PaperBLAST
PaperBLAST Hits for metacyc::MONOMER-20600 glycine/sarcosine/betaine reductase complex component A1 (EC 1.21.4.2) (Peptoclostridium acidaminophilum) (158 a.a., MSLFDGKKVI...)
Show query sequence
>metacyc::MONOMER-20600 glycine/sarcosine/betaine reductase complex component A1 (EC 1.21.4.2) (Peptoclostridium acidaminophilum)
MSLFDGKKVIIIGDRDGIPGPAIAECLKGTAAEVVYSATECFVUTAAGAMDLENQNRVKG
FADQFGAENLVVLVGAAEAESAGLAAETVTAGDPTFAGPLAGVQLGLRVFHAVEPEFKDA
VDSAVYDEQIGMMEMVLDVDSIIAEMKSIREQFGKFND
Running BLASTp...
Found 12 similar proteins in the literature:
grdA1 / P50972 glycine/sarcosine/betaine reductase complex component A1 (EC 1.21.4.2) from Peptoclostridium acidaminophilum (see 9 papers)
100% identity, 100% coverage
grdA / CAA74650.1 glycine reductase A from Peptoclostridium acidaminophilum (see paper)
92% identity, 100% coverage
YP_001512500 glycine/sarcosine/betaine reductase complex protein A from Clostridium sp. OhILAs
78% identity, 100% coverage
P26971 glycine reductase (EC 1.21.4.2) from Acetoanaerobium sticklandii (see paper)
77% identity, 100% coverage
BP951000_1855 glycine/sarcosine/betaine reductase complex selenoprotein A from Brachyspira pilosicoli 95/1000
71% identity, 96% coverage
- The complete genome sequence of the pathogenic intestinal spirochete Brachyspira pilosicoli and comparison with other Brachyspira genomes
Wanchanthuek, PloS one 2010 - “...( trxB , BP951000_1853), glycine reductase ( grdE ; BP951000_1854), sarcosine reductase ( grdA , BP951000_1855), glycine reductase complex selenoprotein B ( grdB , BP951000_1856), two copies for the glycine/sarcosine/betaine reductase complex, component C, alpha subunit ( grdC , BP951000_1857 and BP951000_1858), and two copies for...”
Q3A9J5 Glycine/sarcosine/betaine reductase complex component A from Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
64% identity, 99% coverage
- Gene Unprediction with Spurio: A tool to identify spurious protein sequences
Höps, F1000Research 2018 - “...Spurio method. To examine this we took an example selenoprotein GrdA from Carboxydothermus hydrogenoformans (UniProt: Q3A9J5 ) and ran Spurio on it. We found that indeed it was scored as 0.891 probability to be spurious (see Figure 9 ). One can clearly see in the blizzard...”
- “...as spurious. Figure 9. A blizzard plot of the selenoprotein GrdA from Carboxydothermus hydrogenoformans (UniProt: Q3A9J5). See Figure 1 for a description of the features of the blizzard plot. Discussion The identification of spurious genes is an area of genomic annotation that has received very little...”
TDE0745 glycine reductase complex selenoprotein GrdA from Treponema denticola ATCC 35405
67% identity, 95% coverage
- Transcriptional responses of Treponema denticola to other oral bacterial species
Sarkar, PloS one 2014 - “...2.91 2.83 TDE0665 pyruvate ferredoxin/flavodoxin oxidoreductase family protein 2.24 2.22 TDE0693 thiD phosphomethylpyrimidine kinase 3.25 TDE0745 grdA glycine reductase complex selenoprotein GrdA 2.37 TDE0753 hypothetical protein 2.03 1.84 TDE0754 hypothetical protein 2.03 1.78 TDE1231 hypothetical protein 1.55 2.13 TDE1246 lipoprotein, putative 1.54 1.57 TDE1247 hypothetical protein...”
- Porphyromonas gingivalis and Treponema denticola exhibit metabolic symbioses
Tan, PLoS pathogens 2014 - “...B2 TDE2119 GrdB2 1.4 1 2.1 1 TDE2120 GrdE2 1.3 1 1.7 1 Protein A TDE0745 GrdA 1.1 ND 2 Protein C TDE0240 GrdC 1.1 ND TDE0239 GrdD 1.1 ND Conversion of acetyl-phosphate to acetate TDE0933 Acetate kinase 1.2 1 ND Alanine/Glycine cation symporter (AGCS) TDE1259...”
- Mining prokaryotic genomes for unknown amino acids: a stop-codon-based approach
Fujita, BMC bioinformatics 2007 - “...dikinase TGA 12 Haemophilus influenzae (HI0200m) Glycine reductase complex selenoprotein A TGA 6 Treponema denticola (TDE0745) Glycine reductase complex selenoprotein B TGA 6 Treponema denticola (TDE0078) Heterodisulfide reductase subunit A TGA 6 Methanococcus jannaschii (MJ1190m) Coenzyme F420-reducing hydrogenase subunit TGA 5 Methanococcus jannaschii (MJ1190a) Formylmethanofuran dehydrogenase...”
- Comparison of the genome of the oral pathogen Treponema denticola with other spirochete genomes
Seshadri, Proceedings of the National Academy of Sciences of the United States of America 2004 - “...(TDE0238), glycine reductase complex selenoproteins (grdA, TDE0745, grdB, TDE2119, TDE0078), and glutathione peroxidase (TDE1729), all contain predicted...”
grdA / P26970 glycine reductase system component A (EC 1.21.4.2) from Gottschalkia purinilytica (see paper)
67% identity, 94% coverage
grdA / AAB02121.2 selenoprotein A from Gottschalkia purinilytica (see paper)
66% identity, 94% coverage
CBO1261 glycine/sarcosine/betaine reductase complex protein A from Clostridium botulinum A str. ATCC 3502
73% identity, 100% coverage
Q185M6 glycine reductase (EC 1.21.4.2) from Clostridioides difficile (see paper)
CD630_23520, CDIF630erm_02592 glycine/sarcosine/betaine reductase complex selenoprotein A from Clostridioides difficile
73% identity, 99% coverage
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...complex component C -3.70 -3.70 CD630_23510 CDIF630erm_02589 grdB Glycine reductase complex component B OFF OFF CD630_23520 CDIF630erm_02592 grdA Glycine reductase complex component A - - CD630_23540 CDIF630erm_02594 grdE Glycine reductase complex component E -5.02 -2.84 -5.22 OFF CD630_23550 CDIF630erm_02595 trxA2 Thioredoxin 2 -3.66 -3.66 + CD630_23560...”
- “...component C -3.70 -3.70 CD630_23510 CDIF630erm_02589 grdB Glycine reductase complex component B OFF OFF CD630_23520 CDIF630erm_02592 grdA Glycine reductase complex component A - - CD630_23540 CDIF630erm_02594 grdE Glycine reductase complex component E -5.02 -2.84 -5.22 OFF CD630_23550 CDIF630erm_02595 trxA2 Thioredoxin 2 -3.66 -3.66 + CD630_23560 CDIF630erm_02596...”
CDR20291_2240 glycine/sarcosine/betaine reductase complex protein A from Clostridium difficile R20291
72% identity, 99% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory