC = Fold change (log2). b False Discovery Rate. Fig. 4 LC/MS results of differently expressed proteins in Akata-EBV/Cas-9cells with knockdown of...”
- Mitochondria-derived vesicles and their potential roles in kidney stone disease.
Chaiyarit, Journal of translational medicine 2023 - “...(28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35) 10 BCKDHB P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component beta chain) (BCKDE1B) (BCKDH E1-beta) 11 MRPL2 Q5T653 39S ribosomal protein L2, mitochondrial (L2mt) (MRP-L2) (Mitochondrial large...”
- Quantitative Acetylomics Revealed Acetylation-Mediated Molecular Pathway Network Changes in Human Nonfunctional Pituitary Neuroendocrine Tumors
Wen, Frontiers in endocrinology 2021 - “...epsilon (ID: P56381), K294 (only acetylated in NF-PitNETs) in mitochondrial 2-oxoisovalerate dehydrogenase subunit beta (ID: P21953), K26 (only acetylated in controls) in nucleoside diphosphate kinase A (ID: P15531), K70 (ratio of T/N=13.46, p = 1.97E-03) in mitochondrial NAD(P) transhydrogenase (ID: Q13423), K1704 (ratio of T/N =...”
- “...dehydrogenase (ID: P04406), K294 (only acetylated in NF-PitNETs) in mitochondrial 2-oxoisovalerate dehydrogenase subunit beta (ID: P21953), K81 (ratio of T/N=5.38, p =3.75E-03) in isocitrate dehydrogenase [NADP] cytoplasmic (ID: O75874), K314 (ratio of T/N=2.71, p =2.20E-02), K185 (only acetylated in NF-PitNETs), K324 and K239 (only acetylated in...”
- Renewable and tuneable bio-LPG blends derived from amino acids.
Amer, Biotechnology for biofuels 2020 - “...transaminase from E. coli (ilvE; UniProt: P0AB80); human branched-chain -keto acid dehydrogenase (BCKDHAB; P12694 and P21953; His 6 -tag on subunit B only), phenylacetaldehyde dehydrogenase 17 from E. coli (PadA; P80668), threonine dehydratase from E. coli (ilvA; P04968) and the E. coli leuABCD complex composed of...”
- Exploring the Mitochondrial Degradome by the TAILS Proteomics Approach in a Cellular Model of Parkinson's Disease.
Lualdi, Frontiers in aging neuroscience 2019 - “...P12236 Internal 2.57 0.67 NQSPVDQGATGASQGLLDR P18827 Internal 0.72 0.08 SHGSQETDEEFDAR P20674 TP-removal 0.74 0.15 VAHFTFQPDPEPR P21953 TP-removal CTRL only VSKPTLKEVVIVSATR P24752 TP-removal 0.74 0.11 QKTGTAEMSSILEER P25705 TP-removal 0.69 0.10 AIAAKEKDIQEESTFSSR P42704 TP-removal 0.69 0.08 ADCISEPVNR P43304 TP-removal 1.35 0.27 SHTDIKVPDFSEYR P47985 TP-removal CTRL only MKEGMSNNSTTSISQAR P50150...”
- Quantitative proteomic analyses of CD4+ and CD8+ T cells reveal differentially expressed proteins in multiple sclerosis patients and healthy controls.
Berge, Clinical proteomics 2019 - “...Peptidyl-prolyl cistrans isomerase F, mitochondrial PPIF 0.003314 1.0344 21.1705 0.33533 21.6843 0.63539 40.1 8 0.84 P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial BCKDHB 0.003651 0.2586 22.4515 0.21161 22.1585 0.24451 15.3 4 0.83 Q8TCD5 5(3)-deoxyribonucleotidase, cytosolic type NT5C 0.003791 0.3211 24.2434 0.14217 24.0995 0.45523 54.2 7 0.86 P57737...”
- Evaluation of variability in high-resolution protein structures by global distance scoring.
Anzai, Heliyon 2018 - “...dehydrogenase subunit alpha P12694 22 91.7 280 62.9 1.85 269 BCKDHB 2-oxoisovalerate dehydrogenase subunit beta P21953 24 100 326 83.2 1.85 391 CA1 Carbonic anhydrase 1 P00915 24 100 256 98.5 1.96 133 CA2 Carbonic anhydrase 2 P00918 638 98.8 255 98.1 1.68 149 CA13 Carbonic...”
- Proteomic distinction of renal oncocytomas and chromophobe renal cell carcinomas.
Drendel, Clinical proteomics 2018 - “...gene 1 protein) (Lysosomal pepstatin-insensitive protease) (LPIC) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase I) (TPP-I) 0.34 0.63 0.01 P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component beta chain) (BCKDE1B) (BCKDH E1-beta) 0.25 0.85 0.01 P03928 ATP synthase protein 8 (A6L) (F-ATPase subunit 8)...”
- More
- Three novel mutations of the BCKDHA, BCKDHB and DBT genes in Chinese children with maple syrup urine disease.
Yang, Journal of pediatric endocrinology & metabolism : JPEM 2022 (PubMed)- GeneRIF: Three novel mutations of the BCKDHA, BCKDHB and DBT genes in Chinese children with maple syrup urine disease.
- Neonatal maple syrup urine disease in China: two novel mutations in the BCKDHB gene and literature review.
Jiang, Journal of pediatric endocrinology & metabolism : JPEM 2021 (PubMed)- GeneRIF: Neonatal maple syrup urine disease in China: two novel mutations in the BCKDHB gene and literature review.
- Association of BCAT2 and BCKDH polymorphisms with clinical, anthropometric and biochemical parameters in young adults.
Vargas-Morales, Nutrition, metabolism, and cardiovascular diseases : NMCD 2021 (PubMed)- GeneRIF: Association of BCAT2 and BCKDH polymorphisms with clinical, anthropometric and biochemical parameters in young adults.
- Identification of novel mutations in BCKDHB and DBT genes in Vietnamese patients with maple sirup urine disease.
Nguyen, Molecular genetics & genomic medicine 2020 - GeneRIF: Identification of novel mutations in BCKDHB and DBT genes in Vietnamese patients with maple sirup urine disease.
- Four novel mutations of the BCKDHA, BCKDHB and DBT genes in Iranian patients with maple syrup urine disease.
Zeynalzadeh, Journal of pediatric endocrinology & metabolism : JPEM 2018 (PubMed)- GeneRIF: Data suggest that the following genetic modifications are involved in patients with maple syrup urine disease in Iran: (1) mutation in BCKDHA (branched chain keto acid dehydrogenase E1 alpha); (2) mutation in BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta); (3) mutation in DBT (dihydrolipoamide branched chain transacylase E2; one patient).
- Clinical characteristics and mutation analysis of five Chinese patients with maple syrup urine disease.
Li, Metabolic brain disease 2018 (PubMed)- GeneRIF: Six different novel genetic variants were validated in BCKDHB gene and BCKDHA gene, including c.523 T > C, c.659delA, c.550delT, c.863G > A and two gross deletions
- [Mutation analysis and prenatal diagnosis for a pedigree affected with maple syrup urine disease].
Mei, Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2018 (PubMed)- GeneRIF: Two heterozygous mutations c.284G>C (p.Gly95Ala) and c.853C>T (p.Arg285*) of the BCKDHB gene were associated with a pedigree affected with maple syrup urine disease.
- Molecular and phenotypic characteristics of seven novel mutations causing branched-chain organic acidurias.
Stojiljkovic, Clinical genetics 2016 (PubMed)- GeneRIF: we identified seven novel genetic variants: p.Leu549Pro, p.Glu564*, p.Leu641Pro in MUT, p.Tyr206Cys in PCCB, p.His194Arg, p.Val298Met in BCKDHA and p.Glu286_Met290del in BCKDHB gene. In silico and/or eukaryotic expression studies confirmed pathogenic effect of all novel genetic variants
- More
ELZ14_17095 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas brassicacearum
41% identity, 96% coverage
Pro0766 Pyruvate dehydrogenase E1 component beta subunit from Prochlorococcus marinus str. SS120
43% identity, 98% coverage
- Glucose uptake and its effect on gene expression in prochlorococcus
Gómez-Baena, PloS one 2008 - “...Pyruvate dehydrogenase E1 alpha subunit acoA 1.2.4.1 Pro1362 Pyruvate dehydrogenase E1 beta subunit acoB 1.2.4.1 Pro0766 Pyruvate dehydrogenase E2 component (Dihydrolipoamide S-acetyltransferase) aceF 2.3.1.12 Pro0401 Dihydrolipoamide dehydrogenase lpd 1.8.1.4 Pro1372 Citrate synthase gltA 2.3.3.1 Pro0185 Aconitase acnB 4.2.1.3 Pro1866 Isocitrate dehydrogenase icd 1.1.1.42 Pro1752 Phosphoenolpyruvate carboxylase...”
CT340 (pyruvate) Oxoisovalerate Dehydrogenase Alpha and Beta Fusion from Chlamydia trachomatis D/UW-3/CX
46% identity, 47% coverage
- Remodeling of host phosphatidylcholine by Chlamydia acyltransferase is regulated by acyl-CoA binding protein ACBD6 associated with lipid droplets
Soupene, MicrobiologyOpen 2015 - “...acid intermediates. No bkd genes are annotated in C. trachomatis genome but a single gene, CT340 ( pdhA_B ), encodes both the and subunits of the E1 decarboxylase unit of the BKD complex, which are encoded by the two separated genes pdhA and pdhB in the...”
- “...primers (2-methylbutyryl-CoA, isobutyryl-CoA, isovaleryl-CoA) are produced by the Branched Keto Dehydrogenase complex (PdhA_B, PdhC, LpdA; CT340, CT247, CT557) from the b( -keto) intermediates. The extender malonyl-CoA is produced by the acetyl-CoA carboxylase complex (AccA, AccB, AccC, AccD; CT123-124-265-293) from acetyl-CoA. Acetyl-CoA is produced from pyruvate by...”
- Type II fatty acid synthesis is essential for the replication of Chlamydia trachomatis
Yao, The Journal of biological chemistry 2014 - “...encoding both the branched-chain -ketoacid dehydrogenase complex (CT340, CT400, and CT557) and the pyruvate dehydrogenase complex (CT245 to -247) were...”
- Chlamydia trachomatis lacks an adaptive response to changes in carbon source availability
Nicholson, Infection and immunity 2004 - “...pdhA CT246 pdhB CT247 pdhC CT285 lplA CT340 pdhA Pyruvate dehydrogenase E1 alpha Pyruvate dehydrogenase E1 beta Dihydrolipoamide acetyltransferase Lipoate...”
CTL0594 2-oxoisovalerate dehydrogenase alpha subunit from Chlamydia trachomatis 434/Bu
46% identity, 47% coverage
WP_004178692 alpha-ketoacid dehydrogenase subunit beta from Klebsiella quasipneumoniae
43% identity, 96% coverage
MNF30_03905 alpha-ketoacid dehydrogenase subunit beta from Mycoplasma mycoides subsp. capri
40% identity, 99% coverage
NO343_02990 alpha-ketoacid dehydrogenase subunit beta from Mycoplasma capricolum subsp. capricolum
41% identity, 99% coverage
BCAL1910 acetoin:2,6-dichlorophenolindophenol oxidoreductase beta subunit from Burkholderia cenocepacia J2315
44% identity, 95% coverage
ACIAD1018 acetoin:2,6-dichlorophenolindophenol oxidoreductase beta subunit (Acetoin:DCPIP oxidoreductase-beta) (AO:DCPIP OR) (TPP-dependent acetoin dehydrogenase E1 beta-subunit) from Acinetobacter sp. ADP1
44% identity, 96% coverage
- A complete collection of single-gene deletion mutants of Acinetobacter baylyi ADP1
de, Molecular systems biology 2008 - “...protease + ACIAD1014 Putative transcriptional regulator + ACIAD1017 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit ( acoA ) + ACIAD1018 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit ( acoB ) + ACIAD1019 Dihydrolipoamide acetyltransferase ( acoC ) + ACIAD1021 Putative (R,R)-butanediol dehydrogenase Growth defect + ACIAD1052 Putative membrane-bound protein in GNT I transport system...”
RL2242 putative pyruvate dehydrogenase from Rhizobium leguminosarum bv. viciae 3841
45% identity, 68% coverage
ANACAC_01491 hypothetical protein from Anaerostipes caccae DSM 14662
43% identity, 96% coverage
MSC_0266 alpha-ketoacid dehydrogenase subunit beta from Mycoplasma mycoides subsp. mycoides SC str. PG1
40% identity, 99% coverage
- Mycoplasmas as Host Pantropic and Specific Pathogens: Clinical Implications, Gene Transfer, Virulence Factors, and Future Perspectives
Dawood, Frontiers in cellular and infection microbiology 2022 - “...antiphagocytosis and anti-bacteriolytic activity ( Jores etal., 2009 ) PdhB, pyruvate dehydrogenase (lipoamide) beta chain (MSC_0266) ( Naseem etal., 2010 ) PdhC, oxo acid dehydrogenase acyltransferase (Catalytic domain) (MSC_0267), ( Krasteva etal., 2014 ) PdhD, dihydrolipoamide dehydrogenase (MSC_0268). Mmm ( Jores etal., 2009 ) pyruvate dehydrogenase...”
- Identification of targets of monoclonal antibodies that inhibit adhesion and growth in Mycoplasma mycoides subspecies mycoides
Aye, Veterinary immunology and immunopathology 2018 - “...complex, which also contains pyruvate dehydrogenase (lipoamide) alpha chain (MSC_0265), pyruvate dehydrogenase (lipoamide) beta chain (MSC_0266) and dihydrolipoamide dehydrogenase (MSC_0268). In Mmm , the pyruvate dehydrogenase complex is an immunogenic protein located in the membrane ( Krasteva et al., 2014 ) that is recognized by sera...”
- Development of a Novel Cocktail Enzyme-Linked Immunosorbent Assay and a Field-Applicable Lateral-Flow Rapid Test for Diagnosis of Contagious Bovine Pleuropneumonia
Heller, Journal of clinical microbiology 2016 - “...MSC_0108 MSC_0136 MSC_0139 MSC_0160 MSC_0240 MSC_0265 MSC_0266 MSC_0397 MSC_0431 MSC_0453 MSC_0610 MSC_0636 MSC_0653 MSC_0679 MSC_0813 MSC_0816 MSC_1046...”
- “...MSC_0431 MSC_0431 MSC_0653 MSC_0397 MSC_0397 MSC_0636 MSC_0266 MSC_0266 MSC_0610 MSC_0265 MSC_0265 MSC_0636 MSC_0240 MSC_0240 MSC_0453 MSC_0160 MSC_0160...”
- Phage library screening for the rapid identification and in vivo testing of candidate genes for a DNA vaccine against Mycoplasma mycoides subsp. mycoides small colony biotype
March, Infection and immunity 2006 - “...lipoamide dehydrogenase subunit of pyruvate dehydrogenase), MSC_0266 (pdhB, encoding the EI lipoamide dehydrogenase subunit of pyruvate dehydrogenase), MSC_0267...”
Q1KSF0 pyruvate dehydrogenase (acetyl-transferring) (EC 1.2.4.1) from Toxoplasma gondii (see paper)
45% identity, 67% coverage
G0N281 Pyruvate dehydrogenase E1 component subunit beta from Caenorhabditis brenneri
43% identity, 91% coverage
NP_500340 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Caenorhabditis elegans
O44451 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Caenorhabditis elegans
43% identity, 91% coverage
SPy1028 putative acetoin dehydrogenase (TPP-dependent) beta chain from Streptococcus pyogenes M1 GAS
45% identity, 98% coverage
- M1T1 group A streptococcal pili promote epithelial colonization but diminish systemic virulence through neutrophil extracellular entrapment
Crotty, Journal of molecular medicine (Berlin, Germany) 2010 - “...on THB agar (THA; Difco, BD, Franklin Lakes, NJ, USA). Precise allelic replacement of the spy1028 gene was performed using an established methodology [ 20 ]. Briefly, ~1,000bp of flanking DNA immediately upstream and downstream of the spy1028 gene was amplified from the M1T1 chromosome by...”
- “...(from plasmid pACYC1094) by fusion PCR, and the resultant amplicon, containing an in-frame substitution of spy1028 with cat , was subcloned into the temperature-sensitive suicide vector pHY304 to yield the knockout vector pSpy1028-KO. This vector was introduced into GAS M1T1 strain 5448 by electroporation and single...”
- M protein and hyaluronic acid capsule are essential for in vivo selection of covRS mutations characteristic of invasive serotype M1T1 group A Streptococcus
Cole, mBio 2010 - “...), the largest protein encoded by a gene in the serotype M1T1 genome, pilus subunit Spy1028 ( 15 ), the building block for the recently discovered fibrillar GAS surface appendages ( 26 ), or the NAD glycohydrolase which enhances GAS cytotoxicity through depletion of host intracellular...”
- Rgg regulates growth phase-dependent expression of proteins associated with secondary metabolism and stress in Streptococcus pyogenes
Chaussee, Journal of bacteriology 2004 - “...and E3) encoded by four adjacent genes (SPy1026, SPy1028, SPy1029, and SPy1031). AcoB (a subunit of E1; SPy1028) and the E3 subunit, dihydrolipoamide...”
BR1128 dihydrolipoamide acetyltransferase from Brucella suis 1330
44% identity, 67% coverage
A1S_1700 acetoin:26-dichlorophenolindophenol oxidoreductase beta subunit from Acinetobacter baumannii ATCC 17978
44% identity, 94% coverage
KZA74_09670 alpha-ketoacid dehydrogenase subunit beta from Acinetobacter baumannii
44% identity, 96% coverage
azo3868 probable acetoin dehydrogenase, beta subunit from Azoarcus sp. BH72
43% identity, 92% coverage
- Environmental factors affecting the expression of pilAB as well as the proteome and transcriptome of the grass endophyte Azoarcus sp. strain BH72
Hauberg-Lotte, PloS one 2012 - “...supernatant with the factors 2.80.8 and 2.41.3, respectively. Moreover, the genes azo0673 (11.54.6), azo3674 (62.433.5), azo3868 (44.96.2) as well as azo3874 (40.22.5) were found to be up-regulated under the mentioned growth conditions. Only gene azo3294 (1.00.1) could not be shown to be differentially expressed by real-time...”
- “...farnesyltransferase 1.00.1 11.3 azo3412 50S ribosomal protein L22 2.41.3 2.5 azo3674 Serine protease 62.433.5 5.0 azo3868 Acetoin dehydrogenase, beta subunit 44.96.2 10.5 azo3874 Conserved hypothetical secreted protein 40.22.5 5.1 The induction factors obtained by microarray and real-time experiments showed some quantitative differences. This observation was not...”
Q98MY8 Pyruvate dehydrogenase E1 component subunit beta from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
44% identity, 68% coverage
- Cyclic Isothiocyanate Goitrin Impairs Lotus japonicus Nodulation, Affects the Proteomes of Nodules and Free Mesorhizobium loti, and Induces the Formation of Caffeic Acid Derivatives in Bacterial Cultures
Jeong, Plants (Basel, Switzerland) 2024 - “...abundancy were reduced, most heavily, pyrophosphate-fructose 6-phosphate 1-phosphotransferase which catalyzes the first step of glycolysis, Q98MY8 for acetyl-CoA production, succinate-CoA ligase, and isocitrate dehydrogenase. Thus, glycolysis and the TCA cycle belong to the strongly affected pathways which results in a reduction in the synthesis of primary...”
ODPB1_ARATH / Q38799 Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial; PDHE1-B; Protein MACCI-BOU; EC 1.2.4.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
Q38799 pyruvate dehydrogenase system (subunit 1/2) (EC 1.2.1.104); pyruvate dehydrogenase (acetyl-transferring) (subunit 1/2) (EC 1.2.4.1) from Arabidopsis thaliana (see paper)
AT5G50850 MAB1 (MACCI-BOU); catalytic/ pyruvate dehydrogenase (acetyl-transferring) from Arabidopsis thaliana
NP_199898 Transketolase family protein from Arabidopsis thaliana
44% identity, 84% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Tetramer of 2 alpha and 2 beta subunits. - TCA cycle impairment leads to PIN2 internalization and degradation via reduced MAB4 level and ARA6 components in Arabidopsis roots
Song, Frontiers in plant science 2024 - “...Quint etal., 2009 ; Luethy et al., 1995 ), and MACCHI-BOU 1 ( MAB1 ; At5g50850 ) encodes an E1 subunit of mtPDC ( Ohbayashi etal., 2019 ; Luethy et al, 1994 ) The E2 component of mtPDC, encoded by three genes mtE2-1 ( At3g52200 ),...”
- QTL analysis of femaleness in monoecious spinach and fine mapping of a major QTL using an updated version of chromosome-scale pseudomolecules
Yamano, PloS one 2024 - “...and g23706.t3 (Chr2_g001540.1), which had HIGH- and MODERATE-impact variants, are homologs of the Arabidopsis genes AT5G50850 ( MAB1 ) and AT5G13010 ( EMB3011 / PINP1 ) associated with auxin transport and auxin-mediated organ development, respectively [ 44 , 45 ]. The gene g23617.t1 (Chr2_g000670.1) with a...”
- New Insights on the Role of ß-Cyanoalanine Synthase CAS-C1 in Root Hair Elongation through Single-Cell Proteomics
Arenas-Alfonseca, Plants (Basel, Switzerland) 2023 - “...elongation factor 5A-3 AT1G31070 GLCNA.UT1 GLCNA.UT1__N-acetylglucosamine-1-phosphate uridylyltransferase 1 AT5G16760 AtITPK1 ITPK1__Inositol 1,3,4-trisphosphate 5/6-kinase family protein AT5G50850 MAB1 MAB1__Transketolase family protein AT2G33340 MAC3B MOS4-associated complex 3B AT4G24800 ECIP1-MRF3 MRF3__MA3 domain-containing protein AT4G35460 ATNTRB NTRB__NADPH-dependent thioredoxin reductase B AT3G54960 ATPDI1 PDIL1-3__PDI-like 1-3 AT3G15000 MORF8-RIP1 RIP1__cobalt ion binding AT4G13930...”
- Dissecting the Molecular Regulation of Natural Variation in Growth and Senescence of Two Eutrema salsugineum Ecotypes
Wang, International journal of molecular sciences 2022 - “...5.27/60.5 80 6 acid XR5 At5g08570 XP_006399365 pyruvate kinase 6.3/64 5.93/55 70 6 appear SR16 At5g50850 XP_006402055 pyruvate dehydrogenase E1 component subunit beta-1 5.1/38 5.11/35.9 32 4 decrease acid XR9 At5g50850 XP_006402055 pyruvate dehydrogenase E1 component subunit beta-1 5.3/36 5.11/35.9 58 5 increase basic SR4 At2g45290...”
- Genomically Hardwired Regulation of Gene Activity Orchestrates Cellular Iron Homeostasis in Arabidopsis
Hsieh, RNA biology 2022 - “...iPGAM2, At3g08590; ADH1, At1g77120; CSY4, At2g44350; CSY5, At3g60100; ACO2, At4g26970; ACO3, At2g05710; IAR4, At1g24180; MAB1, At5g50850; HOT5, At5g43940; ADH, At4g22110; ALDH2B7, At1g23800; ALDH2B4, At3g48000; ALDH3H1, At1g44170; PCK1, At4g37870; PPC1, At1g53310; IRT3, At1g60960; BGLU42, At5g36890; BTSL2, At1g18910; GRF11, At1g34760. Author contributions E.J.H. and W.S. designed the research;...”
- Quantitative Proteomics Reveals the Dynamic Regulation of the Tomato Proteome in Response to Phytophthora infestans
Fan, International journal of molecular sciences 2021 - “...AT1G74030 3 0.599 0.049 3 1.053 0.430 2 1.073 NQ Solyc03g097680 pyruvate dehydrogenase 1 (PDH) AT5G50850 3 0.048 0.857 3 0.270 0.724 3 1.251 0.038 Metabolism-Primary-Carbohydrate Metabolisms-PPP Solyc04g005160 6-phosphogluconate dehydrogenase (6PGD) AT3G02360 3 0.046 0.033 3 0.524 0.031 3 1.886 0.016 Solyc05g008370 ribose 5-phosphate isomerase A...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...(At1g54220, spots 30, 45, 86), as well as EI (pyruvate dehydrogenase E1 component subunit beta-1, At5g50850, spots 7981, 86). In the first committed step of citric acid cycle, citrate synthase (CS) functions in converting acetyl-CoA to citrate [ 55 ]. Indeed, the CS4 (At2g44350) protein was...”
- Stimulation of adventitious root formation by the oligosaccharin OSRG at the transcriptome level
Larskaya, Plant signaling & behavior 2020 (secret) - More
- Mitochondrial Pyruvate Dehydrogenase Contributes to Auxin-Regulated Organ Development.
Ohbayashi, Plant physiology 2019 - GeneRIF: Mitochondrial Pyruvate Dehydrogenase Contributes to Auxin-Regulated Organ Development.
- Proteome and Interactome Linked to Metabolism, Genetic Information Processing, and Abiotic Stress in Gametophytes of Two Woodferns
Ojosnegros, International journal of molecular sciences 2023 - “...0 Carbohydrates 135690-210_1_ORF2 Q9ZU52 FBA3 FRUCTOSE-BISPHOSPHATE ALDOLASE 3 42.7 32 7 38 0 Carbohydrates 38153-411_5_ORF2 Q38799 PDH2 PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT BETA-1 40.3 14 4 6 0 Carbohydrates 83096-276_3_ORF2 Q5GM68 PPC2 PHOSPHOENOLPYRUVATE CARBOXYLASE 2 112.8 6 5 5 0 Carbohydrates 54280-344_1_ORF1 Q84VW9 PPC3 PHOSPHOENOLPYRUVATE CARBOXYLASE...”
- Integrative omics of Lonicera japonica Thunb. Flower development unravels molecular changes regulating secondary metabolites
Yang, Journal of proteomics 2019 - “...0.01485 Protein 17 O20250 Transketolase, chloroplastic 80,744 0.05 0.09 0.05 0.12 0.15 0.00154 Photosynthesis 18 Q38799 Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial 39,436 0.05 0.06 0.06 0.07 0.13 0.00741 TCA cycle 19 P29356 Fructose-bisphosphate aldolase, cytoplasmic isozyme 38,675 0.04 0.04 0.04 0.04 0.06 0.00002 Glycolysis...”
- Cold and Heat Stress Diversely Alter Both Cauliflower Respiration and Distinct Mitochondrial Proteins Including OXPHOS Components and Matrix Enzymes
Rurek, International journal of molecular sciences 2018 - “...0.01 0.21 0.06 [+1.91] 0.22 0.03 (+2.00) Pyruvate dehydrogenase E1 beta subunit; Arabidopsis; CM NP_199898.1 Q38799 At5g50850 39.4 5.67 39 5.16 5484; 2.94 29 73; 146 3 0.18 0.01 0.40 0.09 (+2.22) 0.21 0.01 (+1.17) 3-phosphoglycerate dehydrogenase-like protein; Arabidopsis; AM NP_195146.1 O49485 At4g34200 63.6 6.16 72...”
- Quantitative proteomic analysis of the Salmonella-lettuce interaction
Zhang, Microbial biotechnology 2014 - “...Accession Gene Fold change P -value # of unique peptides Pyruvate dehydrogenase E1 subunit beta-1 Q38799 PDH2 7.5 <1.0E-04 2 Triosephosphate isomerase P48491 CTIMC 2.3 1.9E-02 2 Fructose-bisphosphate aldolase 1 F4IGL7 FBA1 7.2 5.8E-03 1 2-cys Peroxiredoxin Q96291 BAS1 10.0 5.5E-04 1 Actin 4 P53497 ACT12...”
Q86HX0 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Dictyostelium discoideum
41% identity, 90% coverage
- Dictyostelium discoideum as a Model for Investigating Neurodegenerative Diseases
Haver, Frontiers in cellular neuroscience 2021 - “...Q55DE7 Spinocerebellar ataxia PDHA1 Q54C70 Pyruvate dehydrogenase deficiency SPTBN2 Q54DR3 DLAT P36413 ATXN10 Q55EI6 PDHB Q86HX0 PPP2R2B Q54Q99 ITPR1 Q9NA13 HEXB P13723/Q54SC9 Sandoff disease TBP P26355 EEF2 P151122/Q54JV1 HEXA P13723/Q54SC9 Tay-Sachs disease AFGL2 Q75JS8 ELOVL4 Q55BY4 ERCC6 Q54TY2 Cockayne syndrome NOP56 Q54MT2 AT2B1 P54678/Q54HG6 ABCA1 Q8T5Z7...”
ABZJ_01901, G8E09_10095 alpha-ketoacid dehydrogenase subunit beta from Acinetobacter baumannii MDR-ZJ06
44% identity, 96% coverage
- Phenotypic Variation and Carbapenem Resistance Potential in OXA-499-Producing Acinetobacter pittii
Zhang, Frontiers in microbiology 2020 - “...Hypothetical protein 2.02 0.0019 0.0437 G8E09_10100 Thiamine pyrophosphate-dependent dehydrogenaseE1 component subunit alpha 2.02 0.0001 0.0064 G8E09_10095 Alpha-ketoacid dehydrogenase subunit beta 2.02 0.0001 0.0065 G8E09_14195 Aromatic ring-hydroxylating dioxygenase subunit alpha 1.97 0.0007 0.0205 G8E09_08645 SDR family oxidoreductase 1.94 0.0002 0.0089 G8E09_03110 Peroxiredoxin 1.93 0.0000 0.0003 G8E09_07120 Molecular...”
- Colistin Resistance in Acinetobacter baumannii MDR-ZJ06 Revealed by a Multiomics Approach
Hua, Frontiers in cellular and infection microbiology 2017 - “...3.99E-05 ABZJ_01275 hypothetical protein 1.122845 8.385252 1.31E-08 1.76E-07 ABZJ_03838 membrane-fusion protein 1.119324 7.708838 1.84E-08 2.33E-07 ABZJ_01901 acetoin:26-dichlorophenolindophenol oxidoreductase beta subunit 1.105826 6.349341 5.58E-05 0.000323 ABZJ_01899 lipoate synthase 1.08338 4.583472 0.003397 0.011422 ABZJ_00360 hypothetical protein 1.076106 8.065171 1.34E-07 1.46E-06 ABZJ_01210 hypothetical protein 1.065917 3.456549 0.011028 0.032156 ABZJ_01160...”
A0A2P6R068 Pyruvate dehydrogenase E1 component subunit beta from Rosa chinensis
44% identity, 81% coverage
XP_006402055 pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial from Eutrema salsugineum
43% identity, 87% coverage
EIO_1168, KVC_1207, KVU_0668, KvSKV_05525 pyruvate dehydrogenase complex E1 component subunit beta from Ketogulonicigenium vulgare
42% identity, 72% coverage
- Reconstruction and analysis of carbon metabolic pathway of Ketogulonicigenium vulgare SPU B805 by genome and transcriptome
Wang, Scientific reports 2018 - “...2.2.1.2 KVC_1789 KvSKV_RS08555 KVH_08530 KVU_1236 EIO_1771 AceE TCA 1.2.4.1 KVC_1207, 1208 KvSKV_05525 KVH_05560 KVU_0668, 0669 EIO_1168, 1169 GltA TCA 2.3.3.1 KVC_2235 KvSKV_10775 KVH_10860 KVU_1659 EIO_2099 Acn TCA 4.2.1.3 KVC_0695, 1409 KvSKV_06590 KVH_06620 KVU_0869 EIO_1377 Icd TCA 1.1.1.42 KVC_1885 KvSKV_08965 KVH_09010 KVU_1326 EIO_1866 SucA TCA 1.2.4.2 KVC_0103...”
- “...KvSKV_10835 KVH_10920 KVU_1671 EIO_2112 Tal PPP 2.2.1.2 KVC_1789 KvSKV_RS08555 KVH_08530 KVU_1236 EIO_1771 AceE TCA 1.2.4.1 KVC_1207, 1208 KvSKV_05525 KVH_05560 KVU_0668, 0669 EIO_1168, 1169 GltA TCA 2.3.3.1 KVC_2235 KvSKV_10775 KVH_10860 KVU_1659 EIO_2099 Acn TCA 4.2.1.3 KVC_0695, 1409 KvSKV_06590 KVH_06620 KVU_0869 EIO_1377 Icd TCA 1.1.1.42 KVC_1885 KvSKV_08965 KVH_09010...”
- “...Tal PPP 2.2.1.2 KVC_1789 KvSKV_RS08555 KVH_08530 KVU_1236 EIO_1771 AceE TCA 1.2.4.1 KVC_1207, 1208 KvSKV_05525 KVH_05560 KVU_0668, 0669 EIO_1168, 1169 GltA TCA 2.3.3.1 KVC_2235 KvSKV_10775 KVH_10860 KVU_1659 EIO_2099 Acn TCA 4.2.1.3 KVC_0695, 1409 KvSKV_06590 KVH_06620 KVU_0869 EIO_1377 Icd TCA 1.1.1.42 KVC_1885 KvSKV_08965 KVH_09010 KVU_1326 EIO_1866 SucA TCA...”
- “...KVU_1671 EIO_2112 Tal PPP 2.2.1.2 KVC_1789 KvSKV_RS08555 KVH_08530 KVU_1236 EIO_1771 AceE TCA 1.2.4.1 KVC_1207, 1208 KvSKV_05525 KVH_05560 KVU_0668, 0669 EIO_1168, 1169 GltA TCA 2.3.3.1 KVC_2235 KvSKV_10775 KVH_10860 KVU_1659 EIO_2099 Acn TCA 4.2.1.3 KVC_0695, 1409 KvSKV_06590 KVH_06620 KVU_0869 EIO_1377 Icd TCA 1.1.1.42 KVC_1885 KvSKV_08965 KVH_09010 KVU_1326 EIO_1866...”
Q9P5K8 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) from Neurospora crassa
NCU03913 2-oxoisovalerate dehydrogenase beta subunit from Neurospora crassa OR74A
45% identity, 71% coverage
BME_RS04270 pyruvate dehydrogenase complex E1 component subunit beta from Brucella melitensis bv. 1 str. 16M
BMEI0855 PYRUVATE DEHYDROGENASE E1 COMPONENT, BETA SUBUNIT from Brucella melitensis 16M
43% identity, 67% coverage
- Transcriptome Landscape of Intracellular Brucella ovis Surviving in RAW264.7 Macrophage Immune System
Jiao, Inflammation 2020 - “...signaling pathway, mitogen-activated protein kinase (MAPK) signaling pathway, beta-alanine metabolism, and quorum sensing pathway. BME_RS01160, BME_RS04270, BME_RS08185, BME_RS12880, BME_RS25875, predicted_RNA865, and predicted_RNA953 were confirmed with the transcriptome sequencing data. Hence, our findings not only reveal the intracellular parasitism of B. ovis in the macrophage immune system,...”
- “...predict_RNA953 F: CGTCGAGTGTCTGATAGCCC R: GAGTTTATCGCGCTTGGCTG BME_RS01160 F: CACGCTTCTTGCCATGATCG R: GCAATGCGGTTGTCGGTATC BME_RS12880 F: CTGAAGGCTGGTTTGTTGCC R: GCTGCAACCTTCGGATTGTC BME_RS04270 F: CGATGTGCCGAAGCTTGATG R: AGCGATAGTCAGGATTGGCG RESULTS Visual Analysis of DEGs Between Wild-Type and Intracellular B. ovis The overall distribution of DEGs was inferred by visualization of volcano and scatter plots. In...”
- Immuno-profiling of Brucella proteins for developing improved vaccines and DIVA capable serodiagnostic assays for brucellosis
Nandini, Frontiers in microbiology 2023 - “...BMEI1513 F-5CGCGGATCCATGCGCGATCCCTAT-3 R-5CCGCTCGAGCACAACCCTGCGTTT-3 BMEI0063 F-5CGCGGATCCGTGGGGCAGGGG-3 R-5CCGCTCGAGTGTAAAATTAAAGTTTC-3 BMEI0856 F-5CGCGGATCCATGCCGATCAATATCACC-3 R-5CCGCTCGAGGACCAGCATACCCATC-3 BMEI0916 F-5CGCGGATCCATGCGCGACGGCGTA-3 R-5CCGCTCGAGGTCGACAATGTCATCG-3 BMEII1048 F-5CGCGGATCCATGGCTGCAAAAGAC-3 R-5CCGCTCGAGGAAGTCCATGCCGCC-3 BMEI0855 F-5ATTTGCGGCCGCATGCCCATAGAAAT-3 R-5CCGCTCGAGAGCGGTATAGGTAACG-3 BMEII0154 F-5ATTTGCGGCCGCATGAACATTGAG-3 R-5CCGCTCGAGTGGCTTGGACTTGAT-3 BMEI0748 F-5CGCGGATCCATGGCTGATCTCGCA-3 R-5CCGCTCGAGCTTGAGTTCAACCTTGG-3 Purification of His-tagged serodominant proteins of Brucella The BL21 (DE3) E. coli harboring individual Brucella protein expression plasmids were grown overnight at...”
- “...BMEI2048 Preprotein translocase subunit SecG BMEI0847 NADH dehydrogenase subunit E BMEI1154 Pyruvate dehydrogenase subunit beta BMEI0855 VirB8 BMEII0032 Hypothetical protein BMEI0563 Outer membrane lipoprotein BMEI0135 Dihydrolipoamide succinyltransferase BMEI0141 Flagellar hook-associated protein FlgL BMEII0161 Hypothetical protein BMEI0178 Hypothetical protein BMEI0805 Hypothetical protein BMEI0051 DNA gyrase subunit A...”
- RNA-seq reveals the critical role of OtpR in regulating Brucella melitensis metabolism and virulence under acidic stress
Liu, Scientific reports 2015 - “...tricarboxylic acid (TCA) cycle ( mdh, BMEI0137; sucD, BMEI0138; BMEI0139; sucA, BMEI0140; BMEI0791; gltA, BMEI0836; BMEI0855; BMEI0856; class I fumarate hydratase, BMEI1016; acn, BMEI1855; fumC, BMEII1051; and citrate lyase beta chain, BMEII1074; Fig. 2 ). The TCA cycle is critical for carbon metabolism and energy generation....”
- “...pyruvate metabolism were down-regulated in the otpR mutant, including mdh (BMEI0137), FAD-linked oxidase (BMEI0599), pdhB (BMEI0855), and aceF (BMEI0856). Furthermore, the entire NADH dehydrogenase operon was down-regulated in 16M otpR . The genes encoding the cytochrome D ubiquinol oxidase subunits I, II, and III (BMEII0759, BMEII0760,...”
- Antigen-specific acquired immunity in human brucellosis: implications for diagnosis, prognosis, and vaccine development
Cannella, Frontiers in cellular and infection microbiology 2012 - “...11,217 BMEII0032 Type IV secretion system protein; VirB8 26,446 BMEI1330 Probable serine protease do-like 53,514 BMEI0855 Pyruvate dehydrogenase e1 component, -subunit 48,954 BMEI0228 Lema protein 23,260 BMEI0340 Outer membrane lipoprotein omp16 18,233 BMEI1890 Transporter 34,705 BMEI1077 Immunogenic membrane protein yajC 12,560 BMEII0017 Outer membrane lipoprotein omp10...”
GRMZM2G097226 pyruvate dehydrogenase E1 beta subunit from Zea mays
44% identity, 85% coverage
- Comparative transcriptome analysis reveals that tricarboxylic acid cycle-related genes are associated with maize CMS-C fertility restoration
Liu, BMC plant biology 2018 - “...up Glycolysis/Pentose phosphate pathway Phosphoglucomutase 2 GRMZM2G043198 2.07 up Glycolysis/Pentose phosphate pathway Pyruvate dehydrogenase 2 GRMZM2G097226 2.15 up Glycolysis/Pyruvate metabolism Pyruvate dehydrogenase E1 beta subunit GRMZM2G125233 2.28 up Glycolysis Galactose mutarotase-like superfamily protein GRMZM2G440208 2.43 up Pentose phosphate pathway 6-phosphogluconate dehydrogenase, decarboxylating GRMZM2G098346 2.50 up Glycolysis...”
- Dynamic Proteomic Characteristics and Network Integration Revealing Key Proteins for Two Kernel Tissue Developments in Popcorn
Dong, PloS one 2015 - “...Protein No. 50 (GRMZM2G132903), Proteins No. 39 (GRMZM2G339994), proteins No. 13 (GRMZM2G008714), proteins No. 18 (GRMZM2G097226) and proteins No. 44 (GRMZM2G001898), proteins No. 10 (GRMZM2G135283), proteins No. 21 (GRMZM2G154595), 30 (GRMZM2G090087) and 43 (GRMZM2G445905) had ten, eight, seven, six and five first-degree interaction proteins, respectively. Protein...”
PBANKA_110420 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, putative from Plasmodium berghei ANKA
45% identity, 79% coverage
- A genome-scale vector resource enables high-throughput reverse genetic screening in a malaria parasite
Gomes, Cell host & microbe 2015 - “...etal., 2010 ). We predicted parasite growth would be reduced by a deletion vector for PBANKA_110420, which encodes the E1 subunit of the mitochondrial branched chain -ketoacid dehydrogenase (BCKDH), given that deleting the E1 subunit of the same complex has a clear growth phenotype ( Oppenheim...”
- “...p28 , p230p 3xHA tag, and soap ). Orange lines, three attenuated mutants (plasmepsin IV, PBANKA_110420, PBANKA_140160). Twenty-two mutants are shown in total. See FigureS1 for genotyping data. (B) Linear regression analysis of mean abundance values for the two experiments shown in (B). All barcodes present...”
B7FZN6 Pyruvate dehydrogenase E1 component subunit beta from Phaeodactylum tricornutum (strain CCAP 1055/1)
41% identity, 88% coverage
- Metabolomic, proteomic and lactylated proteomic analyses indicate lactate plays important roles in maintaining energy and C:N homeostasis in Phaeodactylum tricornutum
Huang, Biotechnology for biofuels and bioproducts 2022 - “...3.10 0.02 13 B7G3I7 Pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) 1.11 0.45 1.44 0.02 17 B7FZN6 Pyruvate dehydrogenase E1 component beta subunit 1.34 0.14 1.58 0.03 25 B7FZE1 Pyruvate dehydrogenase E1 component alpha subunit 4.16 0.00 1.72 0.08 28 B7GDA9 Pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)...”
- Proteomic and biochemical responses to different concentrations of CO2 suggest the existence of multiple carbon metabolism strategies in Phaeodactylum tricornutum
Wu, Biotechnology for biofuels 2021 - “...B7GEI2, B7FU06), plastic enolase (B7GEF2), pyruvate kinase (PK, Q2TSX0, Q2TSW9) and pyruvate dehydrogenase complex-related proteins (B7FZN6, B7FZE1, B7GDA9) were upregulated under HC conditions, indicating that the glycolysis pathway was enhanced under HC conditions (Fig. 2 ). As shown in Fig. 2 , under LC cultivation, the...”
SSPN_RS0103520 alpha-ketoacid dehydrogenase subunit beta from Saccharopolyspora spinosa NRRL 18395
44% identity, 98% coverage
BruAb1_1134 PdhB, pyruvate dehydrogenase complex, E1 component, beta subunit from Brucella abortus biovar 1 str. 9-941
BAB1_1151 Biotin/lipoyl attachment:2-oxo acid dehydrogenase, acyltransferase component, lipoyl-binding:Transketolase, central region:Tr... from Brucella melitensis biovar Abortus 2308
43% identity, 67% coverage
- Genome sequence of Brucella abortus vaccine strain S19 compared to virulent strains yields candidate virulence genes
Crasta, PloS one 2008 - “...aldolase, class II 29 4 BruAb1_1993 1 1 V->M(no) P_CadA-1, cadmium-translocating P-type ATPase 30 4 BruAb1_1134 1 1 N->S(no) C_dihydrolipoamide acetyltransferase 31 4 BruAb1_0277 1 1 T->P(no) J_translation initiation factor IF-1 32 4 BruAb1_1196 1 1 A->S(no) -_hypothetical protein 33 4 BruAb2_0463 1 1 I->F(no) -_hypothetical...”
- Iron-dependent reconfiguration of the proteome underlies the intracellular lifestyle of Brucella abortus
Roset, Scientific reports 2017 - “...0.23 GI: 82699967 BAB1_1150 E2 branched-chain alpha-keto acid dehydrogenaseE2 C NO 1.37 0.09 GI: 82699968 BAB1_1151 E1 pyruvate dehydrogenase subunit beta E1 C NO 1.96 0.26 GI: 82699969 BAB1_1152 E1 dehydrogenase, E1 component C NO 1.77 0.23 Oxoglutarate dehydrogenase complex GI: 82700688 BAB1_1922 sucB dihydrolipoamide acetyltransferase...”
- “...shown in Table 2 and Fig. 4 , all the subunits of PDH (BAB1_1149, BAB_1150, BAB1_1151 and BAB1_1152) were up-regulated by Brucella within the host cell. This has also been reported in the closely-related 2-proteobacteria Sinorhyzobium meliloti in which the PDH complex is also up-regulated when...”
- Brucella abortus choloylglycine hydrolase affects cell envelope composition and host cell internalization
Marchesini, PloS one 2011 - “...23.2 11.0 BAB1_0722 OM 12 Pyruvate dehydrogenase, beta subunit gi|17987138 4.62 4.73 63.5 49.0 3.1 BAB1_1151 C 19 25 kDa Omp 7 gi|17987532 4.90 8.58 57.4 23.2 9.1 BAB1_0722 OM 26 31 kDa Omp 5 gi|17986685 4.65 5.04 32.3 22.0 12.8 BAB1_1639 OM 42 25 kDa...”
- Intracellular adaptation of Brucella abortus
Lamontagne, Journal of proteome research 2009 - “...reduced 3 hours after infection. Others, like components of the pyruvate dehydrogenase complex (BAB1_1149, BAB1_1150, BAB1_1151) required for the generation of AcetylCoA remained unchanged at this early time. Two proteins putatively involved in the galactose metabolism, galactonate dehydratase (BAB2_0294) and UDP-glucose-4-epimerase (BAB2_0694), and one galactose transporter...”
- “...that form continuous genetic arrangements. For example BAB1_1922, BAB1_1923, BAB1_1925, as well as BAB1_1149, BAB1_1150, BAB1_1151, and BAB1_1645, BAB1_1646, BAB1_1648. These proteins may be transcribed as a single message and subsequently translated as has been observed in other systems 47 . The latter trio of genes...”
B7FJJ4 Pyruvate dehydrogenase E1 component subunit beta from Medicago truncatula
43% identity, 84% coverage
- Ultrastructural and Photosynthetic Responses of Pod Walls in Alfalfa to Drought Stress
Wang, International journal of molecular sciences 2020 - “...cycle) G7KVS0 E1 subunit-like 2-oxoglutarate dehydrogenase NS NS 0.3 G7JYQ8 Aconitate hydratase NS NS 0.3 B7FJJ4 Pyruvate dehydrogenase E1 beta subunit NS 2.0 2.5 G7KHI5 Isocitrate dehydrogenase [NADP] NS NS 0.2 A2Q2V1 ATP-citrate lyase/succinyl-CoA ligase NS 2.5 0.1 Glycine, serine and threonine metabolism A0A072URB1 Amine oxidase...”
- Label-free quantitative proteomic analysis of alfalfa in response to microRNA156 under high temperature
Arshad, BMC genomics 2020 - “...0.0392 Alpha-galactosidase G7KUS5 MTR_7g022440 1.03 0.0329 Glucose-6-phosphate 1-dehydrogenase G7JW95 MTR_5g022300 1.07 0.0155 Ferredoxin--NADP reductase, chloroplastic B7FJJ4 MTR_7g005380 1.12 0.0269 Pyruvate dehydrogenase E1 component subunit G7JAP0 MTR_3g070100 1.15 0.0337 Putative sedoheptulose-bisphosphatase G7JI05 MTR_4g131760 1.28 0.0096 Glucose-1-phosphate adenylyltransferase Q45FF2 MTR_2g017520 1.29 0.0080 Q45FF2_MEDTR Pyridoxal 5-phosphate synthase A2Q5N9 MTR_7g085490...”
A8JBC6 Pyruvate dehydrogenase E1 component subunit beta from Chlamydomonas reinhardtii
40% identity, 92% coverage
RHECIAT_CH0002031 pyruvate dehydrogenase (acetyl-transferring) protein, beta subunit from Rhizobium etli CIAT 652
44% identity, 69% coverage
AOLE_10255 alpha-ketoacid dehydrogenase subunit beta from Acinetobacter oleivorans DR1
44% identity, 96% coverage
F6I1P0 Pyruvate dehydrogenase E1 component subunit beta from Vitis vinifera
43% identity, 87% coverage
Bphy_3759 alpha-ketoacid dehydrogenase subunit beta from Paraburkholderia phymatum STM815
Bphy_3759 transketolase central region from Burkholderia phymatum STM815
42% identity, 96% coverage
BLU65_RS00350 alpha-ketoacid dehydrogenase subunit beta from Pseudomonas lini
41% identity, 94% coverage
- Transcriptome Profiling Analysis of Phosphate-Solubilizing Mechanism of Pseudomonas Strain W134
Wang, Microorganisms 2022 - “...gene down-regulated in the other two groups. Further analysis of significantly upregulated genes revealed that BLU65_RS00350, BLU65_RS05250, gltA, and oadA were significantly upregulated only in group B. Among them, BLU65_RS05250 and oadA were both related to pyruvate carboxylase (the only difference was their subunits), and pyruvate...”
- “...had influence on the types of organic acids secreted by W134. Transcriptome analysis revealed that BLU65_RS00350, BLU65_RS05250, gltA, and oadA were significantly upregulated only in group B ( Table 3 ), and BLU65_RS05250 and oadA were associated with pyruvate carboxylase, which can be converted to organic...”
CT246 Pyruvate Dehydrogenase Beta from Chlamydia trachomatis D/UW-3/CX
42% identity, 97% coverage
- Remodeling of host phosphatidylcholine by Chlamydia acyltransferase is regulated by acyl-CoA binding protein ACBD6 associated with lipid droplets
Soupene, MicrobiologyOpen 2015 - “...; Zhu etal. 2005 ). The PDH complex of C. trachomatis is PdhA (CT245), PdhB (CT246), and PdhC (CT247). bAAs are imported into the inclusion by the bacterial ABC transporter BrnQ (CT554) (Braun etal. 2008 ). Deamination of valine, leucine and isoleucine by CT773 (Ldh) generates...”
- “...Acetyl-CoA is produced from pyruvate by the pyruvate dehydrogenase complex (PdhA, PdhB, PdhC, LpdA; CT245, CT246, CT247, CT557) and is also the primer for de novo synthesis of straight-chain fatty acids. Branched-fatty acids (bFA) present at the sn-2 position of Chlamydia lipids are generated by elongation...”
- Chlamydia trachomatis lacks an adaptive response to changes in carbon source availability
Nicholson, Infection and immunity 2004 - “...1.70 0.01 1.61 0.03 Pyruvate dehydrogenase CT245 pdhA CT246 pdhB CT247 pdhC CT285 lplA CT340 pdhA Pyruvate dehydrogenase E1 alpha Pyruvate dehydrogenase E1 beta...”
T303_06190 alpha-ketoacid dehydrogenase subunit beta from Streptococcus thermophilus ASCC 1275
44% identity, 97% coverage
- Proteomic analysis reveals potential factors associated with enhanced EPS production in Streptococcus thermophilus ASCC 1275
Padmanabhan, Scientific reports 2020 - “...pyruvate metabolism (phosphoenol pyruvate carboxylase, T303_04815; pyruvate dehydrogenase E2 component, T303_06185; pyruvate dehydrogenase E1 component, T303_06190; pyruvate dehydrogenase E2 component alpha subunit, T303_06195; phosphoacetyl transferase, T303_08140; formate acetyltransferase, T303_09120; lactoyl glutathionine lyase, T303_ 08485) and starch metabolism (- amylase, T303_08530; glycogen phosphorylase, T303_06080; glucanotransferase, T303_06085) were...”
- Transcriptomic Insights Into the Growth Phase- and Sugar-Associated Changes in the Exopolysaccharide Production of a High EPS-Producing Streptococcus thermophilus ASCC 1275
Padmanabhan, Frontiers in microbiology 2018 - “...T303_05140, T303_06840, T303_07255, T303_07345, T303_08980, T303_09765) and pyruvate metabolism (T303_02435, T303_03105, T303_03115, T303_03120, T303_06180, T303_06185, T303_06190, T303_06195, T303_08485, T303_09120) were highly expressed at 5 h in M17-G but the expression of most of those genes were reduced or downregulated at 10 h. In sucrose medium at...”
F6HI27 pyruvate dehydrogenase (acetyl-transferring) from Vitis vinifera
41% identity, 79% coverage
- Proteomic analysis of early-stage incompatible and compatible interactions between grapevine and P. viticola
Liu, Horticulture research 2021 - “...isoform X2 1.0259 0.7138 0.8204 0.0466 D7U830 PDHA1 Pyruvate dehydrogenase E1 0.9019 0.0115 0.8121 0.0018 F6HI27 PDHA1 Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic 0.9350 0.0434 0.7605 0.0235 F6I5U2 PDHX Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex 1.0167 0.8694 1.2357 0.0174 D7TEL2 ACO Aconitate hydratase 1.5400...”
- Root Proteomic Analysis of Two Grapevine Rootstock Genotypes Showing Different Susceptibility to Salt Stress
Prinsi, International journal of molecular sciences 2020 - “...component of pyruvate dehydrogenase complex (8, 11) 1.74 61 D7T0U8 Glyceraldehyde-3-phosphate dehydrogenase (1) 1.77 144 F6HI27 Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic (8, 1, 11) 4.93 60 F6GTG3 Enolase 1, chloroplastic-like (4) 6.75 168 D7SY46 Dihydrolipoyl dehydrogenase 2, chloroplastic (8, 11, 21) 26.09 Lipid metabolism...”
- “...(1, 21) 3.06 207 C0KY93 Leucoanthocyanidin dioxygenase (1, 7, 13, 16, 17, 26) 3.29 192 F6HI27 Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic (1, 8, 11) 3.75 265 F6GY71 Pyruvate decarboxylase 1 (5) 18.60 Cell Wall (10) 233 F6I390 Pectinesterase (10) 5.87 57 F6I6R4 Beta-xylosidase/alpha-L-arabinofuranosidase 2...”
Q9C6Z3 Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic from Arabidopsis thaliana
AT1G30120 PDH-E1 BETA (PYRUVATE DEHYDROGENASE E1 BETA); pyruvate dehydrogenase (acetyl-transferring) from Arabidopsis thaliana
41% identity, 79% coverage
- Integrated physiologic, proteomic, and metabolomic analyses of Malus halliana adaptation to saline-alkali stress
Jia, Horticulture research 2019 - “...0.379 1.399 VTC4 Inositol-phosphate phosphatase Q9M8S8 0.273 1.874 PDH2 Pyruvate dehydrogenase E1 component subunit beta-2 Q9C6Z3 2.246 1.168 ALDH2B4 Aldehyde dehydrogenase family 2 member B4 Q9SU63 3.503 1.809 EMB2024 Probable 6-phosphogluconolactonase 5 Q84WW2 6.350 2.667 LPAT1 1-acyl-sn-glycerol-3-phosphate acyltransferase 1 Q8GXU8 0.499 1.003 AOC2 Allene oxide cyclase...”
- The rolB plant oncogene affects multiple signaling protein modules related to hormone signaling and plant defense
Bulgakov, Scientific reports 2018 - “...Plant defense 7 Q9SJZ2 (PER17_ARATH) Peroxidase 17 Hydrogen peroxide catabolic process 3.40.6 Plant defense 8 Q9C6Z3 (ODPB2_ARATH) Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic Fatty acid biosynthetic process Glycolysis 5.30.7 Primary metabolism 9 Q9LFG2 (DAPF_ARATH) Diaminopimelate epimerase, chloroplastic Amino-acid biosynthesis 41.5 Primary metabolism Stress-inducible 1 10...”
- Iron-dependent modifications of the flower transcriptome, proteome, metabolome, and hormonal content in an Arabidopsis ferritin mutant
Sudre, Journal of experimental botany 2013 - “...Carbohydrate metabolism 18 Q9MA79 At1g43670 New 4.7 4.7 Fructose-1,6-bisphosphatase 696/19/12 36 37.7/5.3 39.4/5.6 Mg 19 Q9C6Z3 At1g30120 6.9 Pyruvate dehydrogenase E1 260/6/6 22 44.7/5.9 38.6/5.3 20 Q9S7W4 At3g07720 4.4 2.7 Galactose oxidase 290/5/5 18 36.0/5.1 35.8/5.1 21 Q9SAJ4 At1g79550 3.8 Phosphoglycerate kinase 908/43/17 54 42.2/5.5 39.2/5.8...”
- Rewiring of primary metabolism for ammonium recycling under short-term low CO2 treatment - its implication for C4 evolution
Miao, Frontiers in plant science 2024 - “...of enolase (LOS2, AT2G36530), pyruvate kinase family protein (AT5G08570; AT2G36580), and pyruvate dehydrogenase (PDH-E1 BETA, AT1G30120; PDH-E1_ALPHA, AT1G01090). Among the genes related to the Calvin-Benson-Bassham (CBB) cycle, most of the genes showed upregulation in terms of expression, and the majority of the metabolites were affected (...”
- Metabolome and Transcriptome Association Analysis Reveals Mechanism of Synthesis of Nutrient Composition in Quinoa (Chenopodium quinoa Willd.) Seeds
Yang, Foods (Basel, Switzerland) 2024 - “...crops and even between different varieties of the same crop. The gene LOC110721444 (homologous gene AT1G30120), which encodes pyruvate dehydrogenase, plays a crucial role in fatty acid synthesis. The co-expression of pyruvate dehydrogenase and fatty acid biosynthesis suggests the primary flux direction of acetyl coenzyme A...”
- Sunflower WRINKLED1 Plays a Key Role in Transcriptional Regulation of Oil Biosynthesis
Lim, International journal of molecular sciences 2022 - “...HaActin7 (HannXRQChr14g0446641); AtBCCP2 (AT5G15530); AtPKP-1 (AT5G52920); AtACP1 (AT3G05020); AtKASI (AT5G46290); AtENR1 (AT2G05990); AtENO1 (AT1G74030); AtPDH-E1 (AT1G30120); AtBCCP1 (AT5G16390); AtLPD1 (AT3G16950); AtFAD3 (AT2G29980); AtDGAT1 (AT2G19450); AtPP2A (AT1G13320). Acknowledgments We thank Edgar Cahoon (University of Nebraska-Lincoln) and Peter Drmann (University of Bonn) for plant transformation vectors. We thank...”
- The Sunflower WRINKLED1 Transcription Factor Regulates Fatty Acid Biosynthesis Genes through an AW Box Binding Sequence with a Particular Base Bias
Sánchez, Plants (Basel, Switzerland) 2022 - “...Expression in SunFlower Seed (CAS-6 Line) PDC -PDH At1g01090 HanXRQr2Chr13g0619071 -PDH-13g 1 Plastid Y -PDH At1g30120 HanXRQr2Chr04g0172911 -PDH-4g 1 Plastid Y-0.02 HanXRQr2Chr16g0768891 -PDH-16g 2 Plastid Y-55 HanXRQr2Chr17g0823581 -PDH-17g 3 Plastid Y-35 LPD At3g16950 HanXRQr2Chr05g0217331 0 Plastid Y-2 HanXRQr2Chr10g0440741 LPD-10g 2 Plastid Y-13 HanXRQr2Chr16g0749581 LPD-16g 2 Plastid...”
- Characterization of a DCL2-Insensitive Tomato Bushy Stunt Virus Isolate Infecting Arabidopsis thaliana
Incarbone, Viruses 2020 - “...spots) as well as eight host proteins: AT1G24450 (NFD2), AT3G55410, AT3G62800 DRB4), AT5G55070, AT1G52400, AT4G26910, AT1G30120 and AT2G28380 (DRB2). Remarkably, among these significantly-enriched proteins, NFD2 (Nuclear Fusion Deficient 2), DRB2 (Double-stranded RNA Binding 2) and DRB4 (Double-stranded RNA Binding 4; Figure 3 E, red spots) belong...”
- The modulation of acetic acid pathway genes in Arabidopsis improves survival under drought stress
Rasheed, Scientific reports 2018 - “...down-regulated. *The expression of only the mitochondrial PDH-E1 alpha ( AT1G01090 ) and beta ( AT1G30120 ) subunits decreased significantly in response to drought stress. The aldehyde dehydrogenase (ALDH) superfamily is a diverse family of proteins controlling aldehyde metabolism. ALDH enzymes convert aldehydes to their corresponding...”
- Primed primary metabolism in systemic leaves: a functional systems analysis
Schwachtje, Scientific reports 2018 - “...0.68 0.63 pyridoxal phosphate (PLP)-dependent transferases superfamily protein AT3G55610 P5CS2 0.62 delta 1-pyrroline-5-carboxylate synthase 2 AT1G30120 PDH-E1 BETA 0.44 pyruvate dehydrogenase E1 beta AT1G65960 GAD2 0.36 glutamate decarboxylase 2 AT1G04410 c-NAD-MDH1 0.34 lactate/malate dehydrogenase family protein AT1G79750 NADP-ME4 0.29 0.28 NADP-malic enzyme 4 AT1G59900 PDH-E1 ALPHA...”
- Potato tuber expression of Arabidopsis WRINKLED1 increase triacylglycerol and membrane lipids while affecting central carbohydrate metabolism
Hofvander, Plant biotechnology journal 2016 - “...c85823_g1_i1 Pyruvate Dehydrogenase, E1b component Plastid 5.11 2.42 2.84 21.63 38.91 26.93 4.23 16.08 9.50 AT1G30120 c28567_g1_i1 Dihydrolipoamide Acetyltransferase, E2 component Plastid 16.63 9.37 6.81 65.01 127.14 70.57 3.91 13.57 10.37 AT1G34430 c22404_g1_i1 Dihydrolipoamide Acetyltransferase, E2 component Plastid 22.12 7.72 4.61 111.44 210.94 144.01 5.04 27.33...”
- More
Q2RT65 Pyruvate dehydrogenase E1 component subunit beta from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Rru_A1880 Pyruvate dehydrogenase beta subunit from Rhodospirillum rubrum ATCC 11170
45% identity, 65% coverage
Q97YF5 acetoin dehydrogenase system (EC 2.3.1.190) from Saccharolobus solfataricus (see paper)
41% identity, 98% coverage
Q7QDU3 Pyruvate dehydrogenase E1 component subunit beta (Fragment) from Anopheles gambiae
43% identity, 89% coverage
XP_002512633 pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial from Ricinus communis
42% identity, 87% coverage
E5RPJ6 pyruvate dehydrogenase (acetyl-transferring) from Glycine max
41% identity, 79% coverage
- Omics-Facilitated Crop Improvement for Climate Resilience and Superior Nutritive Value
Zenda, Frontiers in plant science 2021 - “...glutamine synthetase (O82560), serine hydroxy methyl transferase 5 (C6ZJZ0), translation elongation factor (O23963), pyruvate dehydrogenase (E5RPJ6), etc.], response to heat [HSP70 (P26413), HSP22 (mitochondrial) (Q39818), HSP 17.6 kda class 1(P04795), 17.7 kda class 1 HSP (B4 941)], and photosynthesis [Rubisco activase (D4N5G3), oxygen-evolving enhancer protein 2...”
- Proteomics, physiological, and biochemical analysis of cross tolerance mechanisms in response to heat and water stresses in soybean
Katam, PloS one 2020 - “...factor 52.3/6.21 42/4.9 GTPase activity, GTP binding, Translation elongation factor activity Metabolism 303 27 15 E5RPJ6 Glyma05g27260 Pyruvate dehydrogenase 38.9/5.70 39/5.6 Catalytic activity TCA 1443 36 18 O81278 Glyma05g01010 NAD dependent malate dehydrogenase 43.9/6.47 33/5.5 L-malate dehydrogenase activity TCA process, Malate metabolic process 185 24 20...”
K7KQ57 pyruvate dehydrogenase (acetyl-transferring) from Glycine max
41% identity, 80% coverage
Q0J0H4 Pyruvate dehydrogenase E1 component subunit beta-2, mitochondrial from Oryza sativa subsp. japonica
42% identity, 85% coverage
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...bisphosphate aldolase (Q652S1), and pyruvate dehydrogenase E1 component subunit alpha-1 proteins (Q6AVA8, Q6Z5N4, Q654V6, Q2QM55, Q0J0H4, Q6Z1G7, Q7XTJ3, and Q10G39) with a degree greater than 23 ( Supplementary file 2 ). Some proteins including Putative cold shock protein-1 (Q84UR8), probable pyruvate, phosphate dikinase regulatory protein, chloroplastic...”
- Effects of different nitrogen fertilizers on two wheat cultivars: An integrated approach
Vita, Plant direct 2018 - “...P26302 Triticum aestivum Phosphoribulokinase 192 9 29.2 39.2 5.07 4.99 404 3 3 0.6 60 Q0J0H4 Oryza sativa subsp. japonica Pyruvate dehydrogenase E1 component subunit beta2 290 13 29.2 36.6 5.07 4.95 376 4 4 0.5 Spot number corresponds to those reported in Figure 2 ....”
Afu3g01450 3-methyl-2-oxobutanoate dehydrogenase, putative from Aspergillus fumigatus Af293
41% identity, 84% coverage
- Distinct transcriptional responses to fludioxonil in Aspergillus fumigatus and its ΔtcsC and Δskn7 mutants reveal a crucial role for Skn7 in the cell wall reorganizations triggered by this antifungal
Schruefer, BMC genomics 2023 - “...enzyme [ 18 ]. Four other genes that belong to this putative gene cluster, namely Afu3g01450, Afu3g01480, Afu3g01490 and Afu3g01500, were also up-regulated, but only in the wild type and the skn 7 mutant. Fig. 5 Heat maps of genes that were differentially regulated in all...”
- Regulation of Secondary Metabolism by the Velvet Complex Is Temperature-Responsive in Aspergillus
Lind, G3 (Bethesda, Md.) 2016 - “...(2012) Cluster 9 Not known Afu3g01400 , Afu3g01410 , Afu3g01420 , Afu3g01430 , Afu3g01440 , Afu3g01450 , Afu3g01460 , Afu3g01470 , Afu3g01480 Inglis et al. (2013) Cluster 10 Not known Afu3g02520 , Afu3g02530 , Afu3g02540 , Afu3g02550 , Afu3g02560 , Afu3g02570 , Afu3g02580 , Afu3g02585 ,...”
- Exploring temporal transcription regulation structure of Aspergillus fumigatus in heat shock by state space model
Do, BMC genomics 2009 - “...dehydratase, putative 2(+) AFU4G11310 Fructose-1,6-bisphosphatase Fbp1, putative AFU6G02860 Isocitrate lyase 2(+) AFU7G01000 Aldehyde dehydrogenase, putative AFU3G01450 3-methyl-2-oxobutanoate dehydrogenase, putative 2(+) AFU6G14200 Acetyl-CoA-acetyltransferase, putative AFU6G06470 Heatshock protein Hsp30 like, putative 2(+) AFU1G00410 cutinase transcription factor 1 beta AFU3G09690 thaumatin-like protein, putative 2(+) AFU2G00210 hypothetical protein AFU3G00960 conserved...”
WBM_RS04035 pyruvate dehydrogenase complex E1 component subunit beta from Wolbachia endosymbiont strain TRS of Brugia malayi
Wbm0666 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase E1 component, eukaryotic type, beta subunit from Wolbachia endosymbiont strain TRS of Brugia malayi
43% identity, 93% coverage
- Dual RNAseq analyses at soma and germline levels reveal evolutionary innovations in the elephantiasis-agent Brugia malayi, and adaptation of its Wolbachia endosymbionts
Chevignon, PLoS neglected tropical diseases 2021 - “...preprotein translocase YajC 4 835,5 831,4 1290,6 0,01 0,9995 -0,63 0,2677 -0,64 0,1807 34 WBM0666 WBM_RS04035 dihydrolipoamide acetyltransferase 4 832,3 779,8 1198,8 0,09 0,9995 -0,53 0,1120 -0,62 0,0216 37 WBM0709 WBM_RS04335 coprophyrinogen III oxidase 4 773,9 767,6 803,7 0,01 0,9995 -0,05 0,9936 -0,06 0,9727 18 WBM0277...”
- Dual RNAseq analyses at soma and germline levels reveal evolutionary innovations in the elephantiasis-agent Brugia malayi, and adaptation of its Wolbachia endosymbionts
Chevignon, PLoS neglected tropical diseases 2021 - “...WBM_RS01325 preprotein translocase YajC 4 835,5 831,4 1290,6 0,01 0,9995 -0,63 0,2677 -0,64 0,1807 34 WBM0666 WBM_RS04035 dihydrolipoamide acetyltransferase 4 832,3 779,8 1198,8 0,09 0,9995 -0,53 0,1120 -0,62 0,0216 37 WBM0709 WBM_RS04335 coprophyrinogen III oxidase 4 773,9 767,6 803,7 0,01 0,9995 -0,05 0,9936 -0,06 0,9727 18...”
- Identification of putative effectors of the Type IV secretion system from the Wolbachia endosymbiont of Brugia malayi
Carpinone, PloS one 2018 - “...protein S WBM0152 PAL-like S, E WBM0665 ankyrin repeat protein 4 WBM0164 hypothetical, tropomyosin-like E WBM0666 dihydrolipoamide acetyltransferase 4 WBM0165 hypothetical protein U WBM0671 DNA uptake lipoprotein WBM0181 ATP-binding chaperone Bm , 4 WBM0672 hypothetical protein Bm , U WBM0193 hypothetical, tropomyosin-like Bm , E WBM0709...”
SNOD_RS16815 alpha-ketoacid dehydrogenase subunit beta from Streptomyces nodosus
44% identity, 94% coverage
- Comparative Transcriptome Analysis of Streptomyces nodosus Mutant With a High-Yield Amphotericin B
Huang, Frontiers in bioengineering and biotechnology 2020 - “...SNOD_RS06850 phosphoglycerate mutase. (e) SNOD_RS27415 glucose-6-phosphate dehydrogenase. (f) SNOD_RS10480 O-methyltransferase. (g) SNOD_RS16575 6-phosphogluconate dehydrogenase. (h) SNOD_RS16815 pyruvate dehydrogenase. (i) SNOD_RS16810 pyruvate dehydrogenase. (j) SNOD_RS14500 citrate synthase. (k) SNOD_RS29275 TetR/AcrR family transcriptional regulator. (l) SNOD_RS26215 pyruvate carboxylase. (m) Unlabeled gene2 2-oxoglutarate dehydrogenase. (n) SNOD_RS04655 succinate dehydrogenase. (o)...”
M1CK73 Pyruvate dehydrogenase E1 component subunit beta from Solanum tuberosum
43% identity, 85% coverage
GDI_1940 pyruvate dehydrogenase complex E1 component subunit beta from Gluconacetobacter diazotrophicus PA1 5
43% identity, 71% coverage
LOC101204247 pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic from Cucumis sativus
41% identity, 78% coverage
SERP2325 acetoin dehydrogenase, E1 component, beta subunit from Staphylococcus epidermidis RP62A
SERP_RS11425 alpha-ketoacid dehydrogenase subunit beta from Staphylococcus epidermidis RP62A
41% identity, 93% coverage
- Skin-to-blood pH shift triggers metabolome and proteome global remodelling in Staphylococcus epidermidis
Gonçalves, Frontiers in microbiology 2022 - “...SERP2381 Butanoate metabolism Acetoin(diacetyl) reductase SERP2257 budC Diacetyl reductase [(S)-acetoin forming] SERP2379 butA Acetoin dehydrogenase SERP2325 acoA Acetoin dehydrogenase SERP2326 acoB Acetyl-CoA C-acetyltransferase SERP0220 vraB Arginine/Proline metabolism Pyrroline-5-carboxylate reductase SERP1065 proC Proline dehydrogenase SERP1324 putA Nitric oxide synthase oxygenase SERP1451 Ornithine carbamoyltransferase; SERP2351 arcB-2 Carbamate kinase...”
- “...our study we observed a similar response, wherein proteins involved in butanoate pathway (ButA, SERP2257, SERP2325 and SERP2326) were also accumulated at blood pH when compared to skin pH. Overall, our results suggest that there is a higher amount of available cellular energy at pH 7.4...”
- The Vancomycin Resistance-Associated Regulatory System VraSR Modulates Biofilm Formation of Staphylococcus epidermidis in an ica-Dependent Manner
Wu, mSphere 2021 - “...expression of genes related to glycolysis ( gntPKR , glpFKD ), PPP ( serp2324 , serp2325 , sucCD , serp0731 , serp0732 ), the phosphate transport system ( serp2114 , serp2343 , serp2344 , lacFD ), and the carbohydrate metabolic process ( rbsKDU , gluD ,...”
- Deciphering the Antibacterial Mode of Action of Alpha-Mangostin on Staphylococcus epidermidis RP62A Through an Integrated Transcriptomic and Proteomic Approach
Sivaranjani, Frontiers in microbiology 2019 - “...acetyltransferase 1.34 3.30 10 -10 SEA0017 yadH ABC transporter, permease protein 1.98 5.79 10 -10 SERP2325 acoB Acetoin dehydrogenase, E1 component, beta subunit 1.47 1.68 10 -09 SEA0018 ccmA ABC transporter, ATP-binding protein 2.02 3.86 10 -09 SERP0419 Ribosomal subunit interface protein 1.23 8.43 10 -09...”
- PhoU2 but Not PhoU1 as an Important Regulator of Biofilm Formation and Tolerance to Multiple Stresses by Participating in Various Fundamental Metabolic Processes in Staphylococcus epidermidis
Wang, Journal of bacteriology 2017 - “...oxidoreductase subunit beta 0.56 ND serp0856 NC_002976.3 (866995868756) Pyruvate ferredoxin oxidoreductase, alpha subunit 0.44 ND serp2325 NC_002976.3 (23615592362600) Acetoin dehydrogenase, E1 component, beta subunit 0.33 ND serp2327 NC_002976.3 (23636652365018) Acetoin dehydrogenase, E3 component, dihydrolipoamide dehydrogenase 1.55 ND serp1076 NC_002976.3 (11208851122205) 2-Oxoisovalerate dehydrogenase E2 0.51 ND serp1077...”
- AI-2-dependent gene regulation in Staphylococcus epidermidis
Li, BMC microbiology 2008 - “...E3 component, dihydrolipoamide dehydrogenase 0.49 6.18 SERP2326 Acetoin dehydrogenase, E1 component, alpha subunit 0.44 5.24 SERP2325 Acetoin dehydrogenase, E1 component, beta subunit 0.53 4.95 Nitrogen metabolism SERP1980 Nitrite extrusion protein 3.16 0.28 SERP1984 Respiratory nitrate reductase, gamma subunit 2.57 0.47 SERP1985 Respiratory nitrate reductase, delta subunit...”
- The Vancomycin Resistance-Associated Regulatory System VraSR Modulates Biofilm Formation of Staphylococcus epidermidis in an ica-Dependent Manner
Wu, mSphere 2021 - “...dehydrogenase subunit E1 component 0.28 ND SERP_RS11420 NC_002976.3 (23602692361546) Acetoin dehydrogenase subunit E2 0.38 0.110.08 SERP_RS11425 NC_002976.3 (23615602362600) Acetoin dehydrogenase, E1 component, beta subunit 0.16 ND SERP_RS11430 NC_002976.3 (23626712363624) Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.35 ND sdhA NC_002976.3 (21188332119732) l -Serine dehydratase, iron-sulfur-dependent, subunit...”
PAAG_01194 2-oxoisovalerate dehydrogenase subunit beta from Paracoccidioides lutzii Pb01
45% identity, 74% coverage
- Differential Metabolism of a Two-Carbon Substrate by Members of the Paracoccidioides Genus
Baeza, Frontiers in microbiology 2017 - “...(Figure 7 , Supplementary Figure 8 ), as well as the up-regulation of 2-oxovalerate dehydrogenase (PAAG_01194) and methylmalonate-semialdehyde dehydrogenase (PAAG_07036) in Pb 01 and 3-hydroxyisobutyrate dehydrogenase (PADG_03466) and branched-chain amino acid aminotransferase (PADG_04570) in Pb EPM83 (Figure 7 , Supplementary Figure 8 ). The catabolism of...”
- Hemoglobin uptake by Paracoccidioides spp. is receptor-mediated
Bailão, PLoS neglected tropical diseases 2014 - “...Valine and isoleucine biosynthesis 2 PAAG_02554 3-hydroxyisobutyryl-CoA hydrolase 402.87 9.75 0.58 3.1.2.4 Valine degradation 2 PAAG_01194 2-oxoisovalerate dehydrogenase subunit beta 219.86 6.00 *** 1.2.4.4 Valine, leucine and isoleucine degradation 2 PAAG_06096 phospho-2-dehydro-3-deoxyheptonate aldolase 1370.44 9.67 0.66 2.5.1.54 Phenyalanine, tyrosine and tryptophan biosynthesis 2 PAAG_07659 chorismate synthase...”
Q9ZQY3 Pyruvate dehydrogenase E1 component subunit beta from Zea mays
42% identity, 84% coverage
WP_011113733 alpha-ketoacid dehydrogenase subunit beta from Mycoplasmoides gallisepticum str. R(low)
42% identity, 90% coverage
A2Z2Z0 pyruvate dehydrogenase (acetyl-transferring) (subunit 1/2) (EC 1.2.4.1) from Oryza sativa Indica Group (see paper)
42% identity, 85% coverage
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...pyruvate kinase (Q6AVA8, A0A0E0HXE6, Q259K4, A0A0E0IYE1, B8BM17, A0A0E0IZN3, Q8GVP6, and A0A0E0FK16), pyruvate dehydrogenase E1 (Q6Z5N4, A2Z2Z0, A2XPT6, B8B945, Q10G39, and B8BN11), dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0IJD8, Q2QWU7, A0A0E0IC70, and A0A0E0FKX9), acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0FYX8, B8AGW7, and Q5VS74), mitochondrial pyruvate carrier...”
SRIMR7_20000 alpha-ketoacid dehydrogenase subunit beta from Streptomyces rimosus subsp. rimosus
42% identity, 91% coverage
MSMEG_4711 pyruvate dehydrogenase E1 component subunit beta from Mycobacterium smegmatis str. MC2 155
43% identity, 89% coverage
O64688 Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic from Arabidopsis thaliana
AT2G34590 transketolase family protein from Arabidopsis thaliana
40% identity, 79% coverage
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...At5g35360 Enoyl-[acyl-carrier-protein] reductase [NADH] 82, 83 Q9SLA8, At2g05990 Pyruvate dehydrogenase E1 component subunit beta-3 79 O64688, At2g34590 ENERGETICS ATP synthesis ATP synthase subunit alpha 22, 30, 49, 86 P56757, AtCg00120 ATP synthase subunit beta 4345, 49 P19366, AtCg00480 Electron Transfer Adenylate kinase 2 102 Q9FIJ7, At5g47840...”
- Protein Changes in Response to Lead Stress of Lead-Tolerant and Lead-Sensitive Industrial Hemp Using SWATH Technology.
Xia, Genes 2019 - “...in plants [ 40 ]. Only two photosynthetic proteins, pyruvate dehydrogenase E1 component subunit -3 (O64688) and ferredoxin-3 (Q9ZQG8) were downregulated in Pb-stressed Y1. The former converts pyruvate to acetyl-CoA and CO 2 in the Kelvin cycle [ 41 ], while the latter facilitates the excitation...”
- Identification of the Candidate Proteins Related to Oleic Acid Accumulation during Peanut (Arachis hypogaea L.) Seed Development through Comparative Proteome Analysis
Liu, International journal of molecular sciences 2018 - “...fatty acid metabolic process 3 Araip.10021150.1 2.06 Q06588 ACO4 lipid metabolic process 3 Araip.10007105.1 1.42 O64688 E1-BETA-2 lipid metabolic process 3 Araip.10033916.1 1.23 P0DKC6 HSD1 lipid metabolic process 3 Araip.10037384.1 1.11 Q9C8P0 EMB3003 carbohydrate metabolic process 3 Araip.10026147.1 1.34 F4JQJ7 At4g36945 lipid biosynthetic 3 Araip.10023165.1 1.64...”
- Involvement of a universal amino acid synthesis impediment in cytoplasmic male sterility in pepper
Fang, Scientific reports 2016 - “...5.65 37.17 1 0.540.04 0.300.05 F4I6W4 Phosphoglucomutase 117.65 2 662 6.67 72.56 1 1.380.12 0.720.11 O64688 Pyruvate dehydrogenase E1 component subunit beta-3 112.11 2 406 5.03 36.81 1 0.360.06 0.480.05 Q9M8Z7 Sterol 3-beta-glucosyltransferase UGT80A2 91.22 2 637 6.27 69.28 1 0.300.04 0.780.05 Q9FHH2 101 kDa heat...”
- Metabolic network changes during skotomorphogenesis in Arabidopsis thaliana mutant (atdfb-3)
Li, Plant direct 2022 - “...GenBank/EMBL databases under the following accession numbers: AT5G05980 ( AtDFB ), AT3G18780 ( ACTIN2 ), AT2G34590 ( PDHE1 ), AT1G74690 ( KASII ), AT3G25110 ( FatA ), AT4G34520 ( FAE1 ), AT4G29010 ( AIM1 ), AT3G15290 ( HCDH ), AT2G33150 ( KAT2 ), and AT5G48880 (...”
- Heat stress leads to rapid lipid remodeling and transcriptional adaptations in Nicotiana tabacum pollen tubes
Krawczyk, Plant physiology 2022 - “...1.47 5.2 E 06 LOC107790423 A0A1S3ZU33 AT4G13050 FATA2 Acyl-ACP thioesterase A 1.17 0.0166 LOC107818291 A0A1S4CF02 AT2G34590 PDH (E1 beta) Pyruvate dehydrogenase beta subunit 1.57 1.1 E 22 Fatty acid elongation, desaturation and export LOC107791219 A0A1S3ZWG6 AT5G10480 PAS2/HCD Hydroxyacyl-CoA dehydratase 1.14 3.6 E 11 LOC107789797 A0A1S3ZRX0 AT2G28630...”
- Expression of AtWRI1 and AtDGAT1 during soybean embryo development influences oil and carbohydrate metabolism
Arias, Plant biotechnology journal 2022 - “...dehydrogenase 2 Glyma.17G231400 1.3 1.1 1.8 2.0 1.7 1.7 1.8 1.1 1.8 1.9 1608 0.97 AT2G34590 Pyruvate dehydrogenase 1b Glyma.08G024700 2.0 2.1 4.9 1.6 3.5 2.7 4.8 1.8 1.8 1876 0.97 AT5G46290 KetoacylACP Synthase I Glyma.18G211400 1.2 1.8 1.8 1.8 1.7 1.8 1.2 1.6 1.6 2...”
- New Insights into the Chloroplast Outer Membrane Proteome and Associated Targeting Pathways
Fish, International journal of molecular sciences 2022 - “...SPL1 At1g63900 SP1 At1g64850 - At1g68680 - At1g77590 LACS9 At2g01320 WBC7 At2g11810 MGD3 At2g28900 OEP16-1 At2g34590 PDC E1 Beta At2g40690 * G3P Dehydrogenase At2g44640 - At2g47770 TSPO At3g07430 * YlmG Homolog At3g49560 * TIM Protein At3g51870 PAPST1 Homolog At3g62880 OEP16-4 At4g15440 HPL Homolog At4g15810 NTPase At4g16160...”
- High oil accumulation in tuber of yellow nutsedge compared to purple nutsedge is associated with more abundant expression of genes involved in fatty acid synthesis and triacylglycerol storage
Ji, Biotechnology for biofuels 2021 - “...the temporal expression pattern of WRI1 matched that of its potential targets such as PDH- (AT2G34590), BCCP1 (AT5G16390), FAB2 (AT2G43710), FATA (AT3G25110) and FATB (AT1G08510). Unlike oil seed tissues, the maturation master regulators that directly or indirectly control the expression of WRI1 , such as LEAFY...”
- Gel-based proteomic map of Arabidopsis thaliana root plastids and mitochondria
Grabsztunowicz, BMC plant biology 2020 - “...Enoyl-[acyl-carrier-protein] reductase [NADH] 82, 83 Q9SLA8, At2g05990 Pyruvate dehydrogenase E1 component subunit beta-3 79 O64688, At2g34590 ENERGETICS ATP synthesis ATP synthase subunit alpha 22, 30, 49, 86 P56757, AtCg00120 ATP synthase subunit beta 4345, 49 P19366, AtCg00480 Electron Transfer Adenylate kinase 2 102 Q9FIJ7, At5g47840 Ferredoxin-NADP...”
- “...63, and 47, 48 and 50, respectively, while E1, the beta-3 subunit of pyruvate dehydrogenase (At2g34590) was detected in spot 79 (Table 1 ). Acetyl-CoA, in turn, is further used in various processes, such as fatty acid biosynthesis (see below). In non-photosynthetic plastids (as well as...”
- Redox Conformation-Specific Protein-Protein Interactions of the 2-Cysteine Peroxiredoxin in Arabidopsis
Liebthal, Antioxidants (Basel, Switzerland) 2020 - “...Probable protein phosphatase 2C 62 (AT4G33500) Plastocyanin major isoform (AT1G20340) Pyruvate dehydrogenase E1 subunit beta-3 (AT2G34590) Red chlorophyll catabolite reductase (AT4G37000) Single-stranded DNA-binding protein WHY1 (AT1G14410) Ribose-P pyrophosphokinase 3 (AT1G10700) Transaldolase-like protein (AT1G12230) Starch synthase 3 (AT1G11720) Uncharacterized protein (AT2G27680) Stearoyl-[acyl-carrier-protein] 9-desaturase 5 (AT3G02630) Thiosulfate sulfurtransferase...”
- Characterization of siRNAs clusters in Arabidopsis thaliana galls induced by the root-knot nematode Meloidogyne incognita
Medina, BMC genomics 2018 - “...Member of the CYP708A family of cytochrome P450 enzymes (CYP708A2) 0.8 No No chr2:1457219014,572,294 down At2g34590 transketolase family protein 0.8 1.1 0.7 These DC-clusters were all shared by galls and roots and located in promoter regions and with expression patterns inversely correlated with those of the...”
- “...ATCOPIA3I 1.0000 ATCOPIA3LTR chr2:12813921,281,621 down At2g04030 Chaperone protein htpG family 1.0 0.9291 ATREP13 chr2:1457170614,572,100 down At2g34590 Transketolase family protein 0.8 0.9466 ATREP1 chr2:1457219014,572,294 down At2g34590 0.9505 ATREP1 chr2:1559503315,595,856 down At2g37120 S1FA-like DNA-binding protein 0.8 0.9756 ATMU7 0.9863 ATMU7 chr2:89390018,939,617 down At2g20750 expansin B1 0.7 0.7231 BRODYAGA1A...”
- More
P27746 acetoin dehydrogenase system (EC 2.3.1.190) from Alcaligenes eutrophus H16 (see paper)
acoB / AAA21949.1 acetoin:DCPIP oxidoreductase-beta from Cupriavidus necator (see paper)
H16_B0145 acetoin dehydrogenase E1 component beta-subunit from Ralstonia eutropha H16
H16_B0145 alpha-ketoacid dehydrogenase subunit beta from Cupriavidus necator H16
45% identity, 90% coverage
JV35_11990 alpha-ketoacid dehydrogenase subunit beta from Pectobacterium betavasculorum
43% identity, 94% coverage
XP_811646 pyruvate dehydrogenase E1 beta subunit, putative from Trypanosoma cruzi
41% identity, 88% coverage
- Subcellular proteomics of Trypanosoma cruzi reservosomes
Sant'Anna, Proteomics 2009 - “...peptidase, beta subunit XP_816361 Mitochondrial processing peptidase activity N 110 Pyruvate dehydrogenase E1 beta subunit XP_811646 Pyruvate dehydrogenase (acetyl-transferring) activity N 111 Succinyl-coa ligase [GDP-forming] beta-chain XP_802641 Succinate-CoA ligase (GDP-forming) activity N 112 P22 protein precursor XP_813311 Transcription regulator activity N 113 ADP, ATP carrier protein...”
pdhB / P75391 β subunit from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (see 3 papers)
MPN392 pyruvate dehydrogenase E1-beta subunit from Mycoplasma pneumoniae M129
P75391 Pyruvate dehydrogenase E1 component subunit beta from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
43% identity, 97% coverage
- Exploring the adaptability and robustness of the central carbon metabolism of Mycoplasma pneumoniae
Zondervan, 2022 - Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen
Gründel, PloS one 2015 - “...(E3; PDHD). The components are encoded by the genes pdhA ( mpn393 ), pdhB ( mpn392 ), pdhC ( mpn391 ) and pdhD ( mpn390 ) [ 4 ]. These are organized in two operons encoding for the E1 and E1 subunits and the other for...”
- “...AGT TAC GAA GCA ATG C MpPDHAr GAT AGA TCC ATT GCG TTA CCC PDHB (mpn392) MpPDHBf1 GTT GAC TCC TGA TCT AGC GC MpPDHBf2 CAT GCC AAT GGG TGG TG MpPDHBf3 GGG TAA CGC AAT GGA TCT AG MpPDHBf4 GGA CAA GGG CAT TGA ACT...”
- Network of Surface-Displayed Glycolytic Enzymes in Mycoplasma pneumoniae and Their Interactions with Human Plasminogen
Gründel, Infection and immunity 2015 - “...Yes Yes No Yes Yes Yes Yes Internal helix* mpn392 1 35.9 Yes mpn391 0 42.4 Yes Surface displayed, binds human Plg and fibronectin (25-27) Surface displayed,...”
- Systematic Structural Analyses of Attachment Organelle in Mycoplasma pneumoniae
Nakane, PLoS pathogens 2015 - “...study (categories III and IV). Six proteins in category IV, PtsG (MPN207), OppF (MPN218), PdhB (MPN392), PdhA (MPN393), GlyA (MPN576), and Tuf (MPN665), have been known to be a part of large complexes involved in cell metabolism, which likely remained in the core fraction [ 27...”
- Characterization of pyruvate dehydrogenase subunit B and enolase as plasminogen-binding proteins in Mycoplasma pneumoniae
Thomas, Microbiology (Reading, England) 2013 (PubMed)- “...enolase (Mpn606) and pyruvate dehydrogenase subunit B (Mpn392; PDHB) of M. pneumoniae show concentration-dependent binding to human plasminogen. Monospecific...”
- “...italic sequences, mutation of TGA to TGG. Target PdhB (MPN392) Enolase (MPN606) pET vector Oligonucleotide Sequence (5A3) MpPdhBf1 GTT GAC TCC TGA TCT AGC GC...”
- Dissecting the energy metabolism in Mycoplasma pneumoniae through genome-scale metabolic modeling
Wodke, Molecular systems biology 2013 - “...performed using Illustrabacteria genomic KIT (GE). The disruptive insertions in genes mpn133 , mpn321 , mpn392 , mpn533 , and mpn595 were detected by PCR ( Supplementary Figure S7 ). The fragments corresponding to junctions between the genes and the mini-transposon were amplified using the primer...”
- Identification, expression and serological evaluation of the recombinant ATP synthase beta subunit of Mycoplasma pneumoniae
Nuyttens, BMC microbiology 2010 - “...14 45 6.1 49.3 4 MPN598 ATP synthase beta subunit 29 80 5.4 52.3 5 MPN392 Pyruvate dehydrogenase E1 subunit 21 57 6.2 40.6 6 MPN025 Fructose bisphosphate aldolase 10 44 6.4 31.3 a Antigenic proteins were separated by 2-DE, and their identities were determined by...”
- The phosphoproteome of the minimal bacterium Mycoplasma pneumoniae: analysis of the complete known Ser/Thr kinome suggests the existence of novel kinases
Schmidl, Molecular & cellular proteomics : MCP 2010 - “...MPN311b MPN322 MPN324 MPN331 MPN349 MPN389 MPN390 MPN391 MPN392 MPN393 MPN394 MPN420 MPN425 MPN428 MPN429 MPN430 MPN434 MPN452b MPN470 MPN474b MPN495 Molecular...”
- More
- Intracellular proteins moonlighting as bacterial adhesion factors
Jeffery, AIMS microbiology 2018 - “...mutase Bifidobacterium lactis P59159 plasminogen [81] Streptococcus oralis E6IYJ0 plasminogen [78] Pyruvate dehydrogenase Mycoplasma pneumoniae P75391 fibrinogen [36] Pyruvate kinase Lactococcus lactis Q07637 yeast invertase [54] Superoxide dismutase Mycobacterium avium P53647 adhesin [98] Triose phosphate isomerase Streptococcus oralis E6J203 plasminogen [78] 6. Conclusions The large number...”
B0XA87 Pyruvate dehydrogenase E1 component subunit beta from Culex quinquefasciatus
41% identity, 90% coverage
- Comparative proteomics reveals mechanisms that underlie insecticide resistance in Culex pipiens pallens Coquillett
Zhang, PLoS neglected tropical diseases 2021 - “...1 alpha subcomplex subunit 5 (B0WLS3), ubiquinol-cytochrome c reductase complex core protein (B0WXM0), pyruvate dehydrogenase (B0XA87), mitochondrial malate dehydrogenase 2 (B0WMC8), malate dehydrogenase (B0W5T5), ATP synthase delta chain, mitochondrial (B0WYE7), NADH:ubiquinone dehydrogenase (B0WA75, B0W7N4), NADH-ubiquinone oxidoreductase B8 (B0WUY1), cytochrome c oxidase, -subunit VIb (B0WY92), NADH dehydrogenase...”
P52904 pyruvate dehydrogenase system (subunit 3/3) (EC 1.2.1.104) from Pisum sativum (see paper)
42% identity, 89% coverage
A9P841 Pyruvate dehydrogenase E1 component subunit beta from Populus trichocarpa
41% identity, 81% coverage
SMU_1422 alpha-ketoacid dehydrogenase subunit beta from Streptococcus mutans UA159
39% identity, 93% coverage
ODPB_DROME / Q7K5K3 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; EC 1.2.4.1 from Drosophila melanogaster (Fruit fly) (see paper)
41% identity, 88% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2) (By similarity). Might play a role in regulating synapse structure formation at neuromuscular junctions (PubMed:29501567). Might play a role in maintenance of mitochondrial morphology (PubMed:29501567).
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
disruption phenotype: RNAi-mediated knockdown in neurons reduces life span of adult flies and results in locomotor defects at both larval and adult stages accompanied by abnormal morphology of motor neuron terminals at neuromuscular junctions and mitochondrial fragmentation in brains (PubMed:29501567). RNAi-mediated knockdown in eye disks induces morphologically aberrant rough eye phenotype in adults and aberrant photoreceptor axon targeting (PubMed:29501567). - Pterostilbene Promotes Mean Lifespan in Both Male and Female Drosophila Melanogaster Modulating Different Proteins in the Two Sexes
Beghelli, Oxidative medicine and cellular longevity 2022 - “...0.7 0.00068 2080 E1JHR5 Eno Enolase 42 19 15 46.6 6.55 73 0.48 0.000096 2731 Q7K5K3 Pdhb Pyruvate dehydrogenase E1 component subunit beta 34 17 12 39.3 7.8 60 0.56 0.00012 MALES 649 Q7KN97 PCB Pyruvate carboxylase 61 92 65 130.8 6.81 312 1.5 0.001 650...”
- Lipid metabolic perturbation is an early-onset phenotype in adult spinster mutants: a Drosophila model for lysosomal storage disorders
Hebbar, Molecular biology of the cell 2017 - “...6 Q9W4H6 GM13002p/pyruvate dehydrogenase CG7010 7 Q7KVX1 Lethal (1) G0334, isoform C/pyruvate dehydrogenase CG7010 8 Q7K5K3 GH08474p/ pyruvate dehydrogenase (acetyl-transferring) activity CG11876 9 P41572 6-Phosphogluconate dehydrogenase CG3724 10 P52029 Glucose-6-phosphate isomerase CG8251 11 P52034 6-Phosphofructokinase CG6001 12 Q9VHN7 CG8036, isoform B/transketolase CG8036 13 Q9V496 Apolipophorin CG11064...”
B8B945 Pyruvate dehydrogenase E1 component subunit beta from Oryza sativa subsp. indica
41% identity, 85% coverage
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...(Q6AVA8, A0A0E0HXE6, Q259K4, A0A0E0IYE1, B8BM17, A0A0E0IZN3, Q8GVP6, and A0A0E0FK16), pyruvate dehydrogenase E1 (Q6Z5N4, A2Z2Z0, A2XPT6, B8B945, Q10G39, and B8BN11), dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0IJD8, Q2QWU7, A0A0E0IC70, and A0A0E0FKX9), acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0FYX8, B8AGW7, and Q5VS74), mitochondrial pyruvate carrier (A0A0E0HZY5 and...”
Q6Z1G7 Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial from Oryza sativa subsp. japonica
41% identity, 85% coverage
- Physiological and Proteomic Analysis of Various Priming on Rice Seed under Chilling Stress
Zhang, Plants (Basel, Switzerland) 2024 - “...Q7XHW4 Probable calcium-binding protein 5.468 7.842 UP Os06g0569500 Q0DBF4 Ent-sandaracopimaradiene 3-hydroxylase 6.003 7.766 UP Os08g0536000 Q6Z1G7 Pyruvate dehydrogenase E1 component subunit 0.010 0.063 Down Os11g0123400 A0A0N7KSC9 CTP:phosphoethanolamine cytidylyltransferase 0.010 0.010 Down Os05g0595100 Q8LNZ3 UDP-glucose 4-epimerase 0.296 0.314 Down Os02g0785800 Q6K8U8 Similar to Ribosomal protein L35A. 0.448...”
- Proteomic and Metabolic Analysis of Pinus halepensis Mill. Embryonal Masses Induced under Heat Stress
Pereira, International journal of molecular sciences 2023 - “...P35480 Brassica napus 2.84 2.13 2.01 0.025 1.08 Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial Q6Z1G7 Oryza sativa subsp. japonica 1.21 1.18 1.28 0.034 2.47 Chalcone synthase P30079 Pinus sylvestris 2.02 1.60 3.19 0.031 1.95 Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial Q2R2Z0 Oryza sativa subsp. japonica 1.18...”
- Comparative transcriptome analysis provides novel insights into molecular response of salt-tolerant and sensitive polyembryonic mango genotypes to salinity stress at seedling stage
Perveen, Frontiers in plant science 2023 - “...0.354492 37.29929 -6.65077 P60112 ATP synthase subunit 9, mitochondrial A. thaliana Cluster-5747.4204 0.462922 49.36202 -6.67 Q6Z1G7 Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial Oryza sativa subsp. japonica Cluster-5747.9055 0.519568 33.75501 -5.95557 Q1WIQ6 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase A. thaliana Cluster-5747.4574 0.154463 8.217138 -5.66746 P29130 Phytochrome B N. tabacum...”
- Transcriptome and Proteome Association Analysis to Screen Candidate Genes Related to Salt Tolerance in Reaumuria soongorica Leaves under Salt Stress.
Liu, Plants (Basel, Switzerland) 2023 - “...1.63 up Transmembrane ascorbate ferrireductase 1 Q08507 ACO3 1.09 up 1.64 up 1-aminocyclopropane-1-carboxylate oxidase 3 Q6Z1G7 Os08g42410 1.20 up 1.65 up Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial Q94JX5 WLIM1 1.10 up 1.73 up LIM domain-containing protein WLIM1 Q9SXA6 ENDO1 1.79 up 1.78 up Endonuclease 1...”
- Proteomic Changes in Paspalum fasciculatum Leaves Exposed to Cd Stress
Salas-Moreno, Plants (Basel, Switzerland) 2022 - “...adenylyltransferase large subunit 1 55.392 17.4168297 Oryza sativa subsp. japonica 1.1 8.3 Chloroplast, amyloplast 57 Q6Z1G7 Pyruvate dehydrogenase E1 component subunit beta-1 39.919 15.2406417 Oryza sativa subsp. japonic 8.9 0 Mitochondrion Antioxidant defense and stress response 58 P38559 Glutamine synthetase root isozyme 1 39.226 24.6498599 Zea...”
- Omics Profiles of Non-transgenic Scion Grafted on Transgenic RdDM Rootstock.
Kodama, Food safety (Tokyo, Japan) 2022 - “...P40619 7.96 TMK3_ARATH Receptor-like kinase TMK3 Q9SIT1 6.85 ODPB1_ORYSJ Pyruvate dehydrogenase E1 component subunit beta-1 Q6Z1G7 6.16 * BT4_ARATH BTB/POZ and TAZ domain-containing protein 4 Q9FJX5 6.14 ATL3_ARATH RING-H2 finger protein ATL3 Q9XF63 6.14 YAC4_SCHPO Putative general negative regulator of transcription C16C9.04c Q09818 6.11 KN7O_ARATH Kinesin-like...”
- Proteome-Wide Analysis of Heat-Stress in Pinus radiata Somatic Embryos Reveals a Combined Response of Sugar Metabolism and Translational Regulation Mechanisms.
Castander-Olarieta, Frontiers in plant science 2021 - “...0.018 2.11 Adenosylhomocysteinase P68173 0.93 0.22 0.24 0.018 1.98 Pyruvate dehydrogenase E1 component subunit beta-1 Q6Z1G7 0.89 0.69 0.78 0.02 2.27 Ribulose bisphosphate carboxylase/oxygenase activase A Q40073 0.68 0.52 0.77 0.02 2.35 Sugar transporter ESL1 Q94KE0 1.19 1.77 1.49 0.021 1.85 Casein kinase II subunit alpha-2...”
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...aldolase (Q652S1), and pyruvate dehydrogenase E1 component subunit alpha-1 proteins (Q6AVA8, Q6Z5N4, Q654V6, Q2QM55, Q0J0H4, Q6Z1G7, Q7XTJ3, and Q10G39) with a degree greater than 23 ( Supplementary file 2 ). Some proteins including Putative cold shock protein-1 (Q84UR8), probable pyruvate, phosphate dikinase regulatory protein, chloroplastic (Q8GVP6),...”
- More
PF3D7_0504600 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, putative from Plasmodium falciparum 3D7
42% identity, 82% coverage
LOC107818291 pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic from Nicotiana tabacum
40% identity, 78% coverage
GOX2290 Pyruvate dehydrogenase E1 component beta subunit from Gluconobacter oxydans 621H
41% identity, 71% coverage
- Global mRNA decay and 23S rRNA fragmentation in Gluconobacter oxydans 621H
Kranz, BMC genomics 2018 - “...pyruvate dehydrogenase E1 component alpha subunit (GOX2289); aceE , pyruvate dehydrogenase E1 component beta subunit (GOX2290); aceF , dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase (GOX2291); acn , aconitate hydratase (GOX1335); ald , aldehyde dehydrogenase (GOX2018); eda , KDPG aldolase (GOX0430); edd , phosphogluconate dehydratase (GOX0431); eno...”
Tfu_0181 putative branched-chain alpha keto acid dehydrogenase E1 beta subunit from Thermobifida fusca YX
42% identity, 94% coverage
- The Effects of Carbon Source and Growth Temperature on the Fatty Acid Profiles of Thermobifida fusca
Winkelman, Frontiers in molecular biosciences 2022 - “...Branched chain amino acid aminotransferase Tfu_0616, Tfu_2112 BCAD Branched Chain alpha keto acid dehydrogenase Tfu_0180, Tfu_0181, Tfu_0182 Des1 Delta-9 acyl-CoA desaturase Tfu_0413 BfaB 9 unsaturated fatty acid methyl transferase Tfu_2160 BfaA 10-methylene BCFA reductase Tfu_2161 PDH Pyruvate Dehydrogenase Complex Tfu_3049, Tfu_3050, Tfu_3051 ACK Acetate Kinase Tfu_2971...”
- “...for both the branched chain aminotransferase (Tfu_0616, Tfu_2112) and branched chain -keto acid dehydrogenase (Tfu_0180, Tfu_0181, Tfu_0182) enzymes required to generate isobutyryl-CoA and 2-methylbutyryl-CoA from valine, leucine, or isoleucine. Alternatively, these branched chain acyl-CoAs may be generated from the -keto acids that are intermediates of branched...”
D2VRL5 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) from Naegleria gruberi
43% identity, 90% coverage
G8BIM8 Pyruvate dehydrogenase E1 component subunit beta from Candida parapsilosis (strain CDC 317 / ATCC MYA-4646)
CPAR2_402950 uncharacterized protein from Candida parapsilosis
41% identity, 83% coverage
- Proteomics Readjustment of the Yarrowia lipolytica Yeast in Response to Increased Temperature and Alkaline Stress
Sekova, Microorganisms 2021 - “...protein 70 family G8BL45 146/13/26 30/5 61/5.0 65 CPAR2_402950, Pyruvate dehydrogenase E1 component subunit beta G8BIM8 142/3/10 40/5 42.1/5.0 66 hsp70 chaperone, heat shock protein 70 family H8X9S4 132/9/38 23/5 22.7/5.7 * S/M/Cthe Mascot Score is an indicator of conformity or scorecard; match peptides are the...”
- Proteomics Readjustment of the Yarrowia lipolytica Yeast in Response to Increased Temperature and Alkaline Stress
Sekova, Microorganisms 2021 - “...metabolism, the ATP synthase subunit (No. 55, CPAR2_503440) and the pyruvate dehydrogenase subunit (No. 65, CPAR2_402950) were revealed ( Figure S4B ). Moreover, a 12 kDa fragment of 36 kDa glyceraldehyde-3-phosphate dehydrogenase CPAR2_808670 was identified (No. 60), and two 12 kDa fragments of two different carbonyl...”
- “...contains SBDS-domain protein CPAR2_406210 involved in the ribosomes genesis, and a fragment of pyruvate dehydrogenase CPAR2_402950, were other original proteins for the combined stress. The -1 elongation factor of the cytosolic GTPase was the only common protein for heat and combined stress. Moreover, under heat stress,...”
Tfu_3050 dehydrogenase complex, E1 component, beta subunit from Thermobifida fusca YX
44% identity, 98% coverage
- The Effects of Carbon Source and Growth Temperature on the Fatty Acid Profiles of Thermobifida fusca
Winkelman, Frontiers in molecular biosciences 2022 - “...fatty acid methyl transferase Tfu_2160 BfaA 10-methylene BCFA reductase Tfu_2161 PDH Pyruvate Dehydrogenase Complex Tfu_3049, Tfu_3050, Tfu_3051 ACK Acetate Kinase Tfu_2971 ACS-AMP AMP-Forming Acetyl-CoA Synthetase Tfu_1546, Tfu_2808, Tfu_2856 ACS-ADP ADP-Forming Acetyl-CoA Synthetase Tfu_1302, Tfu_1473 CCL Citryl-CoA lyase Tfu_0341, Tfu_1285, Tfu_1313 ALS Acetolactate synthase Tfu_0611, Tfu_0612 FIGURE...”
- “...), including the oxidative decarboxylation of pyruvate catalyzed by the pyruvate dehydrogenase complex (PDH) (Tfu_3049, Tfu_3050, Tfu_3051). Alternatively, acetyl-CoA can be generated through the activation of acetate catalyzed by: 1) an acetate kinase (Tfu_2971); 2) an AMP-forming acetyl-CoA synthetase (Tfu_1546, Tfu_2808, Tfu_2856); or 3) an ADP-forming...”
PDIP_79790 3-methyl-2-oxobutanoate dehydrogenase, putative from Penicillium digitatum
43% identity, 66% coverage
- Effects of Peptide Thanatin on the Growth and Transcriptome of Penicillium digitatum
Feng, Frontiers in microbiology 2020 - “...2.03 (up) 26234787 PDIP_64710 Mitochondrial Hsp70 chaperone (Ssc70), putative 1.42 (up) Amino acid metabolism 26236295 PDIP_79790 3-methyl-2-oxobutanoate dehydrogenase, putative 0.33 (down) 26236923 PDIP_86090 Biotin-dependent 2-oxo acid dehydrogenases acyltransferase, putative 0.37 (down) Effect of Thanatin on P. digitatum DNA and RNA Synthesis To identify potential effect of...”
Q93619 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) from Caenorhabditis elegans
43% identity, 84% coverage
- A proteomic view of Caenorhabditis elegans caused by short-term hypoxic stress
Li, Proteome science 2010 - “...a/b/d/f. lev-11 94 Q22866-1 32984 4.66 0.037 2 Protein F27D4.5, confirmed by transcript evidence.tag-173 177 Q93619 40027 6.22 0.028 3 Isoform a of probable arginine kinase. F46H5.3 152 Q10454-1 44140 6.84 0.002 5 Myosin regulatory light chain 1. mlc-1 496 P19625 18605 5.06 0.004 6 Fatty-acid...”
SSPN_RS0119520 alpha-ketoacid dehydrogenase subunit beta from Saccharopolyspora spinosa NRRL 18395
41% identity, 95% coverage
ADK66_07235 alpha-ketoacid dehydrogenase subunit beta from Micromonospora sp. NRRL B-16802
43% identity, 94% coverage
- Characterization of the aurantimycin biosynthetic gene cluster and enhancing its production by manipulating two pathway-specific activators in Streptomyces aurantiacus JA 4570
Zhao, Microbial cell factories 2016 - “...Orf8 77 XP_008613423 Dihydrolipoamide succinyltransferase SDRG_09281, Saprolegnia diclina VS20 44/62 Orf9 326 KOX10942 2-Oxoisovalerate dehydrogenase ADK66_07235, Micromonospora sp. NRRL B-16802 50/64 Orf10 279 KTF47288 3-Methyl-2-oxobutanoate dehydrogenase APS67_01220, Streptomyces sp. AVP053U2 86/91 ArtA 71 KOG32626 MbtH-like protein ADK37_26530, Streptomyces resistomycificus 87/94 ArtB 240 KUN90566 Putative regulator AQJ84_39630,...”
- “...containing protein. Within the art gene cluster, orf9 codes for a 2-oxoisovalerate dehydrogenase homolog to ADK66_07235 of Micromonospora sp. NRRL B-16802 (identity/similarity, 50/64%), and orf10 for a 3-methyl-2-oxobutanoate dehydrogenase to APS67_01220 from Streptomyces sp. AVP053U2 (identity/similarity, 89/91%), and they might mediate the previous acylation reaction. Then...”
Q7T368 Pyruvate dehydrogenase E1 component subunit beta from Danio rerio
42% identity, 84% coverage
RHA1_RS16390 alpha-ketoacid dehydrogenase subunit beta from Rhodococcus jostii RHA1
42% identity, 93% coverage
Q2QM55 Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic from Oryza sativa subsp. japonica
41% identity, 82% coverage
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...fructose/tagatose bisphosphate aldolase (Q652S1), and pyruvate dehydrogenase E1 component subunit alpha-1 proteins (Q6AVA8, Q6Z5N4, Q654V6, Q2QM55, Q0J0H4, Q6Z1G7, Q7XTJ3, and Q10G39) with a degree greater than 23 ( Supplementary file 2 ). Some proteins including Putative cold shock protein-1 (Q84UR8), probable pyruvate, phosphate dikinase regulatory protein,...”
- A Quantitative Acetylomic Analysis of Early Seed Development in Rice (Oryza sativa L.)
Wang, International journal of molecular sciences 2017 - “...coincide with the deposition of storage reserves [ 37 ]. As expected, a PDC component (Q2QM55) was down-acetylated during the early development of seeds ( Table S2 ), suggesting that the PDC activity could be controlled by acetylation modification. Due to the decreased flux through the...”
MG_273 pyruvate dehydrogenase component E1, beta subunit from Mycoplasma genitalium G37
P47515 Pyruvate dehydrogenase E1 component subunit beta from Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
42% identity, 97% coverage
- Transcriptional response of Mycoplasma genitalium to osmotic stress
Zhang, Microbiology (Reading, England) 2011 - “...0.00136 MG_255 Conserved hypothetical protein 2.82 0.00079 0.00136 MG_270 Lipoyltransferase/lipoate-protein ligase, putative 2.32 0.00002 0.00136 MG_273 pdhB Pyruvate dehydrogenase component E1, beta subunit 2.11 0.00082 0.00136 MG_274 pdhA Pyruvate dehydrogenase component E1, alpha subunit 2.80 0.00001 0.00136 MG_275 nox NADH oxidase 4.24 0.00001 0.00136 MG_299 pta...”
- Subtractive Genomics Approach for Identification of Novel Therapeutic Drug Targets in Mycoplasma genitalium
Fatoba, Pathogens (Basel, Switzerland) 2021 - “...subunit K03076 mge02024-Quorum-sensing, mge03070-Bacterial-secretion-system P47489 Glycerol-3-phosphate acyltransferase K08591 mge01110-Biosynthesis-of-secondary-metabolites P47514 Dihydrolipoyllysine-residue acetyltransferase K00627 mge01110-Biosynthesis-of-secondary-metabolites, mge01120-Microbial-metabolism-in-diverse-environments P47515 Pyruvate dehydrogenase E1 component subunit beta K00162 mge01110-Biosynthesis-of-secondary-metabolites, mge01120-Microbial-metabolism-in-diverse-environments P47516 Pyruvate dehydrogenase E1 component subunit alpha K00161 mge01110-Biosynthesis-of-secondary-metabolites, mge01120-Microbial-metabolism-in-diverse-environments P47529 Acyl carrier protein homolog K02078 mge01110-Biosynthesis-of-secondary-metabolites P47541 Phosphate acetyltransferase K00625...”
- “...acid DB03042 Experimental P47514 NADH DB00157 Approved Cytoplasmic Radicicol DB03758 Experimental Dihydrolipoic acid DB03760 Experimental P47515 Pyruvic acid DB00119 Approved Cytoplasmic NADH DB00157 Approved P47516 NADH DB00157 Approved Cytoplasmic P47541 Acetylphosphate DB02897 Experimental Cytoplasmic P47599 Formic acid DB01942 Experimental Cytoplasmic Adenosine-5-[Beta, Gamma-Methylene]Triphosphate DB03909 Experimental P47636 L-cysteic...”
APA386B_2737 pyruvate dehydrogenase complex E1 component subunit beta from Acetobacter pasteurianus 386B
41% identity, 70% coverage
AL01_00920 pyruvate dehydrogenase complex E1 component subunit beta from Bombella intestini
43% identity, 69% coverage
- Whole-Genome Sequence Analysis of Bombella intestini LMG 28161T, a Novel Acetic Acid Bacterium Isolated from the Crop of a Red-Tailed Bumble Bee, Bombus lapidarius
Li, PloS one 2016 - “...9, enolase (AL01_00860); 10, pyruvate kinase (AL01_00625); 11, malate dehydrogenase (AL01_05845); 12, pyruvate dehydrogenase (AL01_00915, AL01_00920, AL01_03860); 13, pyruvate dehydrogenase E2 (AL01_00925); 14, dihydrolipoamide dehydrogenase (AL01_00930); 15, lactate dehydrogenase (AL01_06935); 16, hydroxyacylglutathione hydrolase (AL01_04950); 17, lactoylgluthathione lyase (AL01_00090); 18, pyruvate decarboxylase (AL01_08375); 19, alcohol dehydrogenase (AL01_01980,...”
SPRG_00756 pyruvate dehydrogenase E1 component subunit beta from Saprolegnia parasitica CBS 223.65
42% identity, 86% coverage
RHA1_ro03320 pyruvate dehydrogenase E1 component beta subunit from Rhodococcus sp. RHA1
RHA1_RS16095 alpha-ketoacid dehydrogenase subunit beta from Rhodococcus jostii RHA1
43% identity, 95% coverage
- Nutrient starvation leading to triglyceride accumulation activates the Entner Doudoroff pathway in Rhodococcus jostii RHA1
Juarez, Microbial cell factories 2017 - “...protein RHA1_ro03412 1295 183 0.142 Hypothetical protein RHA1_ro02813 65,807 9173 0.139 Probable NADP dependent oxidoreductase RHA1_ro03320 27,980 3784 0.135 Pyruvate dehydrogenase E1 component beta subunit RHA1_ro04380 9371 1267 0.135 Probable multidrug resistance transporter, MFS superfamily RHA1_ro01994 57,602 7661 0.133 Probable succinate-semialdehyde dehydrogenase (NAD(P)+) RHA1_ro05024 76,619 10,173...”
- Discovery of potential pathways for biological conversion of poplar wood into lipids by co-fermentation of Rhodococci strains
Li, Biotechnology for biofuels 2019 - “...and induced the up-regulation of proteins involved in -oxidation [ 51 ]. Meanwhile, several components (RHA1_RS16095, RHA1_RS16390, RHA1_RS07665, RHA1_RS16100, PD630_LPD07580, PD630_LPD07579) of the pyruvate dehydrogenase complex (PDC)1 which link the glycolysis pathway to the TCA cycle were up-regulated. This is possibly regulated by the lack of...”
Q10G39 Pyruvate dehydrogenase E1 component subunit beta-4, chloroplastic from Oryza sativa subsp. japonica
LOC4333564 pyruvate dehydrogenase E1 component subunit beta-4, chloroplastic from Oryza sativa Japonica Group
40% identity, 80% coverage
- Proteomic and Metabolic Analysis of Pinus halepensis Mill. Embryonal Masses Induced under Heat Stress
Pereira, International journal of molecular sciences 2023 - “...sativa subsp. japonica 1.02 1.18 1.29 0.042 2.57 Pyruvate dehydrogenase E1 component subunit beta-4, chloroplastic Q10G39 Oryza sativa subsp. japonica 0.80 1.48 1.63 0.025 2.13 3-isopropylmalate dehydrogenase, chloroplastic P29696 Solanum tuberosum 0.82 1.32 1.46 0.038 2.35 Trifunctional UDP-glucose 4.6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3.5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 Q9SYM5 Arabidopsis thaliana 0.68 1.49...”
- Programmed Editing of Rice (Oryza sativa L.) OsSPL16 Gene Using CRISPR/Cas9 Improves Grain Yield by Modulating the Expression of Pyruvate Enzymes and Cell Cycle Proteins
Usman, International journal of molecular sciences 2020 - “...A0A0E0HXE6, Q259K4, A0A0E0IYE1, B8BM17, A0A0E0IZN3, Q8GVP6, and A0A0E0FK16), pyruvate dehydrogenase E1 (Q6Z5N4, A2Z2Z0, A2XPT6, B8B945, Q10G39, and B8BN11), dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0IJD8, Q2QWU7, A0A0E0IC70, and A0A0E0FKX9), acetyltransferase component of pyruvate dehydrogenase complex (A0A0E0FYX8, B8AGW7, and Q5VS74), mitochondrial pyruvate carrier (A0A0E0HZY5 and B8BEY3),...”
- “...pyruvate dehydrogenase E1 component subunit alpha-1 proteins (Q6AVA8, Q6Z5N4, Q654V6, Q2QM55, Q0J0H4, Q6Z1G7, Q7XTJ3, and Q10G39) with a degree greater than 23 ( Supplementary file 2 ). Some proteins including Putative cold shock protein-1 (Q84UR8), probable pyruvate, phosphate dikinase regulatory protein, chloroplastic (Q8GVP6), cell division inhibitor-like...”
- Integrative analysis of transcriptome and metabolism reveals potential roles of carbon fixation and photorespiratory metabolism in response to drought in Shanlan upland rice
Zhou, BMC genomics 2022 - “...small chain LOC4334316 1.82 1.11 RPI1, Ribose-5-phosphate isomerase 4 LOC4327400 1.67 0.67 TPIC, Triosephosphate isomerase LOC4333564 2.56 0.07 TRK1, Pyruvate dehydrogenase E1 LOC4330649 1.39 0.24 GST1, glutamine synthetase cytosolic isozyme 1 Fig. 6 Changes of 40 metabolites in two Shanlan upland rice lines exposed to drought...”
- “...1.7-fold including GYD1 (LOC107277781), while the expression of gene involved in Calvin cycle including TRK1 (LOC4333564) were inhibited by up to 2.5-fold in SL1, suggesting DS induced the imbalance of carbon assimilation and photorespiration in SL1 but not SL10. In addition, it was also found that...”
ODPB_SCHPO / Q09171 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
pdb1 / RF|NP_596272.1 pyruvate dehydrogenase e1 component beta subunit Pdb1; EC 1.2.4.1 from Schizosaccharomyces pombe (see paper)
SPBC30D10.13c pyruvate dehydrogenase e1 component beta subunit Pdb1 from Schizosaccharomyces pombe
42% identity, 87% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Tetramer of 2 alpha and 2 beta subunits - CharProtDB Source (per GeneDB): GeneDB_Spombe
- Plant mitochondrial pyruvate dehydrogenase complex: purification and identification of catalytic components in potato
Millar, The Biochemical journal 1998 - “...U09137), and Schizosaccharomyces pombe (accession number SP Q09171) encoding the E1 subunit of mPDC. Pyruvate dehydrogenase complex from potato mitochondria...”
- Absolute proteome and phosphoproteome dynamics during the cell cycle of Schizosaccharomyces pombe (Fission Yeast)
Carpy, Molecular & cellular proteomics : MCP 2014 - “...study) Ratio (this study) SPAC26F1.03 SPBC30D10.13c SPAC16E8.17c SPCC1620.08 SPAC4A8.11c SPAC926.09c SPAC12B10.07 SPAC631.01c SPAC14C4.14 SPAC222.12c Pyruvate...”
- Yeast Augmented Network Analysis (YANA): a new systems approach to identify therapeutic targets for human genetic diseases
Wiley, F1000Research 2014 - “...SPAC3C7.03c SPAC23H4.12 SPCC338.08 15 SPCC1682.16 SPBC32F12.02 SPBC11C11.02 SPBP35G2.08c 16 SPBC106.01 SPCC736.04c SPBC1289.11 SPBC29A3.14c 17 SPCC622.16c SPBC30D10.13c SPCC126.02c SPAC29A4.18 18 SPAC22H10.07 SPCC737.09c SPBC13G1.13 SPBC1921.03c 19 SPBC13G1.13 SPBC56F2.01 SPCC188.13c SPBC2F12.11c 20 SPBC16H5.06 SPBC2F12.11c SPCC663.12 SPAPB1E7.02c 21 SPBC29A10.05 SPBC16A3.07c SPCC338.05c SPAC17A5.16 22 SPBC28F2.07 SPAC5D6.05 SPAC343.11c SPAC20H4.03c 23 SPCC1827.08c SPAC18G6.02c...”
XP_023169248 pyruvate dehydrogenase E1 component subunit beta, mitochondrial isoform X1 from Drosophila hydei
39% identity, 90% coverage
B6TQ36 pyruvate dehydrogenase (acetyl-transferring) from Zea mays
40% identity, 81% coverage
ODPB_YEAST / P32473 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; Pyruvate dehydrogenase complex component E1 beta; PDHE1-B; EC 1.2.4.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
NP_009780 pyruvate dehydrogenase (acetyl-transferring) subunit E1 beta from Saccharomyces cerevisiae S288C
YBR221C E1 beta subunit of the pyruvate dehydrogenase (PDH) complex, which is an evolutionarily-conserved multi-protein complex found in mitochondria from Saccharomyces cerevisiae
39% identity, 88% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Pyruvate dehydrogenase (E1) is a tetramer of 2 alpha and 2 beta subunits. Eukaryotic pyruvate dehydrogenase (PDH) complexes are organized as a core consisting of the oligomeric dihydrolipoamide acetyl-transferase (E2), around which are arranged multiple copies of pyruvate dehydrogenase (E1), dihydrolipoamide dehydrogenase (E3) and protein X (E3BP) bound by non-covalent bonds - Cadmium Sulfide Quantum Dots Adversely Affect Gametogenesis in Saccharomyces cerevisiae
Rossi, Nanomaterials (Basel, Switzerland) 2022 - “...79.57 38% 52 8.0 Energy metabolism Pdb1 E1 beta subunit of the pyruvate dehydrogenase complex (P32473) 73.89 36% 40 5.0 Energy metabolism Tdh2 Glyceraldehyde-3-phosphate dehydrogenase (P00358) 137.4 55% 36 7.0 Energy metabolism Tdh3 Glyceraldehyde-3-phosphate dehydrogenase (P00359) 149.31 72% 36 7.0 Energy metabolism Leu2 Beta-isopropylmalate dehydrogenase (P04173)...”
- Improving Identification of In-organello Protein-Protein Interactions Using an Affinity-enrichable, Isotopically Coded, and Mass Spectrometry-cleavable Chemical Crosslinker
Makepeace, Molecular & cellular proteomics : MCP 2020 - “...33 33 P07251 ATP1 P09457 ATP5 107 Yes Yes 18 29 39 39 P12695 LAT1 P32473 PDB1 91 Yes Yes 20 29 12 50 P81449 TIM11 P81451 ATP19 73 No No 15 3 32 38 P00830 ATP2 P09457 ATP5 72 Yes Yes 10 27 19 26...”
- “...8 8 P12695 LAT1 P16451 PDX1 27 No No 10 2 0 25 P16387 PDA1 P32473 PDB1 27 Yes Yes 8 5 4 18 P0CS90 SSC1 P39987 ECM10 26 No No 7 7 10 9 P30902 ATP7 Q06405 ATP17 25 Yes Yes 4 0 8 17...”
- The RNA-binding protein repertoire of Arabidopsis thaliana.
Marondedze, Scientific reports 2016 (no snippet) - Mitochondrial enzymes are protected from stress-induced aggregation by mitochondrial chaperones and the Pim1/LON protease
Bender, Molecular biology of the cell 2011 - “...25 13 Pda1 Pyruvate dehydrogenase, subunit P16387 46 30 7 14 Pdb1 Pyruvate dehydrogenase, subunit P32473 40 36 9 15 Pox1 Acyl-CoA oxidase P13711 84 n.d. 16 Ssc1 Heat shock protein 70 P12398 71 105 35 * Molecular weight according to database ( http://www.yeastgenome.org/ ). Actual...”
- In planta proteomics and proteogenomics of the biotrophic barley fungal pathogen Blumeria graminis f. sp. hordei.
Bindschedler, Molecular & cellular proteomics : MCP 2009 (no snippet) - Transcriptional analysis of L-methionine catabolism in the cheese-ripening yeast Yarrowia lipolytica in relation to volatile sulfur compound biosynthesis
Cholet, Applied and environmental microbiology 2008 - “...(lipoamide) (subunit E1) Highly similar to sp P32473 S. cerevisiae YBR221c PDB1 pyruvate dehydrogenase (lipoamide) (subunit E1) Similar to tr Q9P5K8...”
- Identification of a thiamin-dependent synthase in Escherichia coli required for the formation of the 1-deoxy-D-xylulose 5-phosphate precursor to isoprenoids, thiamin, and pyridoxol
Sprenger, Proceedings of the National Academy of Sciences of the United States of America 1997 - “...P52901; u 5 human M24848; v 5 S. cerevisiae P32473; w 5 B. subtilis P21881; x 5 Mycoplasma capricolum MCU62057; y 5 Thiobacillus ferrooxidans TFU81808) and E1...”
- QTL mapping of modelled metabolic fluxes reveals gene variants impacting yeast central carbon metabolism.
Eder, Scientific reports 2020 - GeneRIF: QTL mapping of modelled metabolic fluxes reveals gene variants impacting yeast central carbon metabolism.
- Pareto optimal metabolic engineering for the growth-coupled overproduction of sustainable chemicals
Amaradio, Biotechnology and bioengineering 2022 - “...chromosomic locations 4 YDL171C, YPL061W, YPR160W, YPR127W GLT1 (IV), ALD6 (XVI), GPH1 (XVI), YPR127W 4 YBR221C, YDL171C, YPL061W, YPR160W PDB1 (II), GLT1 (IV), ALD6 (XVI), GPH1 (XVI) 4 YDL171C, YGR193C, YPL061W, YPR160W GLT1 (IV), PDX1 (VIII), ALD6 (XVI), GPH1 (XVI) 4 YDL171C, YNL071W, YPL061W, YPR160W GLT1...”
- Data integration uncovers the metabolic bases of phenotypic variation in yeast
Petrizzelli, PLoS computational biology 2021 - “...YNL037C) Icit_Akg_m_nad (YIL125W AND YDR148C AND YFL018C ) Akg_Succoa_m ( YGR240C AND YMR205C ) F6p_Fdp (YBR221C AND YER178W AND YFL018C AND YGR193C AND YNL071W ) Pyr_Accoa_m ( YGR244C AND YOR142W ) Succoa_Succ_m ( YGL080W AND (YGR243W OR YHR162W)) Pyr_tm We checked that pairwise correlations between proteins...”
- Functional interplay between DEAD-box RNA helicases Ded1 and Dbp1 in preinitiation complex attachment and scanning on structured mRNAs in vivo
Sen, Nucleic acids research 2019 - “...in vivo. (A) SSU and mRNA reads on the Ded1-hyperdependent mRNA YBR221C in two biological replicates each ( a, b) of WT or ded1-cs cells in units of rpm (reads...”
- Intimate connections: Inositol pyrophosphates at the interface of metabolic regulation and cell signaling
Shears, Journal of cellular physiology 2018 - “...Protein disulfide isomerase YPR074C TKL1 Transketolase (in the pentose phosphate pathay) YLR293C GSP1 Ran GTPase YBR221C PDB1 E1 beta subunit of the pyruvate dehydrogenase (PDH) complex YGL202W ARO8 Aromatic aminotransferase I YER126C NSA2 Constituent of 66S pre-ribosomal particles YJR063W RPA12 RNA polymerase I subunit A12.2 YIL051C...”
- RSC Chromatin-Remodeling Complex Is Important for Mitochondrial Function in Saccharomyces cerevisiae
Imamura, PloS one 2015 - “...YJR144W MGM101 Mitochondrial Genome Maintenance Mitochondrial enzyme YAL044C GCV3 GlyCine cleaVage YOR136W IDH2 Isocitrate DeHydrogenase YBR221C PDB1 Pyruvate Dehydrogenase Beta subunit YPL188W POS5 PerOxide Sensitive YMR267W PPA2 PyroPhosphatAse YJR104C SOD1 SuperOxide Dismutase General metabolism Amino acid biosynthesis YLR027C AAT2 Aspartate AminoTransferase YJL071W ARG2 ARGinine requiring YJL088W...”
- Metabolic analyses elucidate non-trivial gene targets for amplifying dihydroartemisinic acid production in yeast
Misra, Frontiers in microbiology 2013 - “...by ME2 PPP Gene overexpression in strain Fy DHA necessary to emulate this ExPa 1. YBR221C, YER178W, YFL018C, YGR193C, YNL071W (pyruvate dehydrogenase) 1. YBR221C, YER178W, YFL018C, YGR193C, YNL071W (pyruvate dehydrogenase) 2. YKL029C (NADPH-malic enzyme ME2) 2. YNL241C (glucose-6-phosphate dehydrogenase) 3. YBR218C, YGL062W (pyruvate carboxylase) 3. YGR043C,...”
- The yeast magmas ortholog pam16 has an essential function in fermentative growth that involves sphingolipid metabolism
Short, PloS one 2012 - “...* yor221c +++ X Mitochondrial Lipid Metabolism PDA1 * yer178w +++ Mitochondrial Lipid Metabolism PDB1 ybr221c ++ Mitochondrial Lipid Metabolism RPM2 yml090w c +++ X Mitochondrial Lipid Metabolism TAZ1 * ypr140w + Mitochondrial Lipid Metabolism BRE1 ydl074c +++ Histone Modification DEP1 yal013w ++ X Histone Modification...”
- Graph ranking for exploratory gene data analysis
Gao, BMC bioinformatics 2009 - “...YJL088W YDR019C YOR100C YJL026W YNL036W YER081W YDR001C YDR018C YKR076W YER081W YNL071W YBR045C YJL026W YLL060C YLR237W YBR221C YJL153C YCR083W YDR001C YJL129C YLR142W Down YNL327W YNL327W YNL327W YJL178C YDR435C YFL017C YGL028C YDR044W YDL142C YER009W YNL141W YNR067C YHR128W YIL162W YNL327W YOR095C YGR006W YHL028W YCR021C YGL143C YOL152W YIL149C YMR006C YGR180C...”
- More
Q6C4G4 Pyruvate dehydrogenase E1 component subunit beta from Yarrowia lipolytica (strain CLIB 122 / E 150)
40% identity, 97% coverage
- Proteomes reveal metabolic capabilities of <i>Yarrowia lipolytica</i> for biological upcycling of polyethylene into high-value chemicals
Walker, mSystems 2023 - “...following: YarlipO1F2_232437 (Q6C877, YALI0D22022p, mitochondrial F1F0-ATP synthase) upregulated by 376-fold ( P = 0.0041), YarlipO1F2_208678 (Q6C4G4, YALI0E27005p, pyruvate dehydrogenase) by 60-fold ( P = 0.0183), YarlipO1F2_233609 (Q6CCU5, YALI0C06446p, proteins containing the FAD binding domain) by 55-fold ( P = 0.0129), YarlipO1F2_238445 (Q6CGH0, YALI0A19448p, aldehyde dehydrogenase) by...”
CNAG_05059 pyruvate dehydrogenase E1 component subunit beta from Cryptococcus neoformans var. grubii H99
40% identity, 79% coverage
SACE_3953 pyruvate dehydrogenase E1 component beta subunit from Saccharopolyspora erythraea NRRL 2338
44% identity, 95% coverage
- Systems perspectives on erythromycin biosynthesis by comparative genomic and transcriptomic analyses of S. erythraea E3 and NRRL23338 strains
Li, BMC genomics 2013 - “...( mdh ), SACE_3811 ( acn ), SACE_3926/SACE_3927 ( korA ), SACE_3952 ( pdhA2 ), SACE_3953 ( pdhB1 ), SACE_3954 ( bkdC2 ), SACE_4581 ( citE3 ), SACE_6118 ( pyc ), SACE_6636 (isocitrate dehydrogenase) and SACE_6668/6669 ( sucC ), showed higher expression level, as compared to...”
F1SGH5 Pyruvate dehydrogenase E1 component subunit beta from Sus scrofa
41% identity, 83% coverage
- Proteomic Profiling Reveals Specific Molecular Hallmarks of the Pig Claustrum
Pirone, Molecular neurobiology 2023 - “...0.006 2.1 1655 F1RM45 Apolipoprotein E APOE 12 4 4 36,665 5.92 0.002 1.6 1660 F1SGH5 Pyruvate dehydrogenase E1 component subunit beta PDHB 52 17 17 39,273 6.20 0.002 1.5 1660 F1RM45 Apolipoprotein E APOE 22 6 6 36,665 5.92 0.002 1.5 1757 Q06A94 Heterogeneous nuclear...”
- “...0.009 2.1 1655 F1RM45 Apolipoprotein E APOE 12 4 4 36,665 5.92 0.006 1.6 1660 F1SGH5 Pyruvate dehydrogenase E1 component subunit beta PDHB 52 17 17 39,273 6.20 0.007 1.7 1660 F1RM45 Apolipoprotein E APOE 22 6 6 36,665 5.92 0.007 1.7 1732 I3LRS8 Phosphatidylinositol transfer...”
E9AXQ3 Pyruvate dehydrogenase E1 component subunit beta from Leishmania mexicana (strain MHOM/GT/2001/U1103)
40% identity, 87% coverage
ppdcβ / G1UHX5 phenylpyruvate decarboxylase β subunit (EC 4.1.1.43) from Streptomyces virginiae (see paper)
41% identity, 99% coverage
Pden_4984 Transketolase, central region from Paracoccus denitrificans PD1222
40% identity, 97% coverage
LOC111356157 pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Spodoptera litura
41% identity, 86% coverage
- Natural Coumarin Shows Toxicity to Spodoptera litura by Inhibiting Detoxification Enzymes and Glycometabolism
Xia, International journal of molecular sciences 2023 - “...49,571.64 11,593.98 2.0962 1.69 10 6 LOC111353109 ATP-dependent 6-phosphofructokinase 754.5358 236.7817 1.6736 4.41 10 6 LOC111356157 pyruvate dehydrogenase E1 3664.081 1203.187 1.6066 4.95 10 6 LOC111358748 alcohol dehydrogenase class-3 7719.941 2166.966 1.8330 1.19 10 5 LOC111355208 fructose-1,6-bisphosphatase 1 622.5551 1580.132 1.3445 2.60 10 5 LOC111349213 dihydrolipoyl...”
- “...872.7566 1.8635 6.86 10 7 LOC111360629 probable citrate synthase 19,544.5 5754.938 1.7640 2.94 10 6 LOC111356157 pyruvate dehydrogenase E1 3664.081 1203.187 1.6066 4.95 10 6 LOC111351504 ATP-citrate synthase 2735.836 1023.545 1.4187 5.31 10 6 LOC111350483 succinate dehydrogenase 5595.091 2138.591 1.3875 2.97 10 5 LOC111349213 dihydrolipoyl dehydrogenase...”
H375_3540 pyruvate dehydrogenase complex E1 component subunit beta from Rickettsia prowazekii str. Breinl
38% identity, 98% coverage
Q9D051 pyruvate dehydrogenase system (subunit 1/2) (EC 1.2.1.104) from Mus musculus (see paper)
NP_077183 pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor from Mus musculus
41% identity, 84% coverage
- Changes in protein fluxes in skeletal muscle during sequential stages of muscle regeneration after acute injury in male mice.
Bizieff, Scientific reports 2024 - “...isoenzyme 1 Q9R0Y5 Cytoplasm 6.566.691% 13.3568.524% 10.0913.218% 2.6761.245% 59 Pyruvate dehydrogenase E1 component subunit beta Q9D051 Mitochondria 1.4020.531% 17.91217.817% 10.0693.588%* 1.73670.485% 60 Centrosomal protein of 162kDa Q6ZQ06 Cytoplasm 0.9980.807% 1.0290.223% 0.5030.101% 61 Troponin C, skeletal muscle P20801 Myofibril 4.4322.101% 23.20712.899% 12.9440.351%* 3.6450.702% 62 Myosin-7 Q91Z83 Myofibril...”
- Comparative Proteomic Study of Retinal Ganglion Cells Undergoing Various Types of Cellular Stressors.
Starr, bioRxiv : the preprint server for biology 2024 - “...reduced 40S ribosomal protein S3a P97351 0.023 reduced Pyruvate dehydrogenase E1 component subunit beta, mitochondrial Q9D051 0.023 reduced 60S acidic ribosomal protein P0 P14869 0.014 reduced Ornithine aminotransferase, mitochondrial P29758 0.047 reduced Sideroflexin-3 Q91V61 0.003 reduced Sodium- and chloride-dependent GABA transporter 3 P31650 0.044 reduced NADH...”
- Mitochondrial Proteome Changes in Rett Syndrome
Golubiani, Biology 2023 - “...Molecular/Biological Functions of Proteins HIPPOCAMPUS 1 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial upregulated Pdhb Q9D051 ODPB_MOUSE 0.24 0.23 (n = 6) 0.68 0.17 (n = 6) p = 0.004 pyruvate dehydrogenase (acetyl-transferring) activity/glucose metabolic process 2 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial upregulated Ndufs1 Q91VD9...”
- Pien Tze Huang regulates phosphorylation of metabolic enzymes in mice of hepatocellular carcinoma.
Lin, Scientific reports 2023 - “...0.90 0.67 1.37** 1.23 O70250 Phosphoglycerate mutase 2 (PGAM2) 0.56 0.82 1.18 0.84 0.48** 0.82 Q9D051 Pyruvate dehydrogenase E1 (PDHB) 0.80 0.41 1.15 1.40 0.70 0.41* P06151 L-lactate dehydrogenase A chain (LDHA) 0.82 0.87 1.05 0.89 0.78** 0.87 P05064 Fructose and mannose metabolism Glycolysis/gluconeogenesis Fructose bisphosphate...”
- The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...0.005805916 O35143 ATPase inhibitor, mitochondrial Atp5if1 0.006163506 Q5NCE8 Magnesium transporter MRS2 homolog, mitochondrial Mrs2 0.009684623 Q9D051 Pyruvate dehydrogenase E1 component subunit beta Pdhb 0.011119372 Q9JLZ3 Methylglutaconyl-CoA hydratase, mitochondrial Auh 0.011503073 Q9CPZ8 COX assembly mitochondrial protein homolog Cmc1 0.011903721 Q9DCC8 Mitochondrial import receptor subunit TOM20 homolog Tomm20...”
- Effects of microgravity exposure and fructo-oligosaccharide ingestion on the proteome of soleus and extensor digitorum longus muscles in developing mice.
Ohira, NPJ microgravity 2021 - “...=6.4E2 Ogdh (Q60597) * FC=0.74, P =7.8E4 * FC=0.83, P =3.7E3 FC=0.88, P =1.1E1 Pdhb (Q9D051) * FC=0.82, P =5.2E3 FC=0.91, P =5.5E2 FC=0.92, P =2.3E1 Sdha (Q8K2B3) * FC=0.82, P =7.4E3 FC=0.89, P =7.5E2 FC=0.91, P =1.8E1 Mitochondrial electron transport Cox2 (P00405) * FC=0.69, P...”
- Protein expression alteration in hippocampus upon genetic repression of AMPKα isoforms.
Yang, Hippocampus 2021 - “...reductase, mitochondrial Q8CDN6 0.627 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial P20108 0.646 D-3-phosphoglycerate dehydrogenase Q9D051 0.656 ATP-citrate synthase Q61753 0.658 Q91V92 + Down-regulated also in AMPK1 cKO mice...”
- Adipocyte-Derived Extracellular Vesicles: State of the Art.
Rome, International journal of molecular sciences 2021 - “...malate dehydrogenase 2, NAD (mitochondrial) Ogdh Q60597 oxoglutarate dehydrogenase (lipoamide) Pc Q05920 pyruvate carboxylase Pdhb Q9D051 pyruvate dehydrogenase (lipoamide) beta Pdia3 P27773 protein disulfide isomerase associated 3 Phb P67778 prohibitin Prkar2b P31324 protein kinase, cAMP dependent regulatory, type II beta Rab18 P35293 RAB18, member RAS oncogene...”
- More
- Pyruvate dehydrogenase B regulates myogenic differentiation via the FoxP1-Arih2 axis.
Jiang, Journal of cachexia, sarcopenia and muscle 2023 - GeneRIF: Pyruvate dehydrogenase B regulates myogenic differentiation via the FoxP1-Arih2 axis.
- Prolyl-hydroxylase PHD3 interacts with pyruvate dehydrogenase (PDH)-E1β and regulates the cellular PDH activity.
Kikuchi, Biochemical and biophysical research communications 2014 (PubMed)- GeneRIF: PHD3 depletion did not affect the expression of the PDH-E1alpha, E1beta, and E2 subunits, or the phosphorylation status of E1alpha, but destabilized the PDH complex (PDC), resulting in less functional PDC.
- Proteomic profiling of adipose tissue from Zmpste24-/- mice, a model of lipodystrophy and premature aging, reveals major changes in mitochondrial function and vimentin processing
Peinado, Molecular & cellular proteomics : MCP 2011 - “...Q9QYR9 NP_080720 AAA17989 EDL25822 EDK99981 EDL18063 NP_077183 NP_033867 AAA37726 NP_032644 BAF42049 NP_034569 NP_031478 NP_075770 NP_033414 NP_032641 NP_032088...”
NP_001030512 pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor from Bos taurus
P11966 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Bos taurus
41% identity, 84% coverage
ATEG_09087 2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursor from Aspergillus terreus NIH2624
41% identity, 92% coverage
NP_001007621 pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor from Rattus norvegicus
P49432 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial from Rattus norvegicus
41% identity, 84% coverage
- Ethanol-Induced Alterations in Placental and Fetal Cerebrocortical Annexin-A4 and Cerebral Cavernous Malformation Protein 3 Are Associated With Reductions in Fetal Cortical VEGF Receptor Binding and Microvascular Density
Savage, Frontiers in neuroscience 2020 - “...3.20 167 4/3/16 5.31/36 1990 NP_542152.1 NEM-sensitive factor attachment protein alpha* 3.00 58 1/1/4 5.30/33 NP_001007621 Pyruvate dehydrogenase, beta* 3.00 39 1/1/4 6.20/39 2950 NP_446200.1 Dipeptidyl peptidase III 2.60 61 5/1/10 5.12/83 1016 Q9JII4.1 Cytoplasmic dynein intermediate chain 2* 2.60 32 1/0/3 5.11/71 1650 P02651.2 Apolipoprotein...”
- Influence of the Degree of Unsaturation in Fish Oil Supplements on Oxidative Stress and Protein Carbonylation in the Cerebral Cortex and Cerebellum of Healthy Rats
Moreno, Antioxidants (Basel, Switzerland) 2024 - “...Rattus norvegicus OX = 10116 GN = Pdhb PE = 1 SV = 2 Pdhb P49432 Cortex 0.42 (0.07) 1.15 (0.34) Cerebellum 0.59 * (0.08) 1.34 (0.33) Aconitate hydratase mitochondrial OS = Rattus norvegicus OX = 10116 GN = Aco2 PE = 1 SV = 2...”
- Proteomic analysis of rat colonic mucosa following acupuncture treatment for irritable bowel syndrome with diarrhea
Liu, PloS one 2022 - “...decarboxylase Ddc 1.9 0.022 -1.8 0.017 Q9Z1N4 3(2),5-bisphosphate nucleotidase 1 Bpnt1 1.9 0.036 -3.0 0.0083 P49432 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial Pdhb 1.7 0.017 -1.4 0.030 P23965 Enoyl-CoA delta isomerase 1, mitochondrial Eci1 1.5 0.0015 -1.5 0.0010 P32551 Cytochrome b-c1 complex subunit 2, mitochondrial...”
- “...dehydrogenase [NAD] subunit alpha, mitochondrial Idh3a -1.5 0.00087 P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial Hibadh -1.4 0.048 P49432 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial Pdhb -1.4 0.029 Functional distribution of differentially expressed genes To detect important proteins related to IBS-D and acupuncture effects, differentially expressed proteins were...”
- Proteomic Analysis of Retinal Tissue in an S100B Autoimmune Glaucoma Model.
Reinehr, Biology 2021 - “...10 5 0.007 45% 7 P12785 Fatty acid synthase 2.00 10 6 0.007 57% 8 P49432 Pyruvate dehydrogenase e1 component subunit beta, mitochondrial 3.79 10 6 0.010 108% 9 P12346 Serotransferrin 2.08 10 8 0.011 33% 10 Q63151 Long-chain-fatty-acid--CoA ligase 3 7.13 10 4 0.012 45%...”
- Differential Association of 4E-BP2-Interacting Proteins Is Related to Selective Delayed Neuronal Death after Ischemia.
Martínez-Alonso, International journal of molecular sciences 2021 - “...39,979 6.67/ 7.1 234 77 2100.91 (153) 18 Pyruvate dehydrogenase E1 component subunit beta/ODPB ODPB P49432 Pdhb 39,299/ 36,027 6.2/ 5.5 85 31 1747.87 (59) 25 Phosphoglycerate mutase 1 /PGAM-B/PGAM1 PGAM1 P25113 Pgam1 28,928/ 29,767 6.67/ 6.7 257 72 2135.97 (160) 26 Triose-phosphate isomerase/TPIS TPIS P48500...”
- Modulation of proteomic and inflammatory signals by Bradykinin in podocytes
Saoud, Journal of advanced research 2020 - “...1.318 0.399 P85125 Polymerase I and transcript release factor release factor PTRF 0.021 0.662 0.596 P49432 Pyruvate dehydrogenase PDHB 0.037 0.376 1.409 P61589 Ras homolog family member A RHOA 0.047 0.507 0.981 P63245 Receptor for activated C Kinase1 RACK1 0.044 0.306 1.707 P62282 Ribosomal Protein S11...”
- Metabolic syndrome diminishes insulin-induced Akt activation and causes a redistribution of Akt-interacting proteins in cardiomyocytes
Landa-Galvan, PloS one 2020 - “...component subunit alpha 10 6 46.4 -4.8 P00507 Aspartate aminotransferase, mitochondrial 14 14 73.6 -4.3 P49432 Pyruvate dehydrogenase E1 component subunit beta 12 12 81.0 -4.2 P04797 Glyceraldehyde-3-phosphate dehydrogenase 7 1 47.6 -4.1 Q05962 ADP/ATP translocase 1 38 17 129.4 -4.1 Q60587 Trifunctional enzyme subunit beta,...”
- Leucine-Rich Diet Modulates the Metabolomic and Proteomic Profile of Skeletal Muscle during Cancer Cachexia.
Cruz, Cancers 2020 - “...to the L ( Figure 5 c; Table 2 ). Protein pyruvate dehydrogenase beta, Pdhb (P49432) appeared in higher concentrations in leucine-treated groups, besides the WL group had an increased content compared to the W group ( Figure 5 d; Table 2 ). Phosphoglucomutase-1, PGm1 (P38652;...”
- “...Glycogen phosphorylasePygm, accession code P09812 and ( d ) Pyruvate dehydrogenase E1 componentPdhb, accession code P49432 in gastrocnemius muscle. ( e ) Phosphoglucomutase-1Pgm1, accession code P38652 in gastrocnemius muscle. The values are expressed as the difference of maximal fold change. Legend: C, control group; W, Walker...”
- Inflammation and apoptosis accelerate progression to irreversible atrophy in denervated intrinsic muscles of the hand compared with biceps: proteomic analysis of a rat model of obstetric brachial plexus palsy.
Yu, Neural regeneration research 2020 - “...* , Q6P7Q4, P11980, P04636, A0A0G2K4C6, P35745, F7FKI5, P17764, O88989, P42123, P08461, P14408, Q6P6R2, A0A0G2JZH8, P49432, B0BN46 < 0.001 HIF-1 pathway 14 Q3HSE5 * , Q9ET45 * , P15429, M0RD75, A0A0G2K7M1, P27881, P07323, M0R660, Q4G050, F7FKI5, P49432, E9PTN6, P11275, G3V679, E9PTV9 0.006 Calcium pathway 22 F1LV12...”
- “...G3V9W6 * , P25113 * , D3ZZN3, P07323, P30835, A0A0G2JZH8, Q6P9U7, E9PTN6, D4A5G8, Q9Z1N1, B1WBN9, P49432, E9PTV9, Q6P6R2, P08461, P27881, P09117, P16617, P42123, P48500, Q6P6G4, Q6P6V0, Q499Q4, M0R660, P16290, P15429, P11980, Q52KS1, P05065 < 0.001 Calcium signaling 29 G3V6Q6 * , D3ZH00 * , P15791 *...”
- More
MAA_08787 pyruvate dehydrogenase E1 component beta subunit from Metarhizium robertsii ARSEF 23
41% identity, 77% coverage
- Increasing Pyruvate Concentration Enhances Conidial Thermotolerance in the Entomopathogenic Fungus Metarhizium robertsii
Wu, Frontiers in microbiology 2019 - “...for pyruvate production and by downregulating many genes involved in pyruvate consumption, including MAA_02871 and MAA_08787 ( Zhang etal., 2017 ). The pyruvate kinase (MAA_06851) catalyzes the transfer of a phosphate group from phosphoenolpyruvate to adenosine diphosphate, yielding pyruvate and ATP. MAA_02871 encodes a pyruvate transporter...”
- “...gene (MAA_06851) or knocked down using the antisense RNA method the two genes (MAA_02871 and MAA_08787) that are involved in pyruvate consumption. Pyruvate is located at a key intersection in the network of metabolic pathways, so constitutive modification of pyruvate metabolic pathway could harm some fungal...”
acoB / Q3A7P0 acetoin:DCPIP oxidoreductase β subunit from Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) (see paper)
Pcar_0344 acetoin:DCPIP oxidoreductase beta subunit from Pelobacter carbinolicus str. DSM 2380
39% identity, 95% coverage
- Constraint-based modeling analysis of the metabolism of two Pelobacter species
Sun, BMC systems biology 2010 - “...the reconstructed Pelobacter networks, the reaction was associated with the acoA (Pcar_0343 & Ppro_1131), acoB (Pcar_0344 & Ppro_1132), acoC (Pcar_0345 & Ppro_1133), and acoL (Pcar_0347 & Ppro_1137) genes. In the P. carbinolicus model, the resulting acetaldehyde is reduced to ethanol by alcohol dehydrogenase, whereas acetyl-CoA is...”
acoB / AAA18916.1 acetoin:DCPIP oxidoreductase beta subunit from Pelobacter carbinolicus (see paper)
Q57041 Acetoin:DCPIP oxidoreductase beta subunit from Syntrophotalea carbinolica
39% identity, 95% coverage
- Open Issues for Protein Function Assignment in Haloferax volcanii and Other Halophilic Archaea.
Pfeiffer, Genes 2021 - “...substrates are Ile, Leu, Val 1i HVO_2595 HVO_2596 (cont.) no 41% 41% - - Q57102 Q57041 [ 122 ] 1898934 substrate is acetoin 1i HVO_2595 HVO_2596 (cont.) unknown 40% 43% BSU08060 BSU08070 O31404 O34591 [ 123 ] 10368162 substrate is acetoin 1i HVO_0669 HVO_0668 (cont.) unknown...”
- “...] 10368162 substrate is acetoin 1i HVO_0669 HVO_0668 (cont.) unknown 49% 43% - - Q57102 Q57041 [ 122 ] 1898934 substrate is acetoin 1i HVO_2209 (cont.) unknown 38% TA1438 Q9HIA3 [ 121 ] 17894823 substrates are Ile, Leu, Val The column Section refers to the table...”
PDHB / P26269 pyruvate dehydrogenase β subunit from Ascaris suum (see paper)
40% identity, 86% coverage
6cerD / P11177 Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
41% identity, 91% coverage
- Ligand: thiamine diphosphate (6cerD)
PDHB / P11177 pyruvate dehydrogenase E1 component β subunit from Homo sapiens (see 7 papers)
ODPB_HUMAN / P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 7 papers)
P11177 pyruvate dehydrogenase system (subunit 1/2) (EC 1.2.1.104); pyruvate dehydrogenase (acetyl-transferring) (subunit 1/2) (EC 1.2.4.1) from Homo sapiens (see 2 papers)
41% identity, 84% coverage
- function: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
catalytic activity: N(6)-[(R)-lipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + pyruvate + H(+) = N(6)-[(R)-S(8)- acetyldihydrolipoyl]-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2 (RHEA:19189)
cofactor: thiamine diphosphate
subunit: Heterotetramer of two PDHA1 and two PDHB subunits (PubMed:12651851, PubMed:17474719, PubMed:19081061, PubMed:29970614). The heterotetramer interacts with DLAT, and is part of the multimeric pyruvate dehydrogenase complex that contains multiple copies of pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (DLAT, E2) and lipoamide dehydrogenase (DLD, E3) (PubMed:14638692). These subunits are bound to an inner core composed of about 48 DLAT and 12 PDHX molecules (PubMed:14638692). Interacts with DLAT (PubMed:20160912). - Proteomics and digital subtraction angiography approaches reveal CDH18 as a potential target for therapy of moyamoya disease
Guo, Biology direct 2024 - “...2.160274831408593 <0.05 IGLV7-46 A0A075B6I9 2.124328135002202 <0.05 TMED7 Q9Y3B3 2.0738202332916713 <0.05 PROC P04070 1.875780063068488 <0.05 PDHB P11177 1.831877241191673 <0.05 ARL6IP5 O75915 1.7865963618908067 <0.05 IGHG1 P01857 1.7355221772965377 <0.05 CDH18 was highly expressed in moyamoya disease patients with good prognosis Further, the mRNA expression of the top 10 upregulated...”
- Epstein-Barr Virus miR-BARTs 7 and 9 modulate viral cycle, cell proliferation, and proteomic profiles in Burkitt lymphoma
Caetano, Tumour virus research 2024 - “...4-Nitrophenylphosphatase domain and non-neuronal SNAP25-like 1 1.82 0.866 Q13043 CRYZ Serine/threonine-protein kinase 4 1.83 0.621 P11177 PDHB Pyruvate dehydrogenase E1 component beta 1.88 0.951 A0A7I2YQR8 MACROH2A2 Histone H2A (Fragment) 2.00 0.832 P15121 AKR1B1 Aldo-keto reductase family 1 member B1 2.06 0.588 E7EMG9 LSP1 Lymphocyte-specific protein 1...”
- Combined High-Throughput Proteomics and Random Forest Machine-Learning Approach Differentiates and Classifies Metabolic, Immune, Signaling and ECM Intra-Tumor Heterogeneity of Colorectal Cancer
Contini, Cells 2024 - “...WB [ 5 ] Q9UIQ6 ( LNPEP) OTase ND in S 0.0000 S<H >100 0.00001 P11177 ( PDHB ) PDHE1-B 0.0002 S<H >100 0.0005 P36871 ( PGM1 ) PGM-1 0.0009 S<H 3.2 0.3 qPCR, WB IHC [ 34 ] Q5T013 ( HYI) Putative Hyi ND in...”
- Novel Genetic and Biochemical Insights into the Spectrum of NEFL-Associated Phenotypes.
Della, Journal of neuromuscular diseases 2024 - “...0.65 0.001 P22061 4 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PIMT_HUMAN) 0.64 0.022 P04080 2 Cystatin-B (CYTB_HUMAN) 0.64 0.052 P11177 8 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (ODPB_HUMAN) 0.63 0.001 P30086 10 Phosphatidylethanolamine-binding protein 1 (PEBP1_HUMAN) 0.62 0.022 Q9UHQ9 7 NADH-cytochrome b5 reductase 1 (NB5R1_HUMAN) 0.61 0.005 P11142 15...”
- SRCAP is involved in porcine reproductive and respiratory syndrome virus activated Notch signaling pathway.
Ding, Journal of virology 2024 - “...L22 P30153 PPP2R1A 9 17.3 65.31 4.83 0.039 Protein phosphatase 2, regulatory subunit A, alpha P11177 PDHB 8 28.1 39.23 4.66 0.004 Pyruvate dehydrogenase (lipoamide) beta B4DRM3 EIF4B 25 36.9 69.73 4.58 0.017 Eukaryotic translation initiation factor 4B; required for the binding of mRNA to ribosomes...”
- Skeletal muscle proteome analysis underpins multifaceted mitochondrial dysfunction in Friedreich's ataxia.
Indelicato, Frontiers in neuroscience 2023 - “...subunit alpha 1 P08559 41,959 20,700 0.49 -1.02 0.002 PDHB Pyruvate dehydrogenase E1 subunit beta P11177 29,384 13,574 0.46 -1.11 >0.001 -1.03 PDHX Pyruvate dehydrogenase complex component X O00330 16,031 7,552 0.47 -1.09 0.002 PHB1 Prohibitin 1 P35232 25,071 8,447 0.34 -1.57 0.002 PHB2 Prohibitin 2...”
- Interplay between Cultured Human Osteoblastic and Skeletal Muscle Cells: Effects of Conditioned Media on Glucose and Fatty Acid Metabolism.
Lunde, Biomedicines 2023 - “...Pyrroline-5-carboxylate reductase 1 0.034958 0.019611 P08559 PDHA1 Pyruvate dehydrogenase E1 subunit alpha 1 0.028673 0.012049 P11177 PDHB Pyruvate dehydrogenase E1 subunit beta 0.028679 0.008729 P34897 SHMT2 Serine hydroxymethyltransferase 2 0.02749 0.033103 P49411 TUFM Tu translation elongation factor, mitochondrial 0.010111 0.035421 P07108 DBI Acyl-CoA binding protein 0.04511...”
- Mitochondria-derived vesicles and their potential roles in kidney stone disease.
Chaiyarit, Journal of translational medicine 2023 - “...dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial (EC 2.7.11.2) (Pyruvate dehydrogenase kinase isoform 3 192 PDHB P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (PDHE1-B) (EC 1.2.4.1) 193 RAB38 P57729 Ras-related protein Rab-38 (Melanoma antigen NY-MEL-1) 194 RIMS3 Q9UJD0 Regulating synaptic membrane exocytosis protein 3 (Nim3) (RIM3...”
- More
NP_001302465 pyruvate dehydrogenase E1 component subunit beta, mitochondrial isoform 3 from Homo sapiens
41% identity, 88% coverage
- Pyruvate dehydrogenase B regulates myogenic differentiation via the FoxP1-Arih2 axis.
Jiang, Journal of cachexia, sarcopenia and muscle 2023 - GeneRIF: Pyruvate dehydrogenase B regulates myogenic differentiation via the FoxP1-Arih2 axis.
- Integrated single-cell and bulk characterization of cuproptosis key regulator PDHB and association with tumor microenvironment infiltration in clear cell renal cell carcinoma.
Wu, Frontiers in immunology 2023 - GeneRIF: Integrated single-cell and bulk characterization of cuproptosis key regulator PDHB and association with tumor microenvironment infiltration in clear cell renal cell carcinoma.
- Pyruvate Dehydrogenase PDH-E1β Controls Tumor Progression by Altering the Metabolic Status of Cancer Cells.
Yonashiro, Cancer research 2018 (PubMed)- GeneRIF: Building on evidence that PDH activity depends on the stability of a multi-protein PDH complex, the authors found that the PDH-E1beta subunit of the PDH complex is downregulated to inhibit PDH activity under conditions of prolonged hypoxia which establishs the specific mechanism through which PDH acts as an oncogenic factor by tuning glycolytic metabolism in cancer cells.
- Pyruvate dehydrogenase B promoted the growth and migration of the nasopharyngeal carcinoma cells.
Tang, Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2016 (PubMed)- GeneRIF: PDHB was downregulated in nasopharyngeal carcinoma cells. Forced expression of PDHB in NPC cells inhibited cell growth and migration, while knocking down the expression of PDHB promoted the growth, migration, and tumorigenesis of NPC cells. PDHB inhibited ERK signaling and cell growth driven by RasV12.
- ATP6AP2/(pro)renin receptor contributes to glucose metabolism via stabilizing the pyruvate dehydrogenase E1 β subunit.
Kanda, The Journal of biological chemistry 2015 - GeneRIF: Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability
- Prolyl-hydroxylase PHD3 interacts with pyruvate dehydrogenase (PDH)-E1β and regulates the cellular PDH activity.
Kikuchi, Biochemical and biophysical research communications 2014 (PubMed)- GeneRIF: PHD3 depletion did not affect the expression of the PDH-E1alpha, E1beta, and E2 subunits, or the phosphorylation status of E1alpha, but destabilized the PDH complex (PDC), resulting in less functional PDC.
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
Hendrickson, PloS one 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- PDH E1β deficiency with novel mutations in two patients with Leigh syndrome.
Quintana, Journal of inherited metabolic disease 2009 (PubMed)- GeneRIF: Sequencing of PDHB reveals a homozygous point mutation (c.302T>C), causing a predicted amino acid change in patient 1. Patient 2 is compound heterozygote for mutations c.301A>G (p.M101V) and c.313G>A (p.R105Q).
- More
G1M029 Pyruvate dehydrogenase E1 component subunit beta from Ailuropoda melanoleuca
41% identity, 88% coverage
- Dataset of Panda sperm proteome
Liu, Data in brief 2024 - “..., including l-lactate dehydrogenase (D2HU89), citrate synthase (G1LAU6), alpha-enolase (G1LB18), pyruvate dehydrogenase E1 subunit beta (G1M029), chaperonin containing TCP1 subunit 2 (G1LZI4), glucose-6-phosphate isomerase (D2HRQ7), malate dehydrogenase (G1LWG5), and phosphoglycerate kinase (D2H1P3 ( Fig. 2C ). These proteins are involved in various metabolic processes such as...”
ECU04_1160 PYRUVATE DEHYDROGENASE E1 COMPONENT BETA SUBUNIT from Encephalitozoon cuniculi GB-M1
41% identity, 94% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory