PaperBLAST
PaperBLAST Hits for reanno::Phaeo:GFF1302 ABC transporter for D-Sorbitol, ATPase component (Phaeobacter inhibens DSM 17395) (334 a.a., MGQIKLESVT...)
Show query sequence
>reanno::Phaeo:GFF1302 ABC transporter for D-Sorbitol, ATPase component (Phaeobacter inhibens DSM 17395)
MGQIKLESVTKNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTI
RIDGEDATNIPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAA
LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELH
KRLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFIGSPKMN
LLTGPQAAQHNAATIGIRPEHLSISETEGMWAGTIGVSEHLGSDTFFHVQCDAFDDPLTV
RASGELDLGYGERVFLTPDMTHLHRFGSDGLRIE
Running BLASTp...
Found 250 similar proteins in the literature:
PGA1_c13180 ABC transporter for D-Sorbitol, ATPase component from Phaeobacter inhibens DSM 17395
100% identity, 100% coverage
- mutant phenotype: Specific phenotype on D-Sorbitol.
TC 3.A.1.1.5 / P54933 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) (see paper)
73% identity, 99% coverage
RL4215 putative ATP-binding component of mannitol ABC transport protein from Rhizobium leguminosarum bv. viciae 3841
68% identity, 100% coverage
Atu4450 ABC transporter, nucleotide binding/ATPase protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
68% identity, 100% coverage
- Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
Jin, Biomolecules 2022 - “...afuB = atu4785 , afuC = atu4786 and others), maltose ( atu0391 , atu4559 , atu4450 ), oligogalacturonide ( atu3130 , atu3132 ), glucose ( atu3351 , atu3352 ), rhamnose ( atu34873490 ), sn-glycerol 3-phosphate ( ugpC = atu3099 / atu3188 ), branched-chain amino acid (...”
blr3224 ABC transporter ATP-binding protein from Bradyrhizobium japonicum USDA 110
67% identity, 99% coverage
- Pleiotropic Effects of PhaR Regulator in Bradyrhizobium diazoefficiens Microaerobic Metabolism
Quelas, International journal of molecular sciences 2024 - “...four genes required for mannitol transport across the membrane and their conversion to fructose-6-P, namely, blr3224, coding for putative mannitol transport system; blr3225, coding for mannitol dehydrogenase; blr3226, coding for ribitol kinase and blr3227; coding for D-fructokinase were downregulated at transcriptional level ( Tables S1 and...”
- Induction by Bradyrhizobium diazoefficiens of Different Pathways for Growth in D-mannitol or L-arabinose Leading to Pronounced Differences in CO2 Fixation, O2 Consumption, and Lateral-Flagellum Production
Cogo, Frontiers in microbiology 2018 - “...Q89RF7 Putative transketolase family protein. Pyruvate dehydrogenase E1 component. In only Mtl In only Mtl blr3224 Q89QA6 ABC transporter ATP-binding protein. Putative sorbitol/mannitol transport system. In only Mtl NS blr3225 Q89QA5 Oxidoreductase. Similar to putative Glucose/ribitol oxidoreductase. 5.0927 In only Mtl blr3226 Q89QA4 Ribitol kinase 3.9234...”
- “...neighbor of three genes encoding proteins also found in MtlDPnamely the putative sorbitol/Mtl transport system (blr3224), a D-ribitol kinase (EC 2.7.1.47; blr3226), and the D -fructokinase (EC 2.7.1.4; blr3227) that may be required to phosphorylate the D -fructose produced after Mtl reduction ( Table 2 )....”
RHE_RS14795 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
60% identity, 99% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...transport system ATP-binding protein K10191 Bacteroid RHE_RS19645 lacK; lactose/L-arabinose transport system ATP-binding protein K10111 MM RHE_RS14795 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS27505 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS10605 malK, mtlK, thuK; multiple...”
- “..., thuK ; multiple sugar transport system ATP-binding protein [EC:3.6.3.-]; in MM, the proteins RHE_RS10605, RHE_RS14795, RHE_RS27505 were identified, and RHE_RS25965 was expressed in bacteroid ( Table 1 ). The msmX , msmK , malK , sugC , ggtA , msiK ; multiple sugar transport system...”
BMEII0750 MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING PROTEIN MALK from Brucella melitensis 16M
BOV_A0454 sugar ABC transporter, ATP-binding protein from Brucella ovis ATCC 25840
58% identity, 100% coverage
- Ontology-based Brucella vaccine literature indexing and systematic analysis of gene-vaccine association network
Hur, BMC immunology 2011 - “...kinase 5 2 (1) C (9.26) BMEI0310 gap glyceraldehyde-3-phosphate dehydrogenase 5 1 (1) C (9.97) BMEII0750 smoK sugar ABC transporter, ATP-binding protein 6 3 (2) CM (9.99) BMEI1416 rfbE O-antigen export system ATP-binding protein RfbE 6 3 (2) CM (7.88) BMEII0940 smoK sugar ABC transporter, ATP-binding...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BP BMEII0625 BruAb20571, ugpB BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...ugpB BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754...”
SMc02869 N-Acetyl-D-glucosamine ABC transport system, ATPase component from Sinorhizobium meliloti 1021
58% identity, 95% coverage
- mutant phenotype: Specific phenotype on N-Acetyl-D-Glucosamine.
RHE_RS27505 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
59% identity, 98% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...K10111 MM RHE_RS14795 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS27505 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS10605 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 Bacteroid RHE_RS25965 malK, mtlK, thuK; multiple...”
- “...thuK ; multiple sugar transport system ATP-binding protein [EC:3.6.3.-]; in MM, the proteins RHE_RS10605, RHE_RS14795, RHE_RS27505 were identified, and RHE_RS25965 was expressed in bacteroid ( Table 1 ). The msmX , msmK , malK , sugC , ggtA , msiK ; multiple sugar transport system ATP-binding...”
BRA0521 sugar ABC transporter, ATP-binding protein from Brucella suis 1330
BCAN_B0520 ATP-binding transport protein smoK from Brucella canis ATCC 23365
58% identity, 100% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BruAb20571, ugpB BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520 OSP Oligosaccharide or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706...”
Pf6N2E2_1960 ABC transporter for D-sorbitol, ATPase component from Pseudomonas fluorescens FW300-N2E2
56% identity, 91% coverage
- mutant phenotype: # Specifically important in carbon source D-Sorbitol
BRA0307 sugar ABC transporter, ATP-binding protein from Brucella suis 1330
60% identity, 99% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP...”
AO356_00010 ABC transporter for D-Sorbitol, ATPase component from Pseudomonas fluorescens FW300-N2C3
56% identity, 91% coverage
- mutant phenotype: Specific phenotype on D-Sorbitol.
BCAN_B0308 ATP-binding transport protein smoK from Brucella canis ATCC 23365
59% identity, 99% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877...”
YP_419049 ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase:TOBE domain from Brucella melitensis biovar Abortus 2308
59% identity, 99% coverage
BOV_A0282 sugar ABC transporter, ATP-binding protein from Brucella ovis ATCC 25840
59% identity, 99% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945...”
SM_b20328 ABC transporter for D-trehalose/D-maltose/sucrose, ATPase component (ThuK) from Sinorhizobium meliloti 1021
TC 3.A.1.1.17 / Q9R9Q4 ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) from Rhizobium meliloti (Sinorhizobium meliloti) (see 3 papers)
SMb20328 probable trehalosemaltose transporter ATP-binding protein from Sinorhizobium meliloti 1021
Q7ANR9 ThuK ABC transporter, ATP-binding protein from Rhizobium meliloti (strain 1021)
57% identity, 96% coverage
Pden_4439 ABC transporter related from Paracoccus denitrificans PD1222
58% identity, 99% coverage
PS417_12700 ABC transporter for D-Mannitol and D-Sorbitol, ATPase component from Pseudomonas simiae WCS417
54% identity, 91% coverage
- mutant phenotype: Specific phenotype on D-Sorbitol; D-Mannitol. Also important for D-mannose utilization, but is closely related to a P. aeruginosa system that is apparently not a mannose transporter (the substrate-binding component PA2338 does not bind mannose, see PMC6829864).
TC 3.A.1.1.49 / O30494 MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK from Pseudomonas fluorescens
54% identity, 91% coverage
- substrates: Arabitinol, glucitol, mannitol
- Sugar alcohol degradation in Archaea: uptake and degradation of mannitol and sorbitol in Haloarcula hispanica
Ortjohann, Extremophiles : life under extreme conditions 2024 - “...the secondary structure of MscK derived from AlphaFold prediction (AF-G0I055-F1-model_v4). UniProt accession: MscK, G0I055; MtlK, O30494; XacJ, D4GP38; XacK, D4GP39; RhcJ, D4GPB1; Tl-MalK, Q9YGA6; P68187 Mannitol and sorbitol are oxidized to fructose via two distinct dehydrogenases The msc cluster contains two genes, mscS (HAH_5138) and mscM...”
mtlK / Q4KC54 polyol ABC-type transporterATP-binding component MtlK from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) (see paper)
54% identity, 91% coverage
Psyr_2437 ABC transporter:TOBE from Pseudomonas syringae pv. syringae B728a
53% identity, 90% coverage
HZ99_03895 ABC transporter ATP-binding protein from Pseudomonas fluorescens
53% identity, 91% coverage
PGA1_c27970 N-Acetyl-D-glucosamine ABC transport system, ATPase component from Phaeobacter inhibens DSM 17395
57% identity, 100% coverage
- mutant phenotype: Specific phenotype on N-Acetyl-D-Glucosamine.
PA14_34370 putative ATP-binding component of ABC maltose/mannitol transporter from Pseudomonas aeruginosa UCBPP-PA14
53% identity, 89% coverage
PA2341 probable ATP-binding component of ABC maltose/mannitol transporter from Pseudomonas aeruginosa PAO1
53% identity, 89% coverage
SPO1835 ABC transporter ATP-binding protein from Ruegeria pomeroyi DSS-3
57% identity, 100% coverage
SM_b20002 ABC transporter for Lactose, ATPase component from Sinorhizobium meliloti 1021
53% identity, 93% coverage
- mutant phenotype: Specific phenotype on Beta-Lactose.
SMc03065 ABC transporter for D-maltose/D-trehalose/sucrose, ATPase component (AglK) from Sinorhizobium meliloti 1021
TC 3.A.1.1.8 / Q9Z3R9 AglK aka R00699 aka SMC03065, component of Sucrose/maltose/trehalose porter (sucrose-inducible) from Rhizobium meliloti (Sinorhizobium meliloti) (see 2 papers)
52% identity, 91% coverage
- mutant phenotype: Specific phenotype on D-Maltose monohydrate; D-Trehalose dihydrate. Also mildly important for D-cellobiose utilization, which has its own ABC transporter, so the cause is unclear. Also reported to transport sucrose (PMID:10400573, PMID:12003938)
- substrates: Maltose, Sucrose, Trehalose
Dshi_0546 ABC transporter for Xylitol, ATPase component from Dinoroseobacter shibae DFL-12
55% identity, 99% coverage
- mutant phenotype: Specific phenotype on Xylitol.
RHE_RS10605 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
52% identity, 93% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...K10111 MM RHE_RS27505 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS10605 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 Bacteroid RHE_RS25965 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K03406 MM RHE_RS02080 mcp; methyl-accepting chemotaxis protein...”
- “...mtlK , thuK ; multiple sugar transport system ATP-binding protein [EC:3.6.3.-]; in MM, the proteins RHE_RS10605, RHE_RS14795, RHE_RS27505 were identified, and RHE_RS25965 was expressed in bacteroid ( Table 1 ). The msmX , msmK , malK , sugC , ggtA , msiK ; multiple sugar transport...”
RHE_RS19645 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
53% identity, 91% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...HAL; histidine ammonia-lyase [EC:4.3.1.3] K10191 MM RHE_RS22750 lacK; lactose/L-arabinose transport system ATP-binding protein K10191 Bacteroid RHE_RS19645 lacK; lactose/L-arabinose transport system ATP-binding protein K10111 MM RHE_RS14795 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM RHE_RS27505 malK, mtlK, thuK; multiple sugar transport system ATP-binding...”
- “...ATP-binding protein, sn-glycerol-3-phosphate ABC transporter, the ATP-binding protein UgpC in MM RHE_RS22750 and in bacteroid RHE_RS19645 were identified ( Table 1 ). The rbsB ; ribose transport system substrate-binding protein is represented by the isoenzymes RHE_RS09135, RHE_RS22400, RHE_RS27555, RHE_RS30010, RHE_RS30060 in MM, and RHE_RS29865 was expressed...”
Atu4559 ABC transporter, nucleotide binding/ATPase protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
53% identity, 89% coverage
- Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
Jin, Biomolecules 2022 - “...atu4784 , afuB = atu4785 , afuC = atu4786 and others), maltose ( atu0391 , atu4559 , atu4450 ), oligogalacturonide ( atu3130 , atu3132 ), glucose ( atu3351 , atu3352 ), rhamnose ( atu34873490 ), sn-glycerol 3-phosphate ( ugpC = atu3099 / atu3188 ), branched-chain amino...”
Atu0595 ABC transporter, nucleotide binding/ATPase protein from Agrobacterium tumefaciens str. C58 (Cereon)
51% identity, 91% coverage
BRA0658 glycerol-3-phosphate ABC transporter, ATP-binding protein from Brucella suis 1330
53% identity, 95% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618 BCAN_B0656 OSP SN-glycerol-3-phosphate import...”
BMEII0621 SN-GLYCEROL-3-PHOSPHATE TRANSPORT ATP-BINDING PROTEIN UGPC from Brucella melitensis 16M
53% identity, 95% coverage
- Brucella melitensis global gene expression study provides novel information on growth phase-specific gene regulation with potential insights for understanding Brucella:host initial interactions
Rossetti, BMC microbiology 2009 - “...concert with other factors. Although genetic analysis reveals that ugpB may belong to an operon (BMEII0621 to II0625) that encodes for a sn-glycerol-3-phosphate ABC transporter [ 42 ], the experimental evidence does not support this hypothesis. A previous study showed that the product of ugpB in...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618...”
RL0749 putative alpha-glucoside transport ATP-binding protein from Rhizobium leguminosarum bv. viciae 3841
51% identity, 91% coverage
YPO3712 maltose/maltodextrin transport ATP-binding protein from Yersinia pestis CO92
53% identity, 88% coverage
- Construction and characterization of stable, constitutively expressed, chromosomal green and red fluorescent transcriptional fusions in the select agents, Bacillus anthracis, Yersinia pestis, Burkholderia mallei, and Burkholderia pseudomallei
Su, MicrobiologyOpen 2014 - “...P relC (YPO3751), P rplN (YPO0220), P nusE (YPO0209), P rpsM (YPO0231), and P rplU (YPO3712)) as a high-expression group along with P cysZK for promoter activity studies. Next, we elected to tag Y. pseudotuberculosis and Y. pestis using a Tn 7 -based, broad-range bacterial cloning...”
BCAN_B0658 Lactose transport ATP-binding protein lacK from Brucella canis ATCC 23365
53% identity, 95% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618 BCAN_B0656 OSP SN-glycerol-3-phosphate import IM BMEII0624, ugpA...”
Bcep1808_2705 ABC transporter related from Burkholderia vietnamiensis G4
52% identity, 89% coverage
- Mapping the Efficacy and Mode of Action of Ethylzingerone [4-(3-Ethoxy-4-Hydroxyphenyl) Butan-2-One] as an Active Agent against Burkholderia Bacteria
Rushton, Applied and environmental microbiology 2020 - “...was also upregulated. The largest significant change in expression (+4.26-fold) was associated with the gene Bcep1808_2705, which putatively encodes a sorbitol dehydrogenase. Network analysis of KEGG pathways indicated that the operon was putatively involved in fatty acid biosynthesis ( 17 ). All three genes within the...”
- “...HEPB. In connection, genes encoding a sorbitol-binding extracellular binding protein (Bcep1808_2709) and the operon from Bcep1808_2705 to Bcep1808_2708, which encodes an ABC transporter system, were significantly upregulated, 3.32- to 4.06-fold, in response to HEPB (Table S5). Twenty-five of the genes upregulated by 2-fold were located on...”
ESA_RS15745 ABC transporter ATP-binding protein from Cronobacter sakazakii ATCC BAA-894
50% identity, 90% coverage
- RecA deletion disrupts protein homeostasis, leading to deamidation, oxidation, and impaired glycolysis in <i>Cronobacter sakazakii</i>
Lu, Applied and environmental microbiology 2025 - “...This deficiency was correlated with diminished biofilm formation and decreased desiccation tolerance. Moreover, the gene ESA_RS15745 responsible for encoding a sugar transporter protein played a crucial role in regulating osmotic pressure in bacterial growth and reproduction and was also associated with desiccation tolerance and biofilm formation...”
- “...Xinjun D , Shuo W . 2024 . Effects and molecular mechanism of sugar transporter ESA_RS15745 on desiccation resistance, motility, and biofilm formation of Cronobacter sakazakii . J Food Sci 89 : 581 595 . doi: 10.1111/1750-3841.16872 38126106 43 Xue J , Lv J , Liu...”
- Effects and molecular mechanism of sugar transporter ESA_RS15745 on desiccation resistance, motility, and biofilm formation of Cronobacter sakazakii
Ping, Journal of food science 2024 (PubMed)- “...pathogen, can cause neonatal meningitis and sepsis with high rates of infection and death. Gene ESA_RS15745 encodes a sugar transporter protein, which is not only essential for osmotic pressure maintenance during bacterial growth and reproduction but also associated with their desiccation tolerance, motility, and biofilm formation....”
- “...resist desiccation, whereas an increase in the ability of motility and biofilm formation, implying that ESA_RS15745 may positively regulate sugar transport and desiccation tolerance and negatively regulate motility and biofilm formation. To further investigate the molecular mechanisms underlying the function of related genes, RNA-seq was performed...”
BOV_A0620 glycerol-3-phosphate ABC transporter, ATP-binding protein from Brucella ovis ATCC 25840
53% identity, 95% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618 BCAN_B0656 OSP SN-glycerol-3-phosphate import IM BMEII0624,...”
BPHYT_RS16095 ABC transporter for D-Sorbitol, ATPase component from Burkholderia phytofirmans PsJN
53% identity, 89% coverage
- mutant phenotype: Specific phenotype on D-Sorbitol.
RLO149_c015810 ABC transporter ATP-binding protein from Roseobacter litoralis Och 149
55% identity, 82% coverage
- Comparative genome analysis and genome-guided physiological analysis of Roseobacter litoralis
Kalhoefer, BMC genomics 2011 - “...transporter inner membrane component RLO149_c015790 putative extracellular galactoside-binding protein RLO149_c015800 HTH-type transcriptional regulator, IclR family RLO149_c015810 putative galactoside ABC transporter ATP-binding protein Cluster 2 RLO149_c021930 putative HTH-type transcriptional regulator gbpR (Galactose-binding protein regulator) RLO149_c021940 SbpA: multiple sugar-binding periplasmic protein RLO149_c021950 putative multiple sugar transport ATP-binding protein...”
RHE_RS23370 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
51% identity, 93% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS22575 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS23370 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS26890 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS28085...”
- “...msiK ; multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC...”
AT5A_09950 ABC transporter ATP-binding protein from Agrobacterium tumefaciens 5A
50% identity, 92% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...2.6 AT5A_09940 Sugar ABC transporter transmembrane protein 2.3 AT5A_09945 Sugar ABC transporter transmembrane protein 2.1 AT5A_09950 Sugar ABC transporter nucleotide-binding ATPase 2.2 AT5A_18906 Maltose ABC transporter transmembrane protein 2.4 AT5A_18911 Maltose ABC transporter transmembrane protein 2.4 AT5A_18916 Maltose ABC transporter substrate-binding protein 2.7 AT5A_18921 Maltose/maltodextrin ABC...”
RHE_RS22750 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
55% identity, 80% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...hutH, HAL; histidine ammonia-lyase [EC:4.3.1.3] K01745 Bacteroid RHE_RS01780 hutH, HAL; histidine ammonia-lyase [EC:4.3.1.3] K10191 MM RHE_RS22750 lacK; lactose/L-arabinose transport system ATP-binding protein K10191 Bacteroid RHE_RS19645 lacK; lactose/L-arabinose transport system ATP-binding protein K10111 MM RHE_RS14795 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 MM...”
- “...; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC transporter, the ATP-binding protein UgpC in MM RHE_RS22750 and in bacteroid RHE_RS19645 were identified ( Table 1 ). The rbsB ; ribose transport system substrate-binding protein is represented by the isoenzymes RHE_RS09135, RHE_RS22400, RHE_RS27555, RHE_RS30010, RHE_RS30060 in MM,...”
Spro_4470 ABC transporter-related protein from Serratia proteamaculans 568
52% identity, 88% coverage
SFHH103_06032 ABC transporter ATP-binding protein from Sinorhizobium fredii HH103
52% identity, 96% coverage
Psest_0871 maltose ABC transporter, ATPase component MalK from Pseudomonas stutzeri RCH2
50% identity, 88% coverage
- mutant phenotype: Specifically important for utilizing D-Maltose monohydrate.
TC 3.A.1.1.19 / Q8L122 PalK, component of Platinose (isomaltulose) (6-O-α-D-glucopyranosyl-D-fructofuranose) porter (see 3 papers)
palK / BAB96542.1 PalK from Agrobacterium tumefaciens (see 3 papers)
59% identity, 84% coverage
AT5A_18921 ABC transporter ATP-binding protein from Agrobacterium tumefaciens 5A
55% identity, 78% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...2.4 AT5A_18911 Maltose ABC transporter transmembrane protein 2.4 AT5A_18916 Maltose ABC transporter substrate-binding protein 2.7 AT5A_18921 Maltose/maltodextrin ABC transporter 2.7 AT5A_19366 Sugar ABC transporter periplasmic sugar-binding protein 7.2 7.8 5.5 5.7 26.5 7.0 5.9 5.1 AT5A_19371 Sugar ABC transporter permease 5.7 6.3 6.1 4.3 25.4 5.4...”
TC 3.A.1.1.4 / Q01937 LacK, component of Lactose porter from Agrobacterium radiobacter (see paper)
52% identity, 79% coverage
AFK62_RS17895 maltose/maltodextrin ABC transporter ATP-binding protein MalK from Cronobacter condimenti 1330
51% identity, 88% coverage
VCA0946 maltose/maltodextrin ABC transporter, ATP-binding protein from Vibrio cholerae O1 biovar eltor str. N16961
48% identity, 88% coverage
- Utilization of Small RNA Genes to Distinguish Vibrio cholerae Biotypes via Multiplex Polymerase Chain Reaction
Ahmed, The American journal of tropical medicine and hygiene 2019 (secret) - The quorum sensing transcription factor AphA directly regulates natural competence in Vibrio cholerae
Haycocks, PLoS genetics 2019 - “...a VCA0522 a 772158 772161 caatgcaaccaaatgaacag VCA0826 VCA0826 802525 802499 cgcatcaatcagttgcatct (VCA0851) 897851 897797 gcgtgcacaataattcatat VCA0946 a VCA0946 a 908441 908327 acgtgccaacttttcattag VCA0959 VCA0959 1035131 1035098 gaattaaatcaatttcatat (VCA1081) 1052121 1052131 ctatccaacatgttgcgtat (VCA1095) a 1053076 1053158 atagtcaaccattttcctac (VCA1097) VCA1097 < > VCA1098 1056176 1056200 ctactcaacatgttgctggc (VCA1100) 1...”
- “...prsA (VC2183), viuA (VC2211), pyrG (VC2448), hutR (VCA0064), pncB (VCA0098), intI4 (VCA0291), cqsS (VCA0522), malK (VCA0946), cheA-3 (VCA1095). 5 This column indicates the gene(s) with the closest start codon to the peak. In many cases peaks within genes are close to a start codon of an...”
RC1_3732 maltose from Rhodospirillum centenum SW
51% identity, 85% coverage
pRL120560 putative ATP-binding component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
50% identity, 96% coverage
MED193_07888 SN-glycerol-3-phosphate ABC transporter, ATP-binding protein from Roseobacter sp. MED193
A3X9J7 SN-glycerol-3-phosphate ABC transporter, ATP-binding protein from Roseobacter sp. MED193
50% identity, 92% coverage
- Bacterial catabolism of membrane phospholipids links marine biogeochemical cycles
Westermann, Science advances 2023 - “...N/D N/D MED193_07883 A3X9K3 GlpQ-2 Putative extracellular glycerophosphoryl diester phosphodiesterase ++ 2.56 0.01 N/D N/D MED193_07888 A3X9J7 UgpC Putative G3P ABC transporter, ATPase ++ 3.55 0.07 0.72 0.00 MED193_07903 A3X9J4 UgpB Putative G3P ABC transporter, periplasmic substrate binding protein ++ 4.05 0.95 -2.32 0.00 MED193_10151 A3XFY0...”
- Bacterial catabolism of membrane phospholipids links marine biogeochemical cycles
Westermann, Science advances 2023 - “...N/D MED193_07883 A3X9K3 GlpQ-2 Putative extracellular glycerophosphoryl diester phosphodiesterase ++ 2.56 0.01 N/D N/D MED193_07888 A3X9J7 UgpC Putative G3P ABC transporter, ATPase ++ 3.55 0.07 0.72 0.00 MED193_07903 A3X9J4 UgpB Putative G3P ABC transporter, periplasmic substrate binding protein ++ 4.05 0.95 -2.32 0.00 MED193_10151 A3XFY0 PhnE...”
TC 3.A.1.1.12 / Q9AI63 PalK, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter from Erwinia rhapontici (see paper)
49% identity, 89% coverage
RHE_RS25965 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
55% identity, 76% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...K10111 MM RHE_RS10605 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K10111 Bacteroid RHE_RS25965 malK, mtlK, thuK; multiple sugar transport system ATP-binding protein [EC:7.5.2.-] K03406 MM RHE_RS02080 mcp; methyl-accepting chemotaxis protein K03406 MM RHE_RS02690 mcp; methyl-accepting chemotaxis protein K03406 MM RHE_RS03220 mcp; methyl-accepting chemotaxis...”
- “...transport system ATP-binding protein [EC:3.6.3.-]; in MM, the proteins RHE_RS10605, RHE_RS14795, RHE_RS27505 were identified, and RHE_RS25965 was expressed in bacteroid ( Table 1 ). The msmX , msmK , malK , sugC , ggtA , msiK ; multiple sugar transport system ATP-binding protein, in MM represented...”
Atu3188 ABC transporter, nucleotide binding/ATPase protein (glycerol-3-phosphate) from Agrobacterium tumefaciens str. C58 (Cereon)
50% identity, 94% coverage
MALK_SALTY / P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
SL1344_4167 maltose/maltodextrin ABC transporter ATP-binding protein MalK from Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NP_463095 maltose transport protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
51% identity, 90% coverage
- function: Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Responsible for energy coupling to the transport system.
catalytic activity: D-maltose(out) + ATP + H2O = D-maltose(in) + ADP + phosphate + H(+) (RHEA:22132)
subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalK) and a solute-binding protein (MalE). - speG Is Required for Intracellular Replication of Salmonella in Various Human Cells and Affects Its Polyamine Metabolism and Global Transcriptomes
Fang, Frontiers in microbiology 2017 - “...Succinate dehydrogenase cytochrome b-556 subunit 1.027 Other Genes narK SL1344_1693 Nitrite extrusion protein 4.443 malK SL1344_4167 Maltosemaltodextrin transport ATP-binding protein 3.343 ybf M SL1344_0669 Putative outer membrane protein 2.372 SL1344_2997 SL1344_2997 Acetyl-CoA acetyltransferase 2.089 SL1344_3662 SL1344_3662 Putative racemase 1.552 SL1344_0211 SL1344_0211 Hypothetical protein 1.495 dctA SL1344_3579...”
- Mapping putative contact sites between subunits in a bacterial ATP-binding cassette (ABC) transporter by synthetic peptide libraries.
Blüschke, Journal of molecular biology 2007 (PubMed)- GeneRIF: Results identify specific molecular contacts made between MalK and MalFG that extend beyond the well-characterized EAA motif.
- Topography of the surface of the signal-transducing protein EIIA(Glc) that interacts with the MalK subunits of the maltose ATP-binding cassette transporter (MalFGK2) of Salmonella typhimurium.
Blüschke, The Journal of biological chemistry 2006 (PubMed)- GeneRIF: the surface of the signal-transducing protein EIIA(Glc) interacts with the MalK subunits of the maltose ATP-binding cassette transporter (MalFGK2) of Salmonella typhimurium
- Domain structure of the ATP-binding-cassette protein MalK of salmonella typhimurium as assessed by coexpressed half molecules and LacK'-'MalK chimeras
Schmees, Journal of bacteriology 1998 - “...MalK of S. typhimurium (MALK STY), SwissProt accession no. P19566, corrected at position 141; MalK of E. coli (MALK ECO), SwissProt accession no. P02914; LacK...”
- Cloning, nucleotide sequence, and overexpression of smoS, a component of a novel operon encoding an ABC transporter and polyol dehydrogenases of Rhodobacter sphaeroides Si4
Stein, Journal of bacteriology 1997 - “...Salmonella typhimurium (MalK_Sty), SwissProt accession no. P19566 (10); LacK from Agrobacterium radiobacter (LacK_Agr), SwissProt accession no. Q01937 (46);...”
Ac3H11_2941 ABC transporter for D-Sorbitol, ATPase component from Acidovorax sp. GW101-3H11
51% identity, 94% coverage
- mutant phenotype: Specific phenotypes on D-Sorbitol.
c5005 Maltose/maltodextrin transport ATP-binding protein malK from Escherichia coli CFT073
50% identity, 81% coverage
N646_3117 maltose/maltodextrin ABC transporter ATP-binding protein MalK from Vibrio alginolyticus NBRC 15630 = ATCC 17749
48% identity, 89% coverage
RSP_2870 ABC alpha-glucoside transporter, ATPase subunit AglK from Rhodobacter sphaeroides 2.4.1
55% identity, 78% coverage
VF_A0800 maltose/maltodextrin transporter ATP-binding protein from Vibrio fischeri ES114
48% identity, 89% coverage
MalK / b4035 maltose ABC transporter ATP binding subunit (EC 7.5.2.1) from Escherichia coli K-12 substr. MG1655 (see 31 papers)
MalK / P68187 maltose ABC transporter ATP binding subunit (EC 7.5.2.1) from Escherichia coli (strain K12) (see 29 papers)
MALK_ECOLI / P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 6 papers)
P68187 ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) from Escherichia coli (see paper)
TC 3.A.1.1.1 / P68187 Maltose/maltodextrin import ATP-binding protein MalK aka B4035, component of Maltooligosaccharide porter. The 3-D structure has been reported by Oldham et al. (2007). An altering access mechanism has been suggested for the maltose transporter resulting from rigid-body rotations (Khare et al., 2009). Bordignon et al. (2010) and Schneider et al. (2012) have reviewed the extensive knowledge available on MalEFGK2, its mode of action and its regulatory interactions from Escherichia coli (see 17 papers)
malK / RF|NP_418459 maltose/maltodextrin import ATP-binding protein malK; EC 3.6.3.19 from Escherichia coli K12 (see 18 papers)
b4035 fused maltose transport subunit, ATP-binding component of ABC superfamily/regulatory protein from Escherichia coli str. K-12 substr. MG1655
NP_418459 maltose ABC transporter ATP binding subunit from Escherichia coli str. K-12 substr. MG1655
EcolC_3994 ABC transporter related from Escherichia coli C str. ATCC 8739
Z5633 ATP-binding component of transport system for maltose from Escherichia coli O157:H7 EDL933
E2348C_4350, Z_RS26335 maltose/maltodextrin ABC transporter ATP-binding protein MalK from Escherichia coli O127:H6 str. E2348/69
51% identity, 88% coverage
- function: Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Responsible for energy coupling to the transport system.
catalytic activity: D-maltose(out) + ATP + H2O = D-maltose(in) + ADP + phosphate + H(+) (RHEA:22132)
subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE). Protein stability and stable complex formation require YidC. - substrates: Maltooligosaccharides, Maltose
tcdb comment: The transporter sequesters the MalT transcriptional activator at the cytoplasmic surface of the membrane in the absence of the transport substrate (Richet et al. 2012). The crystal structures of the transporter complex MBP-MalFGK2 bound with large malto-oligosaccharide in two different conformational states have also been determined. In the pretranslocation structure,Oldham et al. 2013 found that the transmembrane subunit MalG forms two hydrogen bonds with malto-oligosaccharide at the reducing end. In the outward-facing conformation, the transmrembrane subunit MalF binds three glucosyl units from the nonreducing end. These structural features explain why large modified malto-oligosaccharides are not transported by MalFGK2 despite their high binding affinity to MBP. In the transport cycle, substrate is channeled from MBP into the transmembrane pathway with a polarity such that both MBP and MalFGK2 contribute to the overall substrate selectivity of the system (Oldham et al. 2013). Stabilization of the semi-open MalK2 conformation by maltose-bound MBP is key to the coupling of maltose transport to ATP hydrolysis in vivo, because it facilitates the progression of the MalK dimer from the open to the semi-open conformation, from which it can proceed to hydrolyze ATP (Alvarez et al. 2015). Both the binding of MalE to the periplasmic side of the transmembrane complex and binding of ATP to MalK2 are necessary to facilitate the conformational change from the inward-facing state to the occluded state, in which MalK2 is completely dimerized (Hsu et al. 2017). An integrated transport mechanism of the maltose ABC importer has been proposed (Mächtel et al. 2019) - CyuR is a dual regulator for L-cysteine dependent antimicrobial resistance in Escherichia coli
Rodionova, Communications biology 2024 - “...- 1.9 23 malE b4034 Maltose ABC transporter 178 4.93 GcAaAAATcGTgGCgATTTtaTg 1.4 1.8 24 malK b4035 Maltose ABC transporter 209 4.93 cAtaAAATcGCcACgATTTtTgC 2.7 3.9 25 prfC b4375 Peptide chain release factor 3 71 5.53 GGtaAAATaGCcGCAATTTtTCg 1.1 1.0 a Fold changes in gene expression when cyuR was...”
- Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
Franchini, PloS one 2015 - “..., i b4034 periplasmic maltose-binding protein 7.5 malK c , f , g , i b4035 ATP-binding component of transport system for maltose 4.2 lamB c , f , g , i b4036 phage lambda receptor protein, maltose high-affinity receptor 8.1 malM c , f ,...”
- Global transcriptomic analysis of an engineered Escherichia coli strain lacking the phosphoenolpyruvate: carbohydrate phosphotransferase system during shikimic acid production in rich culture medium
Cortés-Tolalpa, Microbial cell factories 2014 - “...binding protein Transport 174.0512 malF b4033 Maltose ABC transporter - membrane subunit Transport 19.1719 malK b4035 Maltose ABC transporter - ATP binding subunit Transport 14.8026 nmpC b0553 OMP protein; locus of qsr prophage Transport 11.7561 proX b2679 Glycine betaine/proline ABC transporter - periplasmic binding protein Transport...”
- Enhancing E. coli tolerance towards oxidative stress via engineering its global regulator cAMP receptor protein (CRP)
Basak, PloS one 2012 - “...b number Gene Log 2 Fold Change CRP b4036 lamB 8.997 b4034 malE * 8.930 b4035 malK 8.502 RpoS b3517 gadA * 4.517 b1493 gadB 4.571 b1732 katE * 2.701 b1896 otsA * 2.581 * - Analyzed by qRT-PCR ( Table S4 ). qRT-PCR was carried...”
- Escherichia coli toxin/antitoxin pair MqsR/MqsA regulate toxin CspD
Kim, Environmental microbiology 2010 - “...protein, periplasmic, substrate recognition for active transport of and chemotaxis toward maltose and maltodextrin malK b4035 1.1 1.1 3.2 Maltose transport complex, ATP-binding subunit malL b4036 1.9 1.2 4.3 Maltoporin, maltose high-affinity uptake system malM b4037 1.6 1.3 3.0 Periplasmic protein in maltose transport system, function...”
- Sxy induces a CRP-S regulon in Escherichia coli
Sinha, Journal of bacteriology 2009 - “...b1948 b1950 b1566 b1923 b1938 b1939 b1940 b1921 b1922 b3525 b4035 b4036 b1073 b1074 b1075 b1076 b1077 b1078 b4034 malP tsr aer cheZ tap fliD fliS fliT trg cheW...”
- Analysis of promoter targets for Escherichia coli transcription elongation factor GreA in vivo and in vitro
Stepanova, Journal of bacteriology 2007 - “...(glyoxylate cycle) malG malF malE malK lamB malM b4032 b4033 b4034 b4035 b4036 b4037 2.1 3.2 1.9 4.2 3.1 4.5 2.8 3.7 5.8 7.5 7.1 6.5 Part of maltose permease,...”
- YdgG (TqsA) controls biofilm formation in Escherichia coli K-12 through autoinducer 2 transport
Herzberg, Journal of bacteriology 2006 - “...7.5 dcuB malK acrF artJ pheP ycfT agaD b4123 b4035 b3266 b0860 b0576 b1115 b3140 6.5 6.1 5.7 5.3 4.9 4.3 4 Putative oxidoreductase; putative methyltransferase...”
- More
- Coupling between ATP hydrolysis and protein conformational change in maltose transporter.
Lv, Proteins 2017 (PubMed)- GeneRIF: Coupling between ATP hydrolysis and protein conformational change in maltose transporter MalK has been described.
- Formation of a Chloride-conducting State in the Maltose ATP-binding Cassette (ABC) Transporter.
Carlson, The Journal of biological chemistry 2016 - GeneRIF: Data indicate that MalFGK2 transporter is comprised of two membrane proteins, MalF and MalG, and the nucleotide-binding domain, which controls the conformation of MalFG, is composed of the homodimeric MalK subunit.
- Allosteric transitions of the maltose transporter studied by an elastic network model.
Li, Biopolymers 2014 (PubMed)- GeneRIF: Data suggest that the binding and conformational change of maltose transporter (MalFGK2) may provide some insights into the understanding of the mechanism of ABC transporters.
- ATP-induced conformational changes of nucleotide-binding domains in an ABC transporter. Importance of the water-mediated entropic force.
Hayashi, The journal of physical chemistry. B 2014 (PubMed)- GeneRIF: The water-mediated entropic force is important for ATP-induced conformational changes of nucleotide-binding domains in MalK.
- The inhibitory effects of Escherichia coli maltose binding protein on β-amyloid aggregation and cytotoxicity.
Sharoar, Archives of biochemistry and biophysics 2013 (PubMed)- GeneRIF: Escherichia coli maltose binding protein has inhibitory effects on beta-amyloid aggregation and cytotoxicity
- The ABC transporter MalFGK(2) sequesters the MalT transcription factor at the membrane in the absence of cognate substrate.
Richet, Molecular microbiology 2012 - GeneRIF: The molecular entity that interacts with MalT is not free MalK, but the maltose transporter, MalFGK(2) , which sequesters MalT to the membrane.
- Crystal structure of the maltose transporter in a pretranslocation intermediate state.
Oldham, Science (New York, N.Y.) 2011 (PubMed)- GeneRIF: using x-ray crystallography, study captured the maltose transporter in an intermediate step between the inward- and outward-facing states
- ATP-driven MalK dimer closure and reopening and conformational changes of the "EAA" motifs are crucial for function of the maltose ATP-binding cassette transporter (MalFGK2).
Daus, The Journal of biological chemistry 2007 (PubMed)- GeneRIF: ATP-driven MalK dimer closure and reopening are crucial steps in the translocation cycle of the intact maltose transporter MalFGK2
- More
- Sugar alcohol degradation in Archaea: uptake and degradation of mannitol and sorbitol in Haloarcula hispanica
Ortjohann, Extremophiles : life under extreme conditions 2024 - “...(AF-G0I055-F1-model_v4). UniProt accession: MscK, G0I055; MtlK, O30494; XacJ, D4GP38; XacK, D4GP39; RhcJ, D4GPB1; Tl-MalK, Q9YGA6; P68187 Mannitol and sorbitol are oxidized to fructose via two distinct dehydrogenases The msc cluster contains two genes, mscS (HAH_5138) and mscM (HAH_5147) , that encode putative dehydrogenases. The functional involvement...”
- Multitask ATPases (NBDs) of bacterial ABC importers type I and their interspecies exchangeability
Leisico, Scientific reports 2020 - “...subtilis MsmX and E. coli MalK proteins. Primary sequences of MsmX and MalK (Uniprot code P68187) were aligned using EMBOSS Needle ( https://www.ebi.ac.uk/Tools/psa/emboss_needle/ ). Functional motifs characteristics of NBDs are highlighted and colored according to the structure of B. subtilis MsmX K43A presented in Fig. 5...”
- Gating by ionic strength and safety check by cyclic-di-AMP in the ABC transporter OpuA
Sikkema, Science advances 2020 - “...follows: Ll-OpuAA, Q9KIF7; Bs-OpuAA, P46920; Lm-GbuA, Q9RR46; Ec-ProV, P14175; Ec-MetN, P30750; Cs-ArtN, Q8RCC2; and Ec-MalK, P68187. ( B ) HTH region of the NBD in the occluded conformation. The basic residues of KRIK are shown in stick representation in blue. ( C ) In vivo 14...”
- The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
Ferreira, PloS one 2017 - “...maltose transporter are underlined in green . Accession numbers: MsmX (P94360), YurJ (O32151), and MalK (P68187). (TIF) Click here for additional data file. S3 Fig Sequence alignment of three ABC-type ATPases. The alignment between B . subtilis MsmX and OpuAA, and E . coli MalK was...”
- “...pink (similar in MsmX), or orange (not conserved in MsmX). Accession numbers: MsmX (P94360), MalK (P68187), and OpuAA (P46920). (TIF) Click here for additional data file. S1 Appendix Construction of plasmids and B. subtilis strains. (DOCX) Click here for additional data file. Lia Godinho constructed pLG31,...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...no.b Descriptionb pI/MW Theoreticalc Experimentald P68187 Maltose/maltodextrin import ATP-binding protein 6.23/40,990.45 ManA P00946 Mannose-6-phosphate...”
- A novel point mutation in RpoB improves osmotolerance and succinic acid production in Escherichia coli
Xiao, BMC biotechnology 2017 - “...under osmotic stress. For example, transcript levels of malE (EcolC_3995), malF (EcolC_3996), malG (EcolC_3997) malK (EcolC_3994), and lamB (EcolC_3993), which encode individual subunits of the maltose ABC (ATP-binding cassette) transporter, decreased 10- to 14- fold in Suc-T110 compared to the corresponding levels in RpoBD645Y under osmotic...”
- Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
Segura, BMC genomics 2018 - “...NDE NDE Z5630 malG Maltose/maltodextrin transport system (permease protein) NDE 2.79 3.81E-05 NDE NDE NDE Z5633 malK Multiple sugar transport system (ATP-binding protein) NDE 3.99 7.37E-08 NDE 2.36 3.38E-03 NDE Z2860 manX PTS system mannose-specific IIAB component NDE 2.69 4.64E-08 NDE NDE NDE Z2861 manY PTS...”
- Transcriptomic Analysis of Viable but Non-Culturable Escherichia coli O157:H7 Formation Induced by Low Temperature
Zhong, Microorganisms 2019 - “...Z_RS03375, ugp C, rht B, kdg T, brn Q IT, OAT, SSTTA, ITTA 1 Z_RS26780, Z_RS26335, Z_RS25895, Z_RS25370, Z_RS24525, Z_RS24370, Z_RS23610, Z_RS23465, Z_RS22905, Z_RS21350, Z_RS21150, Z_RS21140, Z_RS21025, Z_RS19885, Z_RS18625, Z_RS16005, Z_RS12610, Z_RS12490, Z_RS09475, Z_RS09120, Z_RS04060, Z_RS03890, Z_RS02910, Z_RS02490, Z_RS01960, sec F, pst S, pst A, nep...”
- Microarray analysis of the Ler regulon in enteropathogenic and enterohaemorrhagic Escherichia coli strains
Bingle, PloS one 2014 - “...- predicted transporter E2348C_4348 2 malF maltose transporter subunit E2348C_4349 2 malE maltose transporter subunit E2348C_4350 3 malK maltose transporter subunit E2348C_4351 3 lamB maltose outer membrane porin (maltoporin) E2348C_4442 3 eptA predicted metal dependent hydrolase EptA pMAR2_096 3 - putative glutamate:gamma-aminobutyrate antiporter pMAR2 pMAR2_097 2...”
KP1_0276 maltose transport system ATP-binding component from Klebsiella pneumoniae NTUH-K2044
52% identity, 88% coverage
SPO0237 sn-glycerol-3-phosphate import ATP-binding protein UgpC from Ruegeria pomeroyi DSS-3
50% identity, 93% coverage
- Bacterial transcriptional response to labile exometabolites from photosynthetic picoeukaryote Micromonas commoda
Ferrer-González, ISME communications 2023 - “...DSS-3 in co-culture with M. commoda . Locus Tag Protein ID Fold Change Description Transporters SPO0237 AAV93562.1 36.3 SN-glycerol-3-phosphate ABC transporter, ATP-binding protein ugpC SPO0238 AAV93563.1 25.4 SN-glycerol-3-phosphate ABC transporter, permease ugpE SPO0239 AAV93564.1 30.3 SN-glycerol-3-phosphate ABC transporter, permease ugpA SPO0240 AAV93565.1 23.7 SN-glycerol-3-phosphate ABC transporter,...”
- Diel investments in metabolite production and consumption in a model microbial system
Uchimiya, The ISME journal 2022 - “...SPO0238 ugpE ABC transporter, permease 4.3 [ 25 ] SPO0239 ugpA ABC transporter, permease 3.3 SPO0237 upgC ABC transporter, ATP-binding 3.5 SPO0240 ugpB ABC transporter, periplasmic substrate-binding protein 1.3 (n.s.) Nuceloside Xanthine SPO0654 xdhA Xanthine dehydrogenase, A subunit 33.4 [ 76 ] SPO0653 xdhB Xanthine dehydrogenase,...”
blr3917 ABC transporter ATP-binding protein from Bradyrhizobium japonicum USDA 110
50% identity, 92% coverage
BWI76_RS01840 maltose ABC transporter, ATPase component (MalK) from Klebsiella michiganensis M5al
51% identity, 88% coverage
- mutant phenotype: Specifically important for maltose utilization
APZ00_20870 ABC transporter ATP-binding protein from Pannonibacter phragmitetus
51% identity, 93% coverage
Atu3099 ABC transporter, nucleotide binding/ATPase protein (sn-Glycerol-3-phosphate) from Agrobacterium tumefaciens str. C58 (Cereon)
48% identity, 90% coverage
- Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
Jin, Biomolecules 2022 - “...glucose ( atu3351 , atu3352 ), rhamnose ( atu34873490 ), sn-glycerol 3-phosphate ( ugpC = atu3099 / atu3188 ), branched-chain amino acid ( livH = atu4518 , livG = atu4516 , livM = atu4517 , and others) and urea ( atu55315533 ) were all up-regulated during...”
- Arginine-Rich Small Proteins with a Domain of Unknown Function, DUF1127, Play a Role in Phosphate and Carbon Metabolism of Agrobacterium tumefaciens
Kraus, Journal of bacteriology 2020 (secret)
APP7_1286 maltose/maltodextrin import ATP-binding protein MalK from Actinobacillus pleuropneumoniae serovar 7 str. AP76
APL_1236 maltose/maltodextrin import ATP-binding protein MalK from Actinobacillus pleuropneumoniae L20
47% identity, 87% coverage
CTN_1296 Sugar ABC transporter, ATP-binding protein from Thermotoga neapolitana DSM 4359
48% identity, 89% coverage
2awnB / P68187 Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
51% identity, 86% coverage
- Ligand: adenosine-5'-diphosphate (2awnB)
RHE_RS29410 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
50% identity, 94% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS28085 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS29410 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS12565 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS24950...”
- “...sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC transporter, the ATP-binding...”
WU75_03185 maltose/maltodextrin ABC transporter ATP-binding protein MalK from Vibrio parahaemolyticus
VPA1402 maltose/maltodextrin ABC transporter, ATP-binding protein from Vibrio parahaemolyticus RIMD 2210633
47% identity, 89% coverage
TC 3.A.1.1.22 / Q9X103 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins from Thermotoga maritima (see paper)
TM1276 sugar ABC transporter, ATP-binding protein from Thermotoga maritima MSB8
48% identity, 89% coverage
- substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
- Uncoupling Fermentative Synthesis of Molecular Hydrogen from Biomass Formation in Thermotoga maritima
Singh, Applied and environmental microbiology 2018 - “...type) T. maritima; TM0460 (corresponds to THMB_0470) (W229UGA), TM1276 (corresponds to THMB_1301 of Tma100) (G148D and D345L), 16S rRNA (nucleotide A to G at...”
- “...TM0460 (corresponds to THMC_0470 of Tma200) (W229UGA), TM1276 (corresponds to THMC_1301 of Tma200) (V233S) and 3=TM1322 (corresponds to THMC_1346 of Tma200)...”
- Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
Noll, BMC evolutionary biology 2008 - “...Fig. 3 is unrelated to any archaeal ORFs. This cluster includes the Tt. maritima ORF TM1276 which, based upon gene expression data, has been suggested to encode a maltose transporter ABP [ 24 , 25 ]. Unfortunately this analysis does not provide additional support for that...”
- “...lack of a malK near these Thermotogales operons is not unusual. Two Tt. maritima ORFs, TM1276 and TM1232, were identified here as potential MalK homologs by phylogenetic analyses, but we did not observe up regulation of either ORF in response to growth on maltose [ 33...”
- An expression-driven approach to the prediction of carbohydrate transport and utilization regulons in the hyperthermophilic bacterium Thermotoga maritima
Conners, Journal of bacteriology 2005 - “...TM0595, TM0596, TM0598 TM0810-TM0812 TM1202-TM1204 TM1232-TM1235 TM1276 TM1836, TM1839 TM1853-TM1855 Unknown This study Unknown This study 47 Unknown...”
SMb20661 putative sugar uptake ABC transporter ATP-binding protein from Sinorhizobium meliloti 1021
50% identity, 92% coverage
BCAN_B0753 Lactose transport ATP-binding protein lacK from Brucella canis ATCC 23365
BRA0745 sugar ABC transporter, ATP-binding protein, putative from Brucella suis 1330
50% identity, 94% coverage
- Differential expression of iron acquisition genes by Brucella melitensis and Brucella canis during macrophage infection
Eskra, PloS one 2012 - “...transport system permease protein - NC 2.57 BMEII0542 BCAN_B0755 sugar-binding protein - NC 5.25 BMEII0544 BCAN_B0753 SN-glycerol-3-phosphate transport ATP-binding protein ugpC NC 4.46 BMEII0548 BCAN_B0748 glycine betaine/L-proline transport ATP-binding protein proV NC 3.32 BMEII0929 BCAN_B0318 ribonucleotide-diphosphate reductase subunit beta nrdF NC 3.41 BMEII0930 BCAN_B0317 ribonucleotide-diphosphate reductase...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import...”
BAB2_0493 Disease resistance protein:Adenylate kinase:ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase:TOBE domain from Brucella melitensis biovar Abortus 2308
BMEII0544 SN-GLYCEROL-3-PHOSPHATE TRANSPORT ATP-BINDING PROTEIN UGPC from Brucella melitensis 16M
50% identity, 94% coverage
- Intracellular adaptation of Brucella abortus
Lamontagne, Journal of proteome research 2009 - “...transporters whose expression increased considerably were inner membrane and inner membrane associated energy coupled transporters (BAB2_0493, BAB2_0703, BAB2_1011), indicating active mobilization of molecules through the cell envelope. In agreement with the proteomic analysis of B. abortus outer membrane fragments 5 , only Omp2b porin isotype (BAB1_0660)...”
- “...synthesis Ilvc 48 BAB2_0023 Transporters Trs-ABC branched amino acid 49 BAB1_2150 Stress response Dps 49 BAB2_0493 Transporters UgpC 50 BAB1_0962 Stress response SAMbm 50 BAB2_0703 Transporters Trs-ABC ATP binding 51 BAB2_0531 Stress response AhpC-like-2 51 BAB2_1011 Transporters Trs-ABC ATP binding 52 BAB2_0189 Stress response GroEL 52...”
- Differential expression of iron acquisition genes by Brucella melitensis and Brucella canis during macrophage infection
Eskra, PloS one 2012 - “...sugar transport system permease protein - NC 2.57 BMEII0542 BCAN_B0755 sugar-binding protein - NC 5.25 BMEII0544 BCAN_B0753 SN-glycerol-3-phosphate transport ATP-binding protein ugpC NC 4.46 BMEII0548 BCAN_B0748 glycine betaine/L-proline transport ATP-binding protein proV NC 3.32 BMEII0929 BCAN_B0318 ribonucleotide-diphosphate reductase subunit beta nrdF NC 3.41 BMEII0930 BCAN_B0317 ribonucleotide-diphosphate...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or...”
RHE_RS26890 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
49% identity, 94% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS23370 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS26890 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS28085 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS29410...”
- “...; multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC transporter,...”
Smed_3707 glycerol-3-phosphate transporter ATP-binding subunit from Sinorhizobium medicae WSM419
50% identity, 95% coverage
- Identification of Sinorhizobium (Ensifer) medicae based on a specific genomic sequence unveiled by M13-PCR fingerprinting
Dourado, International microbiology : the official journal of the Spanish Society for Microbiology 2009 (PubMed)- “...M13-PCR amplicon of ca. 1500 bp, observed only in S. medicae isolates and spanning locus Smed_3707 to Smed_3709 from the pSMED01 plasmid sequence of S. medicae WSM419 genome's sequence, a pair of PCR primers was designed and used for direct PCR amplification of a 1399-bp sequence...”
Dshi_1648 glucose/maltose/trehalose/sucrose ABC transporter, ATPase component from Dinoroseobacter shibae DFL-12
49% identity, 89% coverage
- mutant phenotype: Related to alpha-glucoside transporter component aglK. Specifically important for utilization of D-glucose, D-maltose, D-trehalose, and sucrose.
BOV_A0696 putative sugar ABC transporter, ATP-binding protein from Brucella ovis ATCC 25840
50% identity, 94% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM...”
UgpC / b3450 sn-glycerol 3-phosphate ABC transporter ATP binding subunit (EC 7.6.2.10) from Escherichia coli K-12 substr. MG1655 (see 5 papers)
UgpC / P10907 sn-glycerol 3-phosphate ABC transporter ATP binding subunit (EC 7.6.2.10) from Escherichia coli (strain K12) (see 2 papers)
UGPC_ECOLI / P10907 sn-glycerol-3-phosphate import ATP-binding protein UgpC; EC 7.6.2.10 from Escherichia coli (strain K12) (see 9 papers)
TC 3.A.1.1.3 / P10907 UgpC aka B3450, component of Glycerol-phosphate porter. Transports both glycerol-3-P and glycerol-3-P diesters including glycerophosphocholine but not glycerol-2-P from Escherichia coli (see 12 papers)
ECK3434 sn-glycerol 3-phosphate ABC transporter ATP binding subunit from Escherichia coli str. K-12 substr. MG1655
b3450 ATP-binding component of sn-glycerol 3-phosphate transport system from Escherichia coli str. K-12 substr. MG1655
49% identity, 94% coverage
- function: Part of the ABC transporter complex UgpBAEC involved in sn- glycerol-3-phosphate (G3P) import (PubMed:23013274, PubMed:2842304, PubMed:363686, PubMed:7042685, PubMed:8282692). Responsible for energy coupling to the transport system (Probable). Can also transport glycerophosphoryl diesters, which are hydrolyzed to G3P and alcohol during transport (PubMed:2842304). The G3P moiety can be detected in the cytoplasm whereas the corresponding alcohol is usually found in the culture medium (PubMed:2842304). It was proposed by Yang et al that the complex could also transport glycerol-2-phosphate (G2P) in vivo, but it was shown later by Wuttge et al that UgpB does not bind G2P, questioning this transport activity (PubMed:19429609, PubMed:23013274). G2P might be converted in the periplasm to G3P before its transport (PubMed:23013274).
catalytic activity: sn-glycerol 3-phosphate(out) + ATP + H2O = sn-glycerol 3- phosphate(in) + ADP + phosphate + H(+) (RHEA:21668)
catalytic activity: glycerol 2-phosphate(out) + ATP + H2O = glycerol 2- phosphate(in) + ADP + phosphate + H(+) (RHEA:34759)
subunit: The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute-binding protein (UgpB).
disruption phenotype: Mutant lacking this gene fails to grow on both glycerol-3-phosphate and glycerol-2-phosphate. - substrates: Glycerol-phosphate
tcdb comment: UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012). UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012) - Global regulation by the seven-component Pi signaling system
Hsieh, Current opinion in microbiology 2010 - “...subunit [ 1 ] ugpB ECK3437 glycerol-3-phosphate transporter subunit, periplasmic-binding component [ 1 ] ugpC ECK3434 glycerol-3-phosphate transporter subunit, ATP-binding component [ 1 ] ugpE ECK3435 glycerol-3-phosphate transporter subunit, membrane component [ 1 ] ugpQ ECK3433 glycerol-3-phosphate transporter subunit, membrane component [ 1 ] yibD ECK3605...”
- Genome-wide analysis of the general stress response network in Escherichia coli: sigmaS-dependent genes, promoters, and sigma factor selectivity
Weber, Journal of bacteriology 2005 - “...yqaE b0861 b0864 b4149 b2452 b2663 b3291 b0854 b1234 b3453 b3450 b0808 b0815 b1440 b1644 b1806 b1833 b3474 b3522 b2543 b2666 Gene product a OD 4 NaClb pH 5c...”
- RpoS-regulated genes of Escherichia coli identified by random lacZ fusion mutagenesis
Vijayakumar, Journal of bacteriology 2004 - “...no. ybaY gabP ugpE b0453 b2663 b3451 ugpC ydcS yehX b3450 b1440 b2129 narY appB IdcC aidB b1467 b0979 b0186 b4187 katE uspB b1732 b3494 osmY b4376 yhiV b3514...”
Pf1N1B4_5115 sucrose ABC transporter, ATPase component from Pseudomonas fluorescens FW300-N1B4
50% identity, 82% coverage
- mutant phenotype: Specific phenotype on sucrose
ECs4296 ATP-binding component of sn-glycerol 3-phosphate transport system from Escherichia coli O157:H7 str. Sakai
49% identity, 94% coverage
TM1232 sugar ABC transporter, ATP-binding protein from Thermotoga maritima MSB8
45% identity, 92% coverage
VS_II0219 maltose/maltodextrin transporter ATP-binding protein from Vibrio splendidus LGP32
46% identity, 89% coverage
VIBHAR_05213 hypothetical protein from Vibrio harveyi ATCC BAA-1116
47% identity, 89% coverage
- Functional determinants of the quorum-sensing non-coding RNAs and their roles in target regulation
Shao, The EMBO journal 2013 - “...altered production when Qrr4 was induced ( Figure 1B ). Four targets ( vibhar_00986 , vibhar_05213 , vibhar_05384, and vibhar_06097 ) showed no regulation in E. coli , suggesting that these targets are not directly controlled by Qrr4 or the regions responsible for regulation are not...”
- “...5 RACE The transcription start sites of vibhar_00417 , vibhar_02446 , vibhar_02509 , vibhar_04936 , vibhar_05213 , vibhar_05763 , vibhar_05691 , and vibhar_06930 were mapped using FirstChoice RLM-RACE Kit (Invitrogen), following the manufactures instructions. GFP reporter assay E. coli strains were grown overnight aerobically at 37C...”
BG05_RS11820 ABC transporter ATP-binding protein from Bacillus mycoides
47% identity, 90% coverage
Bphyt_4584 ABC transporter related from Burkholderia phytofirmans PsJN
47% identity, 86% coverage
HD73_4301 ABC transporter ATP-binding protein from Bacillus thuringiensis serovar kurstaki str. HD73
BC4016 Cyclodextrin transport ATP-binding protein from Bacillus cereus ATCC 14579
46% identity, 90% coverage
- Activation of the Extracytoplasmic Function σ Factor σP by β-Lactams in Bacillus thuringiensis Requires the Site-2 Protease RasP
Ho, mSphere 2019 - “...FIGS5 Amino acid alignment of RasP. An alignment of B. subtilis RasP and B. thuringiensis HD73_4301. The active site is marked by a red box. Download FIGS5, TIF file, 1.3 MB . Copyright 2019 Ho et al. 2019 Ho et al. This content is distributed under...”
- The Membrane Proteome of Spores and Vegetative Cells of the Food-Borne Pathogen Bacillus cereus
Gao, International journal of molecular sciences 2021 - “...(BC1955) subfamilies were detected in the cell membrane only, as was one other ABC transporter BC4016. Two other vegetative cell membrane-specific transporters were BC4016, a cyclodextrin transport ATP-binding protein. Only the ABC transporter BC1927, which is active in branched-chain amino acid transport and quorum sensing was...”
- Transcriptional responses of Bacillus cereus towards challenges with the polysaccharide chitosan
Mellegård, PloS one 2011 - “...10 5 cytochrome P450 p450 domain BC3720 5.8 10 6 DeoR family transcriptional regulator HTH BC4016 5.7 10 6 cyclodextrin transport ATP-binding protein AAA, transport-associated OB domain BC3718 5.1 10 5 PTS system, fructose-specific II ABC component phosphotransferase system domains BC0753 5.1 10 4 potassium-transporting ATPase...”
B9J850 pterin deaminase (EC 3.5.4.11) from Agrobacterium tumefaciens (see paper)
52% identity, 80% coverage
smoE / Q7CS28 ABC-type 3-(6-sulfo-α-D-quinovosyl)-sn-glycerol transporter ATP-binding subunit from Agrobacterium fabrum (strain C58 / ATCC 33970) (see paper)
Atu3281 ABC transporter, nucleotide binding/ATPase protein from Agrobacterium tumefaciens str. C58 (Cereon)
48% identity, 91% coverage
- Oxidative desulfurization pathway for complete catabolism of sulfoquinovose by bacteria
Sharma, Proceedings of the National Academy of Sciences of the United States of America 2022 - “...an ABC Transporter Solute-binding Protein that Binds SQGro. Within the gene cluster identified through proteomics, Atu3281 ( smoE ), Atu3283 ( smoG ), and Atu3284 ( smoH ) were annotated as an ABC transporter system, with Atu3282 ( smoF ) encoding an associated periplasmic solute-binding protein....”
RPYSC3_35230 ABC transporter ATP-binding protein from Rhodopseudomonas palustris
53% identity, 81% coverage
- Whole-genome sequencing and comparative analysis of two plant-associated strains of Rhodopseudomonas palustris (PS3 and YSC3)
Lo, Scientific reports 2018 - “...sugar ABC transport systems (RPPS3_01220, RPPS3_01230, RPPS3_033890, RPPS3_35020, RPPS3_35050, RPPS3_35450, RPPS3_43670, RPPS3_45360, RPYSC3_01220, RPYSC3_01230, RPYSC3_35200, RPYSC3_35230, RPYSC3_35650, RPYSC3_44090 and RPYSC3_45830) and TonB-dependent transporters in the R. palustris genomes (Supplementary Tables S5 and S6 ). TonB-dependent transporters have been considered to be involved in dietary polysaccharide processing...”
YPTB2521 putative ABC type sugar transporter, ATP-binding subunit from Yersinia pseudotuberculosis IP 32953
48% identity, 92% coverage
BTHUR0008_RS19140 ABC transporter ATP-binding protein from Bacillus thuringiensis serovar berliner ATCC 10792
47% identity, 90% coverage
SMc02474 PUTATIVE ATP-BINDING ABC TRANSPORTER PROTEIN from Sinorhizobium meliloti 1021
48% identity, 92% coverage
CPF_2654 putative maltose/maltodextrin ABC transporter, ATP-binding protein from Clostridium perfringens ATCC 13124
45% identity, 89% coverage
RPPS3_35050 ABC transporter ATP-binding protein from Rhodopseudomonas palustris
53% identity, 81% coverage
- Whole-genome sequencing and comparative analysis of two plant-associated strains of Rhodopseudomonas palustris (PS3 and YSC3)
Lo, Scientific reports 2018 - “...In addition, there are genes encoding multiple sugar ABC transport systems (RPPS3_01220, RPPS3_01230, RPPS3_033890, RPPS3_35020, RPPS3_35050, RPPS3_35450, RPPS3_43670, RPPS3_45360, RPYSC3_01220, RPYSC3_01230, RPYSC3_35200, RPYSC3_35230, RPYSC3_35650, RPYSC3_44090 and RPYSC3_45830) and TonB-dependent transporters in the R. palustris genomes (Supplementary Tables S5 and S6 ). TonB-dependent transporters have been considered...”
Ac3H11_2066 glucose ABC transporter, ATPase component from Acidovorax sp. GW101-3H11
48% identity, 91% coverage
- mutant phenotype: Specifically important for utilizing glucose. Also mildly important for mannose utilization and likely transports it as well.
TC 3.A.1.1.46 / P77481 Putative uncharacterized ABC transporter ATP-binding protein YcjV, component of Probable glucoside uptake porter, YcjNOPV from Escherichia coli (strain K12)
47% identity, 91% coverage
- substrates: Glucosides
tcdb comment: Encoded in an operon or gene cluster with a glucosyl hydrolase and two oxidoreductases (Moussatova et al. 2008)
TC 3.A.1.1.24 / TC 3.A.1.1.25 / Q72L52 Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) (see paper)
TTC0211 No description from Thermus thermophilus HB27
47% identity, 87% coverage
- substrates: Maltose, Mannose, Palatinose, Sucrose, Trehalose, glucose
tcdb comment: The structures have been solved to a resolution range of 1.6-2.0 Å (Chandravanshi et al. 2019). D - Mlc of Thermus thermophilus: a glucose-specific regulator for a glucose/mannose ABC transporter in the absence of the phosphotransferase system
Chevance, Journal of bacteriology 2006 - “...Promoter regions of mlc (TTC0329), malE1 (TTC1627), and malK1 (TTC0211) were amplified by hot start PCRs using genomic DNA of T. thermophilus and the respective...”
- The high-affinity maltose/trehalose ABC transporter in the extremely thermophilic bacterium Thermus thermophilus HB27 also recognizes sucrose and palatinose
Silva, Journal of bacteriology 2005 - “...-1286) and two monocistronic genes designated malK1 (TTC0211) and malK2 (TTC0611) are annotated as trehalose/ maltose and maltose/maltodextrin transport...”
- “...organisms (Fig. 3). In the genome of HB27, malK1 (TTC0211) and malK2 (TTC0611) are distant from the malEFG clusters. Upstream of the malE1 region we found...”
Z2463 putative ATP-binding component of a transport system from Escherichia coli O157:H7 EDL933
47% identity, 91% coverage
TTHA0579 sugar ABC transportor, ATP-binding protein from Thermus thermophilus HB8
47% identity, 87% coverage
8hplC / A0R2C0 Lpqy-sugabc in state 1 (see paper)
46% identity, 85% coverage
- Ligand: adenosine-5'-triphosphate (8hplC)
CPE2345 probable maltose ABC transportor from Clostridium perfringens str. 13
45% identity, 89% coverage
A0R2C0 ABC transporter, ATP-binding protein SugC from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
MSMEG_5058 ABC transporter, ATP-binding protein SugC from Mycobacterium smegmatis str. MC2 155
MSMEG_5058, MSMEI_4931 ABC transporter ATP-binding protein from Mycolicibacterium smegmatis MC2 155
46% identity, 80% coverage
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...MSMEI_2888 Protein-export membrane protein SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727, MSMEI_2660 Glutamate-binding protein 0.22 0.03 0.39 0.03 A0QXB0...”
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...protein SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727, MSMEI_2660 Glutamate-binding protein 0.22 0.03 0.39 0.03 A0QXB0 MSMEG_3235, MSMEI_3153 ABC-type...”
- Structural basis of trehalose recycling by the ABC transporter LpqY-SugABC
Liu, Science advances 2020 - “...strain mc 2 155 genomic DNA and overexpressed in M. smegmatis mc 2 155 . MSMEG_5058 , MSMEG_5059 , and MSMEG_5060 were amplified by polymerase chain reaction (PCR) and inserted into a pM261 vector, with a C-terminal 6 His-tag attached to SugC. The recombinant plasmid was...”
- “...trap ATP in the nucleotide-binding site, the catalytic glutamate in the consensus site [E164 in MSMEG_5058 (SugC)] was mutated to glutamine. A coexpression vector was constructed by amplification of MSMEG_5058 (E164Q), MSMEG_5059 , MSMEG_5060 , and MSMEG_5061 from M. smegmatis strain mc 2 155 genomic DNA...”
- Characterization of Conserved and Novel Septal Factors in Mycobacterium smegmatis
Wu, Journal of bacteriology 2018 - “...MSMEG_6105 MSMEG_4287 MSMEG_2410 MSMEG_3654 MSMEG_6051 MSMEG_5058 MSMEG_1642 MSMEG_2424 MSMEG_3027 MSMEG_5223 MSMEG_0690 MSMEG_3655 MSMEG_2089 MSMEG_0110...”
- A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
McKenzie, Journal of bacteriology 2012 - “...MSMEG_4662 MSMEG_4663 MSMEG_4664 MSMEG_4665 MSMEG_4666 MSMEG_5057 MSMEG_5058 MSMEG_5059 MSMEG_5060 MSMEG_5061 MSMEG_5062 iolB iolD iolE sugK sugG sugF sugE...”
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727, MSMEI_2660 Glutamate-binding protein 0.22 0.03 0.39 0.03 A0QXB0 MSMEG_3235, MSMEI_3153 ABC-type amino...”
RHE_RS24950 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
51% identity, 81% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS12565 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS24950 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS28400 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS24520...”
- “...MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC transporter, the ATP-binding protein UgpC in MM RHE_RS22750 and...”
TEMA_29560 ABC transporter ATP-binding protein from Terrisporobacter mayombei
45% identity, 89% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...Enterococcus ) TEMA_02390 TEPE_14200 TEGL_14000 Cell surface components Trehalose-recycling ABC transporter ( Mycobacterium ) sugC TEMA_29560 TEPE_00240 TEGL_00240 Copper uptake Copper exporter ( Mycobacterium ) ctpV TEMA_18330 - - Enzyme Streptococcal enolase ( Streptococcus ) eno TEMA_33900 TEPE_04590 TEGL_04390 Glycosylation system O-linked flagellar glycosylation ( Campylobacter...”
ML1089 probable ABC-transport protein, ATP-binding component from Mycobacterium leprae TN
45% identity, 84% coverage
- Mycobacterium leprae Transcriptome During In Vivo Growth and Ex Vivo Stationary Phases
Ojo, Frontiers in cellular and infection microbiology 2021 - “...( Figure3E ). Many of the sugar transporters like sugA (ML1087), sugB (ML1088) and sugC (ML1089) were down regulated in ML96 along with uspE (ML1769), uspC (ML1770) and mmpL10 (ML1231). ML0283, a possible cation-efflux transporter was significantly upregulated at 96 hr in axenic medium along with...”
RHE_RS22575 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
47% identity, 92% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS18950 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS22575 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS23370 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS26890...”
- “..., msiK ; multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate...”
HVO_A0281 ABC-type transport system ATP-binding protein (probable substrate sugar) from Haloferax volcanii DS2
45% identity, 91% coverage
BCAM2806 putative sugar ABC transporter ATP-binding protein from Burkholderia cenocepacia J2315
46% identity, 86% coverage
blr1895 ABC transporter ATP-binding protein from Bradyrhizobium japonicum USDA 110
52% identity, 82% coverage
MSIK_STRCO / Q9L0Q1 Diacetylchitobiose uptake system ATP-binding protein MsiK; EC 7.5.2.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
TC 3.A.1.1.33 / TC 3.A.1.1.36 / Q9L0Q1 ABC transporter ATP-binding protein, component of The N,N'-diacetylchitobiose uptake transporter, DasABC/MsiK (MsiK energizes several ABC transporters (see 3.A.1.1.23)) from Streptomyces coelicolor (see paper)
SCO4240 ABC transporter ATP-binding protein from Streptomyces coelicolor A3(2)
48% identity, 81% coverage
- function: Part of the ABC transporter complexes DasABC-MsiK and NgcEFG- MsiK involved in N,N'-diacetylchitobiose ((GlcNAc)2) uptake. Responsible for energy coupling to the transport system.
subunit: The DasABC-MsiK complex is composed of two ATP-binding proteins (MsiK), two transmembrane proteins (DasB and DasC) and a solute-binding protein (DasA) (Probable). The NgcEFG-MsiK complex is composed of two ATP-binding proteins (MsiK), two transmembrane proteins (NgcF and NgcG) and a solute-binding protein (NgcE) (Probable).
disruption phenotype: Disruption of the gene severely affects the ability of the mutant to utilize maltose, cellobiose, starch, cellulose, chitin and chitosan, but not glucose. The null mutant lacks (GlcNAc)2-uptake activity, but GlcNAc transport activity is unaffected. Mutant shows defects in induction of chitinase production. - substrates: N,N'-diacetylchitobiose
- Comparative genomics of transport proteins in developmental bacteria: Myxococcus xanthus and Streptomyces coelicolor
Getsin, BMC microbiology 2013 - “...putative low-affinity inorganic phosphate (P i ) uptake porters. DasABC: Sco5232-4 (R, M, M). MsiK: Sco4240 (C) [ 106 ] Q9K489-91,Q9L0Q1 3.A.1.1.33 DasABC/MsiK; system for the uptake of chitin-degradation products. Agl3EFG porter (R, M, M; Sco7167-Sco7165 [ 107 ]; Agl3K (C; unknown) Q9FBS7-5 3.A.1.1.43 Sugar uptake...”
- A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis
Titgemeyer, Journal of bacteriology 2007 - “...related to many ABC permease genes; msiK (SCO4240) SCO5848-SCO5851, SCO0538-SCO0541, msiK (SCO4240) Distant similarity to many ABC permease genes...”
YPTB0241 sn-glycerol-3-phosphate ABC type transport system, ATP-binding protein from Yersinia pseudotuberculosis IP 32953
48% identity, 94% coverage
RL4249 putative ATP-binding component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
51% identity, 80% coverage
RL1827 putative ATP-binding component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
51% identity, 80% coverage
HfgLR_22070 ABC transporter ATP-binding protein from Haloferax gibbonsii
46% identity, 91% coverage
WP_048053012 ABC transporter ATP-binding protein from Pyrococcus horikoshii
46% identity, 90% coverage
TC 3.A.1.1.23 / P96483 MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] from Streptomyces reticuli (see paper)
47% identity, 81% coverage
- substrates: Cellobiose, Celltriose
TC 3.A.1.1.10 / Q9KWT9 AlgS, component of Alginate (MW 27,000 Da) (and Alginate oligosaccharides) uptake porter. Sphingomonas species A1 is a 'pit-forming' bacterium that directly incorporates alginate into its cytoplasm through a pit-dependent transport system, termed a 'superchannel' (Murata et al., 2008). The pit is a novel organ acquired through the fluidity and reconstitution of cell surface molecules, and through cooperation with the transport machinery in the cells. It confers upon bacterial cells a more efficient way to secure and assimilate macromolecules from Sphingomonas sp (see paper)
algS / BAB03314.1 AlgS from Sphingomonas sp (see paper)
47% identity, 90% coverage
- substrates: Alginate
tcdb comment: The substrate-transport characteristics and quaternary structure of AlgM1M2SS with AlgQ1 have been determined (Maruyama et al. 2015). The addition of poly- or oligoalginate enhanced the ATPase activity of reconstituted AlgM1M2SS coupled with one of the periplasmic solute-binding proteins, AlgQ1 or AlgQ2. External fluorescence-labeled oligoalginates were specifically imported into AlgM1M2SS-containing proteoliposomes in the presence of AlgQ2, ATP, and Mg2+. The crystal structure of AlgQ2-bound AlgM1M2SS adopts an inward-facing conformation. The interaction between AlgQ2 and AlgM1M2SS induces the formation of an alginate-binding tunnel-like structure accessible to solvent. The translocation route inside the transmembrane domains contains charged residues suitable for the import of acidic saccharides (Maruyama et al. 2015)
MAP1766c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
49% identity, 94% coverage
lin0304 similar to sugar ABC transporter, ATP-binding protein from Listeria innocua Clip11262
60% identity, 67% coverage
lmo0278 similar to sugar ABC transporter, ATP-binding protein from Listeria monocytogenes EGD-e
Q8YA81 Lmo0278 protein from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
60% identity, 67% coverage
- Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
Pinilla, Data in brief 2022 - “...that synthesizes L-cysteine from L- serine Q8YAD8 lmo0193 lmo0193 Nis / LNis Hypothetical protein Q8YA81 lmo0278 lmo0278 Nis / LNis Sugar ABC transporter ATP-binding protein; belongs to the ABC transporter superfamily Q8Y843 lmo1075 tagH Nis / LNis Teichoic acid ABC transporter ATP-binding protein; part of the...”
- Proteomic Analysis of Listeria monocytogenes FBUNT During Biofilm Formation at 10°C in Response to Lactocin AL705
Melian, Frontiers in microbiology 2021 - “...PTS transporters, even with low abundance changes, inorganic ions (Lmo0818 and Lmo0641) and sugar ABC (Lmo0278) transport associated proteins, as well as a protein (Lmo0607) involved in defense mechanisms, were also up-regulated by L. monocytogenes FBUNT sessile cells compared with untreated biofilm. These results suggest that...”
- Virulence gene repression promotes Listeria monocytogenes systemic infection
Pombinho, Gut microbes 2020 (secret) - MouR controls the expression of the Listeria monocytogenes Agr system and mediates virulence
Pinheiro, Nucleic acids research 2018 - “...37C. When compared to the WT strain, six transcripts ( agrD, agrB, agrC, agrA, fruA, lmo0278 ) appeared less abundant in the lmo0651 mutant, while only one ( lhrA ) was more abundant (Figure 2A ), suggesting that Lmo0651 acts mainly as a transcriptional activator. Four...”
- “...recruitment ( 59 , 60 ). In addition to Agr system related genes, fruA and lmo0278 were also less expressed in absence of Lmo0651 (Figure 2A ). These genes are related to sugar uptake, fruA encodes one of the components of a fructose-specific phosphotransferase system and...”
- Protein level identification of the Listeria monocytogenes sigma H, sigma L, and sigma C regulons
Mujahid, BMC microbiology 2013 - “...protein lmo0181 Transport and binding proteins Unknown substrate Lmo0260 1.68 hydrolase lmo0260 Hypothetical proteins Conserved Lmo0278 1.67 maltose/maltodextrin transport system ATP-binding protein lmo0278 Transport and binding proteins Carbohydrates, organic alcohols, and acids Lmo0319 c,e 2.96 beta-glucosidase bglA Energy metabolism Sugars Lmo0343 3.94 transaldolase tal2 Energy metabolism...”
- Changes in gene expression during adaptation of Listeria monocytogenes to the soil environment
Piveteau, PloS one 2011 - “...extract. Several transporters including ABC transporters were over expressed including the gene cluster lmo2121-lmo2126 and lmo0278 whose function has been experimentally determined as uptake of maltose/maltodextrin [36] . Another interesting feature is the higher transcription of genes encoding enzymes involved in catabolism of specific substrates. -glucosidases...”
- Maltose and maltodextrin utilization by Listeria monocytogenes depend on an inducible ABC transporter which is repressed by glucose
Gopal, PloS one 2010 - “...MsmX has been identified as the cognate ATP-binding protein for the MdxF/MdxG permease [29] . Lmo0278 of L. monocytogenes showed 72 percent identity/83 percent similarity to MsmX and therefore most probably is its equivalent. All sequenced L. monocytogenes strains and Listeria species contain genes which are...”
- “...proteins which are virtually identical (90100 percent identical/95100 percent similar amino acids) to Lmo2121Lmo2128 and Lmo0278. For L. ivanovii the homology slightly drops to 7798 percent identity/8399 percent similarity. In the case of L. grayi the homology was found to be significantly lower in most cases,...”
- In vivo transcriptional profiling of Listeria monocytogenes and mutagenesis identify new virulence factors involved in infection
Camejo, PLoS pathogens 2009 - “...also increased in vivo ( Table S8 ). Significantly, mannose ( lmo0781lmo0784 ), maltose ( lmo0278 ) and cellobiose ( lmo0301 and lmo0915 ) -specific PTS encoding genes [63] were up regulated in vivo . Inversely, fructose ( lmo2733 ), galactitol ( lmo2665 ) and mannitol...”
- More
- Proteomic dataset of Listeria monocytogenes exposed to sublethal concentrations of free and nanoencapsulated nisin
Pinilla, Data in brief 2022 - “...subpathway that synthesizes L-cysteine from L- serine Q8YAD8 lmo0193 lmo0193 Nis / LNis Hypothetical protein Q8YA81 lmo0278 lmo0278 Nis / LNis Sugar ABC transporter ATP-binding protein; belongs to the ABC transporter superfamily Q8Y843 lmo1075 tagH Nis / LNis Teichoic acid ABC transporter ATP-binding protein; part of...”
YPO3793 sn-glycerol-3-phosphate transport, ATP-binding protein from Yersinia pestis CO92
48% identity, 94% coverage
cg0835 ABC-type sugar transport systems, ATPase component from Corynebacterium glutamicum ATCC 13032
52% identity, 87% coverage
pRL100443 putative ATP-binding component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
47% identity, 92% coverage
DJ458_RS02915 ABC transporter ATP-binding protein from Staphylococcus pseudintermedius
47% identity, 88% coverage
- Staphylococcal Protein A (spa) Locus Is a Hot Spot for Recombination and Horizontal Gene Transfer in Staphylococcus pseudintermedius
Zukancic, mSphere 2020 - “...RM genes. Additionally, sublineage 2 harbored a putative ugp operon consisting of six genes (locus_tags DJ458_RS02915 - DJ458_ RS02940 ) associated with sn -glycerol-3-phosphate and sugar transport ( Fig.4 ). The operon was integrated at a locus encoding a putative abi family protein in other S....”
- “...Similarly, they have lost the abi gene and have acquired a putative ugp operon (locus_tag DJ458_RS02915 - DJ458_RS02940 ) at that locus. All isolates in sublineage 2 carry agrD type II, and five of them also harbor the SpST71A prophage ( 17 ). Similar to ST71,...”
Atu3021 ABC transporter, nucleotide binding/ATPase protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
46% identity, 88% coverage
TC 3.A.1.1.34 / O32151 Uncharacterized ABC transporter ATP-binding protein YurJ, component of The arabinosaccharide transporter AraNPQMsmX. Transports α-1,5-arabinooligosaccharides, at least up to four L-arabinosyl units; the key transporter for α-1,5-arabinotriose and α-1,5-arabinotetraose, but not for α-1,5-arabinobiose which is transported by AraE. MsmX is also used by the MdxEFG-MsmX system (3.A.1.1.36) (Ferreira and Sá-Nogueira, 2010). Involved in the uptake of pectin oligosaccharides with either MsmX or YurJ as the ATPase from Bacillus subtilis (strain 168)
BSU32550 putative multiple sugar ABC transporter (ATP-binding protein) from Bacillus subtilis subsp. subtilis str. 168
45% identity, 90% coverage
- substrates: Arabinosides
- A model industrial workhorse: Bacillus subtilis strain 168 and its genome after a quarter of a century
Bremer, Microbial biotechnology 2023 - “...ATPase subunit of export apparatus BSU16250 fliJ cheF flagellar synthesis rod subunit of export ATPase BSU32550 frlP yurJ fructoseamino acid ABC transporter (ATPbinding subunit) BSU31100 ktrB yubG potassium transporter ATPase BSU14510 ktrC ylxV, yzaC, ykqB potassium uptake protein; regulator of potassium conductance; ATPdependent gating channel BSU13500...”
- Bioinformatic, genetic, and biochemical evidence that some glycoside hydrolase family 42 beta-galactosidases are arabinogalactan type I oligomer hydrolases
Shipkowski, Applied and environmental microbiology 2006 - “...is also implied by our work. The MalK homolog YurJ (BSU32550) (as predicted by Quentin et al. [49]) or MsmX (BSU38810) may fulfill this role, much like MsmX of...”
- The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
Ferreira, PloS one 2017 - “...E . coli maltose transporter are underlined in green . Accession numbers: MsmX (P94360), YurJ (O32151), and MalK (P68187). (TIF) Click here for additional data file. S3 Fig Sequence alignment of three ABC-type ATPases. The alignment between B . subtilis MsmX and OpuAA, and E ....”
ABD05_RS21580 ABC transporter ATP-binding protein from Burkholderia pyrrocinia
46% identity, 86% coverage
SM_b21106 ABC transporter for L-Fucose, ATPase component from Sinorhizobium meliloti 1021
47% identity, 89% coverage
- mutant phenotype: Specific phenotype on L-Fucose.
Clocel_3857 ABC transporter ATP-binding protein from Clostridium cellulovorans 743B
45% identity, 89% coverage
- Clostridium cellulovorans Proteomic Responses to Butanol Stress
Costa, Frontiers in microbiology 2021 - “...of them (14, namely Clocel_0638, Clocel_0903, Clocel_1272, Clocel_1328, Clocel_1355, Clocel_1356, Clocel_1854, Clocel_2887, Clocel_2598, Clocel_3460, Clocel_3854, Clocel_3857, Clocel_4100, Clocel_4152) were up-regulated in butanol-challenged C. cellulovorans . Currently, the protein product of Clocel_0638 does not have any associated function, however, it shows a very high sequence identity (7375%)...”
- Elucidation of the recognition mechanisms for hemicellulose and pectin in Clostridium cellulovorans using intracellular quantitative proteome analysis
Aburaya, AMB Express 2015 - “...hydrolase family 2 Beta-mannosidase 2.55 1.51E03 Clocel_3657 Xylan 1,4-beta-xylosidase Xylan 1,4-beta-xylosidase/alpha- N -arabinofuranosidase 1.79 4.26E02 Clocel_3857 ABC transporter Multiple sugar transport system ATP-binding protein 2.15 1.03E03 Clocel_4053 LPXTG-motif cell wall anchor domain-containing protein Sialate O -acetylesterase 2.28 3.79E02 Clocel_4087 Aldose 1-epimerase Aldose 1-epimerase 1.45 2.68E02 Clocel_4088...”
RHE_RS18950 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
50% identity, 80% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...MM RHE_RS02065 mcp; methyl-accepting chemotaxis protein K03406 Bacteroid RHE_RS27360 mcp; methyl-accepting chemotaxis protein K10112 MM RHE_RS18950 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS22575 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS23370...”
- “...ggtA , msiK ; multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein,...”
Q70HW1 ABC-type maltose transporter (EC 7.5.2.1) from Alicyclobacillus acidocaldarius (see paper)
malK / CAE45698.1 ATP-binding MalK protein from Alicyclobacillus acidocaldarius subsp. acidocaldarius (see paper)
45% identity, 86% coverage
RUMGNA_03040 hypothetical protein from Ruminococcus gnavus ATCC 29149
44% identity, 89% coverage
Athe_1803 ABC transporter ATP-binding protein from Caldicellulosiruptor bescii DSM 6725
46% identity, 89% coverage
- Transcriptional Regulation of Plant Biomass Degradation and Carbohydrate Utilization Genes in the Extreme Thermophile Caldicellulosiruptor bescii
Rodionov, mSystems 2021 - “...dedicated ATP-binding ATPase component and presumably use a shared ATPase encoded by the msmK gene (Athe_1803). To test this hypothesis, we constructed the msmK deletion mutant strain of C. bescii (see Fig.S2 ) and characterized its growth on mono- and polysaccharides. 10.1128/mSystems.01345-20.6 FIGS2 Verification of msmK...”
- “...utilized for homologous recombination during strain construction are shown in purple. Surrounding genes in the athe_1803 locus are shown in blue. The deletion target, msmK (Athe_1803), is shown in green. Primers are indicated with black arrows. Download FIGS2, PDF file, 0.2 MB . Copyright 2021 Rodionov...”
BCG_2057c putative sugar-transport ATP-binding protein ABC transporter from Mycobacterium bovis BCG str. Pasteur 1173P2
Rv2038c Probable sugar-transport ATP-binding protein ABC transporter from Mycobacterium tuberculosis H37Rv
MT49_RS10690 ABC transporter ATP-binding protein from Mycobacterium tuberculosis 49-02
48% identity, 93% coverage
- Transposon libraries identify novel Mycobacterium bovis BCG genes involved in the dynamic interactions required for BCG to persist during in vivo passage in cattle
Mendum, BMC genomics 2019 - “...BCGs two ABC sugar transport systems, the trehalose recycling system sugABC , lpqY , and BCG_2057c to BCG_2060c ( Rv2038c to Rv2041c ) were attenuating in vivo in both BCG Danish and in BCG Pasteur (Fig. 2 ). Insertions in the four genes that precede sugABC...”
- “...role in trehalose recycling. Very little is known about BCGs other ABC sugar transport system, BCG_2057c to BCG_2060c, with no previous reports of a virulence phenotype. The ability to degrade cholesterol is a well-known virulence determinant for M. tuberculosis [ 58 60 ]. Sterol catabolism is...”
- Comparison of carbohydrate ABC importers from Mycobacterium tuberculosis
De, BMC genomics 2021 - “...encode the SBPs, SugAB, Rv2039c-40c, UspAB and UgpAE encode the heterodimeric TMDs, and sugC , rv2038c and ugpC encode the NBDs. Genetic and cellular approaches applied to the study of LpqY/SugABC transporter demonstrated that it was essential for virulence of M. tuberculosis in vivo and potentially...”
- “...that they segregate into three main groups (Groups 1 to 3) each one containing SugC, Rv2038c and UgpC orthologs, respectively (Fig. 2 A). Orthologs that were grouped with UgpC (Group 2) belong to the MTBC group and M. marinum , and they were closely related to...”
- Efflux pump gene expression study using RNA-seq in multidrug-resistant TB
Lee, The international journal of tuberculosis and lung disease : the official journal of the International Union against Tuberculosis and Lung Disease 2021 (PubMed)- “...46 had significant fold changes, and 12 genes (Rv0842, Rv1146, Rv1258c, Rv1473, Rv1686c, Rv1687c, Rv1877, Rv2038c, Rv3065, Rv3197a, Rv3728 and Rv3789) that were overexpressed following exposure to KM were thought to contribute to drug resistance. Rv3197A (whiB7) showed a distinct fold change based on the concentration...”
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...C2 or C3 position [ 36 ] Rv2038c-Rv2041c SBP: Rv2041c TMD: Rv2039c and Rv2040c NBD: Rv2038c (two copies) Rv2041c treatment with macrophages and lymphocytes shows elevated expression of pro-inflammatory cytokines and raised up secretion of IFN- and TNF-, respectively [ 52 ] Rv2041c gives positive antibody...”
- Insertion and deletion evolution reflects antibiotics selection pressure in a Mycobacterium tuberculosis outbreak
Godfroid, PLoS pathogens 2020 - “...neighboring genes. The left breakpoint is located at position 529 in the gene ugpC (MT49_RS10690, Rv2038c). The right breakpoint is located at position 453 in a gene encoding for a carboxylesterase/lipase family protein (MT49_RS10725, Rv2045c). Four of the deleted neighboring genes encode for ABC transporters (...”
- Drivers and sites of diversity in the DNA adenine methylomes of 93 Mycobacterium tuberculosis complex clinical isolates
Modlin, eLife 2020 - “...9/21 Rv1776c Probable transposase lpqG upstream 93 14/54 2.85E-10 8/54 Rv1219c Probable conserved lipoprotein LpqG Rv2038c sense 183 14/69 9.05E-09 9/69 Rv2989 Probable sugar-transport ATP-binding protein ABC transporter PPE24* sense 1584 5/5 1.95E-08 5/5 Rv0818 PPE family protein PPE24 MamA mmpL4* sense 1719 51/51 2.18E-126 49/51...”
- Whole genome sequencing, analyses of drug resistance-conferring mutations, and correlation with transmission of Mycobacterium tuberculosis carrying katG-S315T in Hanoi, Vietnam
Hang, Scientific reports 2019 - “...Rv1739c, Rv1749c, Rv1815, Rv1825, Rv1828, Rv1831, Rv1835c, Rv1879, Rv1895, Rv1941, Rv1999c, Rv2017, Rv2023A, Rv2024c, Rv2025c, Rv2038c, Rv2074, Rv2134c, Rv2143, Rv2164c, Rv2177c, Rv2190c, Rv2219A, Rv2228c, Rv2254c, Rv2256a, Rv2286c, Rv2314c, Rv2319c, Rv2327, Rv2424c, Rv2456c, Rv2532c, Rv2556c, Rv2567, Rv2621c, Rv2630, Rv2638, Rv2656c, Rv2668, Rv2669, Rv2729c, Rv2733c, Rv2792c, Rv2798c, Rv2851c,...”
- Transposon libraries identify novel Mycobacterium bovis BCG genes involved in the dynamic interactions required for BCG to persist during in vivo passage in cattle
Mendum, BMC genomics 2019 - “...transport systems, the trehalose recycling system sugABC , lpqY , and BCG_2057c to BCG_2060c ( Rv2038c to Rv2041c ) were attenuating in vivo in both BCG Danish and in BCG Pasteur (Fig. 2 ). Insertions in the four genes that precede sugABC , BCG_1291c to BCG_1294...”
- The response of mycobacterium tuberculosis to reactive oxygen and nitrogen species
Voskuil, Frontiers in microbiology 2011 - “...( cyp138 , rv0330c , rv0967 , sigE , rv1684 , rv2033c , rv2036 , rv2038c , rv2125 , rv2620c , rv2621c , and lpqA ) were selectively induced by NO but not H 2 O 2 . Thus, other than the DosR regulon, 121 of...”
- More
- Insertion and deletion evolution reflects antibiotics selection pressure in a Mycobacterium tuberculosis outbreak
Godfroid, PLoS pathogens 2020 - “...its neighboring genes. The left breakpoint is located at position 529 in the gene ugpC (MT49_RS10690, Rv2038c). The right breakpoint is located at position 453 in a gene encoding for a carboxylesterase/lipase family protein (MT49_RS10725, Rv2045c). Four of the deleted neighboring genes encode for ABC transporters...”
pNG7342 multiple sugar ABC transporter ATP-binding protein from Haloarcula marismortui ATCC 43049
46% identity, 89% coverage
- Genome information management and integrated data analysis with HaloLex
Pfeiffer, Archives of microbiology 2008 - “...pNG7321 381 408 Shortened HQ1769A, pNG7235, OE3930R, NP0566A pNG7327 1,512 1,572 Shortened HQ1784A, NP0802A, OE1568F pNG7342 1,098 1,128 Shortened pNG7026, OE5170F pNG7351 1,065 1,089 Shortened rrnAC0191, NP1260A, OE4674F, HQ3648A pNG7377 432 324 Extended HQ3372A pNG7380 1,746 1,932 Shortened HQ1768A Using our semiautomatic checking procedure, candidate genes...”
F9USZ2 Maltodextrin ABC transporter, ATP-binding protein from Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
lp_0180 multiple sugar ABC transporter, ATP-binding protein from Lactobacillus plantarum WCFS1
lp_0180 ABC transporter ATP-binding protein from Lactiplantibacillus plantarum WCFS1
44% identity, 89% coverage
- Identification of key proteins and pathways in cadmium tolerance of Lactobacillus plantarum strains by proteomic analysis.
Zhai, Scientific reports 2017 - “...D-alaninepoly(phosphoribitol) ligase subunit 2-1 1.65 Transporter F9USY7 mdxE; maltodextrin ABC transporter, substrate binding protein 1.91 F9USZ2 msmX; maltodextrin ABC transporter, ATP-binding protein 2.23 F9USG5 lp_3042; Multidrug ABC transporter, ATP-binding and permease protein 1.97 F9UM05 lp_0783; Oligopeptide ABC transporter, substrate binding protein 2.77 F9UR50 lp_2525; ABC transporter,...”
- Involvement of the mannose phosphotransferase system of Lactobacillus plantarum WCFS1 in peroxide stress tolerance
Stevens, Applied and environmental microbiology 2010 - “...0.78 1.43E-02 2.01 Transport and binding proteins lp_0180 lp_0265 lp_0315 msmK1 pts5ABC potD Multiple sugar ABC transporter, ATP-binding protein PTS system,...”
- Two homologous Agr-like quorum-sensing systems cooperatively control adherence, cell morphology, and cell viability properties in Lactobacillus plantarum WCFS1
Fujii, Journal of bacteriology 2008 - “...California, Berkeley Upregulated genes lp_0152 lp_0177 lp_0179 lp_0180 lp_0302 lp_0547 lp_0578 lp_1197 lp_1198 lp_1200 lp_1201 lp_1203 lp_1730 lp_2151 lp_2352...”
- Systematic elucidation of independently modulated genes in Lactiplantibacillus plantarum reveals a trade-off between secondary and primary metabolism
Qiu, Microbial biotechnology 2024 - “...MdxR regulons, MalR+MdxR IM also captures the combinatorial regulatory signals for malS (lp_0179) and msmX (lp_0180), which share the same promoter with genes in the overlap of MalR and MdxR regulons. All genes in MalR+MdxR IM are involved in maltose/maltodextrin metabolism, which is the biological process...”
- “...been reported by known regulons of L. plantarum , for example, malS (lp_0179) and msmX (lp_0180) captured by MalR+MdxR IM (Section Comparison between iModulons and Regulons ), which contributed to the reconstruction of a more complete TRN. Furthermore, the Activity matrix (A matrix) output by ICA...”
Cphy_3611 ABC transporter related from Clostridium phytofermentans ISDg
45% identity, 89% coverage
- Genome and Transcriptome of Clostridium phytofermentans, Catalyst for the Direct Conversion of Plant Feedstocks to Fuels
Petit, PloS one 2015 - “...operons lack an ATPase, suggesting that these transporter complexes may interact with a multitasking ATPase. Cphy_3611 is similar to MsmX of Bacillus subtilis , which is proposed to be an ATPase for several oligosaccharide transporters [ 60 ]. These findings suggest that C . phytofermentans is...”
- “...and D in S4 File and S5 File). The putative multitasking ABC transporter ATPase subunit Cphy_3611, was expressed during growth on all substrates (transcript abundance within the 50 th percentile) ( S5 File ). To orchestrate the regulation of these genes, a number of transcriptional regulators,...”
EP10_002195 ABC transporter ATP-binding protein from Geobacillus icigianus
46% identity, 88% coverage
- The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
Peltek, International journal of molecular sciences 2024 - “...the genes responsible for xylose metabolism (EP10_002609), lactic acid synthesis (EP10_003019), and transport of oligosaccharides (EP10_002195) and cyclodextrins (EP10_002265) may be a cell response to THz irradiation in conjunction with the general inhibition of metabolism that is observed during this period at the proteomic level [...”
- “...step 9/9 EP10_001940 0.923879 0.063759 Imidazole glycerol phosphate synthase subunit HisH, step 5/9, histidine biosynthesis EP10_002195 1.213861 0.014874 Oligosaccharide import ATP-binding protein MsmX EP10_002265 1.492904 0.046696 Cyclodextrin-binding protein EP10_002551 3.56812 2.92 10 16 PTS system fructose-specific EIIABC component, EC 2.7.1.69 EP10_002552 3.419195 4.25 10 12 Phosphofructokinase-1,...”
RLO149_c021710 ABC transporter ATP-binding protein from Roseobacter litoralis Och 149
47% identity, 89% coverage
TP0804 sugar ABC transporter, ATP-binding protein (ugpC) from Treponema pallidum subsp. pallidum str. Nichols
O83782 Sugar ABC transporter, ATP-binding protein (UgpC) from Treponema pallidum (strain Nichols)
46% identity, 85% coverage
- Clonal isolates of Treponema pallidum subsp. pallidum Nichols provide evidence for the occurrence of microevolution during experimental rabbit infection and in vitro culture
Edmondson, PloS one 2023 - “...effect on glycolytic pathway 874548 SNV A CL1: G G A GG G G E160G TP0804 sn-glycerol-3-phosphate ABC transporter UgpC Potential effect on glycerol-3-phosphate transport 884280 SNV C CL3: T CT -- TP0814 Thioredoxin-disulfide reductase TxrB (promoter region) Potential effect on transcription of txrB gene 974054...”
- “..., with serine being the catalytic residue). The same clone had a E160G substitution in TP0804 , encoding UgpC, annotated as a glycerol-6-phosphate ABC transporter ATP-binding protein; the mutation is in a well-conserved region in which most bacteria have an aspartate at that position. Finally, TP0972...”
- Laboratory Diagnostic Tools for Syphilis: Current Status and Future Prospects
Luo, Frontiers in cellular and infection microbiology 2020 - “...Tp0486 Borrelia-like antigen P83/100 Primary and secondary syphilis Tp0742 GTPase Obg Primary and secondary syphilis Tp0804 ABC protein Latent stage Tp0369 Unknown protein Primary and secondary syphilis Discussion Rapid and accurate detection of syphilis is vital to ensure timely treatment and to control the transmission of...”
- Candidate Treponema pallidum biomarkers uncovered in urine from individuals with syphilis using mass spectrometry
Osbak, Future microbiology 2018 - “...a protein Sugar ABC superfamily ATP binding cassette transporter (Tp0804) in a latent stage pooled sample and 11 peptides (4 of which were high confidence)...”
- “...Uncharacterized protein R9UUC1 Tp0369 ND ABC sugar protein O83782 Tp0804 ND NA NA NA NA NA ND ND ND LSDAGAGALRSPVWR GTPase Obg R9UVA5 Tp0486 ND TLADALPR...”
- Treponema pallidum, the syphilis spirochete: making a living as a stealth pathogen
Radolf, Nature reviews. Microbiology 2016 - “...permease (TP0075TP0076), which uses two different SBPs (TP0074 and TP0737) and a nucleotide ATP-binding subunit, TP0804, an ortholog of E. coli MalK 18 . The functionality of this putative multiple sugar transporter is supported by the observation that, in addition to glucose, maltose and mannose can...”
- Transcriptome of Treponema pallidum: gene expression profile during experimental rabbit infection
Smajs, Journal of bacteriology 2005 - “...0.27 0.27 0.27 0.27 0.27 0.27 0.26 0.26 TP0106 TP0804 TP0340 TP0288 TP0337 TP0028 TP0514 TP0689 TP0147 TP0336 TP0671 TP0566 TP0516 TP0688 TP0715 TP0714 TP0520...”
- Identification of a Potential Vaccine against Treponema pallidum Using Subtractive Proteomics and Reverse-Vaccinology Approaches
Khan, Vaccines 2022 - “...protein (UniProt ID: O83930), and Sugar ABC superfamily ATP-binding cassette transporter, ABC protein (UniProt ID: O83782). We found that the multiepitope subunit vaccine consisting of 4 CTL, 4 HTL, and 11 B-cell epitopes mixed with the adjuvant TLR-2 agonist ESAT6 has potent antigenic characteristics and does...”
- “...protein (UniProt ID: O83930) and Sugar ABC superfamily ATP-binding cassette transporter, ABC protein (UniProt ID: O83782) proteins as virulent with >25% identity and 100% bit-score, and selected for future investigation [ 42 ]. 3.9. Vaccine Protein Prioritization The virulent proteins were subjected to the Vaxijen server...”
- Candidate Treponema pallidum biomarkers uncovered in urine from individuals with syphilis using mass spectrometry
Osbak, Future microbiology 2018 - “...ND ND Uncharacterized protein R9UUC1 Tp0369 ND ABC sugar protein O83782 Tp0804 ND NA NA NA NA NA ND ND ND LSDAGAGALRSPVWR GTPase Obg R9UVA5 Tp0486 ND TLADALPR...”
COB47_1616 ABC transporter ATP-binding protein from Caldicellulosiruptor obsidiansis OB47
46% identity, 89% coverage
MSMX_BACSU / P94360 Oligosaccharides import ATP-binding protein MsmX; Maltodextrin import ATP-binding protein MsmX; Melibiose/raffinose/stachyose import ATP-binding protein MsmX; EC 7.5.2.- from Bacillus subtilis (strain 168) (see 5 papers)
TC 3.A.1.1.26 / TC 3.A.1.1.34 / P94360 MsmX, component of The maltose porter, MdxEFG and MsmX from Bacillus subtilis (see 3 papers)
NP_391760 multiple sugar (maltodextrins) transporter ATP-binding protein from Bacillus subtilis subsp. subtilis str. 168
BSU38810 multiple sugar-binding transporter ATP-binding protein from Bacillus subtilis subsp. subtilis str. 168
45% identity, 90% coverage
- function: Required to energize different ABC-type saccharide transporters (PubMed:20693325, PubMed:29240795). Part of the MdxEFG- MsmX ABC transporter complex involved in maltodextrin import, of the AraNPQ-MsmX complex involved in arabinooligosaccharides import, of the GanPQS-MsmX complex involved in galactooligosaccharides import, and of the MelEDC-MsmX complex involved in melibiose, raffinose and stachyose import (PubMed:16707683, PubMed:20693325, PubMed:27501980, PubMed:29240795, PubMed:31138628). Is probably also part of the ABC transporter complex YtcQP-YteP-MsmX involved in polygalacturonan and rhamnogalacturonan type I import during pectin degradation (PubMed:29240795). Responsible for energy coupling to the transport system (Probable).
subunit: The complex involved in maltodextrin import is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (MdxF and MdxG) and a solute-binding protein (MdxE) (PubMed:16707683). The complex involved in arabinooligosaccharides uptake is composed of two ATP- binding proteins (MsmX), two transmembrane proteins (AraP and AraQ) and a solute-binding protein (AraN) (PubMed:20693325). The complex involved in galactooligosaccharides uptake is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (GanP and GanQ) and a solute-binding protein (GanS) (PubMed:27501980, PubMed:29240795). The complex involved in melibiose, raffinose and stachyose import is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (MelC and MelD) and a solute-binding protein (MelE) (PubMed:31138628). The complex involved in polygalacturonan and rhamnogalacturonan type I uptake is probably composed of two ATP-binding proteins (MsmX), two transmembrane proteins (YtcP and YteP) and a solute-binding protein (YtcQ) (PubMed:29240795).
disruption phenotype: Deletion of the gene abolishes induction of the melREDCA operon the presence of melibiose and raffinose (PubMed:31138628). It does not affect growth in the presence of glucose and arabinose, but it has a negative effect on the ability of the mutant to grow on the alpha-1,5-arabinose oligomers alpha-1,5- arabinobiose, alpha-1,5-arabinotriose and alpha-1,5-arabinotetraose (PubMed:20693325). Deletion mutant cannot utilize pectin and galactan, and shows a slower but steady growth rate in the presence of type I rhamnogalacturonan or polygalacturonan (PubMed:29240795). - substrates: Arabinosides, Maltose
- Membrane Proteomes and Ion Transporters in Bacillus anthracis and Bacillus subtilis Dormant and Germinating Spores
Chen, Journal of bacteriology 2019 - “...P37810 O32218 P42182 P37580 P37476 P16450 O32167 Q01625 P94360 P24141 P24138 P24139 P24136 P24137 P38050 Q45064 P39793 P24327 P20166 P46911 P46912 P34957 P36947...”
- The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
Ferreira, PloS one 2017 - “...and/or rhamnose-galacturonic acid disaccharides. A representation of the predicted structure for an MsmX (Accession number: P94360) monomer, obtained using I-TASSER ( http://zhanglab.ccmb.med.umich.edu/I-TASSER/ ; version 3.0), is shown. To apprehend the reason why carbohydrate ABC-type I importers share a common ATPase, in contrast to the majority of...”
- “...of the E . coli maltose transporter are underlined in green . Accession numbers: MsmX (P94360), YurJ (O32151), and MalK (P68187). (TIF) Click here for additional data file. S3 Fig Sequence alignment of three ABC-type ATPases. The alignment between B . subtilis MsmX and OpuAA, and...”
- Multitask ATPases (NBDs) of bacterial ABC importers type I and their interspecies exchangeability.
Leisico, Scientific reports 2020 - GeneRIF: Multitask ATPases (NBDs) of bacterial ABC importers type I and their interspecies exchangeability.
- A model industrial workhorse: Bacillus subtilis strain 168 and its genome after a quarter of a century
Bremer, Microbial biotechnology 2023 - “...BSU13500 ktrD ykrM K+transporting ATPase (glumamate controlled) BSU30760 mntB ytgB manganese ABC transporter (ATPbinding protein) BSU38810 msmX yxkG multiple sugar (maltodextrins, galactans) transporter ATPbinding protein BSU33730 opuBA proV choline ABC transporter (ATPbinding protein) BSU33830 opuCA yvbE glycine betaine/carnitine/choline/choline ABC transporter (ATPbinding protein) BSU35700 tagH _ ATPbinding...”
- Bioinformatic, genetic, and biochemical evidence that some glycoside hydrolase family 42 beta-galactosidases are arabinogalactan type I oligomer hydrolases
Shipkowski, Applied and environmental microbiology 2006 - “...(as predicted by Quentin et al. [49]) or MsmX (BSU38810) may fulfill this role, much like MsmX of Streptococcus mutans (50) contributes to the transport of...”
TEGL_00240 ABC transporter ATP-binding protein from Terrisporobacter glycolicus ATCC 14880 = DSM 1288
44% identity, 89% coverage
- Genome-based metabolic and phylogenomic analysis of three Terrisporobacter species
Böer, PloS one 2023 - “...TEMA_02390 TEPE_14200 TEGL_14000 Cell surface components Trehalose-recycling ABC transporter ( Mycobacterium ) sugC TEMA_29560 TEPE_00240 TEGL_00240 Copper uptake Copper exporter ( Mycobacterium ) ctpV TEMA_18330 - - Enzyme Streptococcal enolase ( Streptococcus ) eno TEMA_33900 TEPE_04590 TEGL_04390 Glycosylation system O-linked flagellar glycosylation ( Campylobacter ) pseB...”
SMc04393 PUTATIVE ATP-BINDING ABC TRANSPORTER PROTEIN from Sinorhizobium meliloti 1021
47% identity, 86% coverage
- Mapping the Sinorhizobium meliloti 1021 solute-binding protein-dependent transportome
Mauchline, Proceedings of the National Academy of Sciences of the United States of America 2006 - “...been due to a lack of sensitivity. ABC-T SMc04393 was induced nearly 10-fold by dextrin, a polyD-glucoside of indeterminate length formed during the hydrolytic...”
- “...CymDEFG (21) shows limited identity (26-45%) with ABC-T SMc04393. A single system was induced by -glucosides. An integratedfusion to ABC-T SMc04259 is induced...”
TC 3.A.1.1.16 / Q8TZQ3 MalK aka PF1933, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) from Pyrococcus furiosus
PF1933 putative sugar transport ATP-hydrolyzing from Pyrococcus furiosus DSM 3638
45% identity, 89% coverage
- substrates: Maltooligosaccharides
- Genome-wide binding analysis of the transcriptional regulator TrmBL1 in Pyrococcus furiosus
Reichelt, BMC genomics 2016 - “...- downstream singleton PF1874 glyceraldehyde-3-phosphate dehydrogenase - upstream singleton PF1920 triosephosphate isomerase - downstream operon PF1933 PF1934 PF1935 PF1936 PF1937 PF1938 putative sugar transport ATP-hydrolyzing hypothetical protein amylopullulanase malG-like sugar transport inner membrane protein malF-like sugar transport inner membrane protein malE-like sugar binding protein MD system...”
- Experimental and computational analysis of the secretome of the hyperthermophilic archaeon Pyrococcus furiosus
Schmid, Extremophiles : life under extreme conditions 2013 - “...4 11 No PF1961 18894163 Tungsten-containing formaldehyde ferredoxin oxidoreductase wor4 69 5 8 No Transport PF1933 18894131 Putative sugar transport ATP-hydrolyzing 41 5 13 No PF1936 18894134 Putative sugar transport inner membrane protein (malg-like) 45 4 12 6 Translation and transcription PF1375 18893486 Translation elongation factor...”
- Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
Noll, BMC evolutionary biology 2008 - “...the single operons of the former organisms. The mdx operon in P. furiosus (PF1938-1936 and PF1933) encodes a maltodextrin binding protein (MdxE Pf , PF1938) and is upregulated in response to growth on maltose and starch [ 10 , 11 ]. In P. furiosus , the...”
- “...of P. furiosus MalK homologs (ATP binding proteins) . Homologs of the P. furiosus MdxK (PF1933) were gathered using that sequence as query in BLASTP. A ML tree using an alignment of these sequences is shown here. Only bootstrap support values over 800 are shown. For...”
- Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
Chou, Applied and environmental microbiology 2007 - “...tested. It was interesting that the Mal II operon (PF1933 to PF1939) did not respond to glucoside linkage when S0 was present. A similar trend was observed...”
- “...transport, permease Putative sulfate transport, permease Mal II operon PF1933 PF1934 PF1935 PF1936 PF1937 PF1938 PF1939 3.9 8.3 8.4 8.1 NC 9.1 NC NC NC NC NC...”
- Disruption of a sugar transporter gene cluster in a hyperthermophilic archaeon using a host-marker system based on antibiotic resistance
Matsumi, Journal of bacteriology 2007 - “...in Pyrococcus furiosus (Mal-I, PF1739 to PF1744, and Mal-II, PF1933 to PF1938) (33), only one putative gene cluster is found on the T. kodakaraensis genome...”
- Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
Lee, Journal of bacteriology 2006 - “...(Mal-I) PF1740 PF1741 PF1742 PF1743 PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose transport (Mal-I) Maltose/trehalose transport (Mal-I)...”
- “...longer maltooligosaccharides (29). The second transporter (Mal-II; PF1933, PF1936 to PF1938) is specific for maltooligosaccharides, but it does not transport...”
- Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
Schut, Journal of bacteriology 2003 - “...transporter (Mal II) cluster in P. furiosus (PF1938 to PF1933) is also up-regulated in maltose-grown cells and is organized in a fashion similar to that of Mal...”
- Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus
Koning, Archaea (Vancouver, B.C.) 2002 - “...genes encoding the binding protein and two permeases (PF1933, PF1936-PF1938). Instead, two open reading frames (ORFs) separate the second permease and the...”
- “...clusters. Pyrococcus furiosus Escherichia coli MalE PF1938 PF1937 PF1936 PF1933 PF1739 PF1740 PF1741 PF1744 1 2 Identity. Similarity. 1 MalF MalG MalK 2 28 (46)...”
CDR20291_3239 ABC transporter ATP-binding protein from Clostridioides difficile R20291
CDR20291_3239 ABC transporter, ATP-binding protein from Clostridium difficile R20291
47% identity, 94% coverage
AH68_10135 ABC transporter ATP-binding protein from Bifidobacterium catenulatum PV20-2
51% identity, 71% coverage
BR0238 sugar ABC transporter, ATP-binding protein from Brucella suis 1330
BCAN_A0241 Lactose transport ATP-binding protein lacK from Brucella canis ATCC 23365
59% identity, 66% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...import ABC BMEII0864 BruAb20797 BRA0404 BOV_A0348 BCAN_B0407 75 OSP Maltose import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0864 BruAb20797 BRA0404 BOV_A0348 BCAN_B0407 75 OSP Maltose import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238 76...”
BL0673 ATP binding protein of ABC transporter for sugars from Bifidobacterium longum NCC2705
BBMN68_1403 ABC transporter ATP-binding protein from Bifidobacterium longum subsp. longum BBMN68
52% identity, 71% coverage
- Transcriptional Regulation of Carbohydrate Utilization Pathways in the Bifidobacterium Genus
Khoroshkin, Frontiers in microbiology 2016 - “...We propose that a missing ATPase component is encoded by a standalone conserved gene (e.g., BL0673 in B. longum NCC2705), which is not co-regulated with malEFG in Bifidobacterium genomes, and that is 63% similar to MsmK, a shared ATPase component that energizes multiple carbohydrate ABC transporters...”
- Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
Turroni, Applied and environmental microbiology 2012 - “...between the deduced product of BBPR_1824 and that of BL0673 of B. longum subsp. longum NCC2705 and MsiK of Streptomyces coelicolor A3, both of which are...”
- Proteomic analysis of global changes in protein expression during bile salt exposure of Bifidobacterium longum NCIMB 8809
Sánchez, Journal of bacteriology 2005 - “...binding protein of ABC transporter for sugars msiK BL0673 40.8 5.9 15 39 1.41 2.82 Amino acid metabolism BL44 Probable branched-chain amino acid...”
- Resistant starch utilization by Bifidobacterium, the beneficial human gut bacteria
Jung, Food science and biotechnology 2023 - “...and two components of ABC-type sugar transporters (BBMN68_1403 and BBMN68_1670) were upregulated. Table 2Reported single isolate of RS-degrading Bifidobacterium...”
- Starch and starch hydrolysates are favorable carbon sources for bifidobacteria in the human gut
Liu, BMC microbiology 2015 - “...BBMN68_1430, alpha-glucosidase; BBMN68_1600, oligo-1,6-glucosidase; and BBMN68_650, alpha-amylase). In addition, 2 components of ABC-type sugar transporters (BBMN68_1403, BBMN68_1670) and a glyceraldehyde 3-phosphate dehydrogenase (BBMN68_254) showed more abundant. We then analyzed the transcription of all the genes in the predicted pathway and the two genes encoding components of...”
- “...protein BL1418 [Bifidobacteriumlongum BBMN68_307 194 111 3.89 ATP binding protein of ABC transporter for sugars BBMN68_1403 153 30 3.94 COG1621: Beta-fructosidases (levanase/invertase) BBMN68_151 245 33 4.06 Alpha-1,4-glucosidase; maltase-like enzyme BBMN68_1261 346 205 5.27 L-1,2-propanediol oxidoreductase [Bifidobacteriumlongum NCC2705] BBMN68_1706 456 102 5.85 Ribosomal protein S2 183 1323...”
Blon_2475 ABC transporter related from Bifidobacterium longum subsp. infantis ATCC 15697
52% identity, 71% coverage
- Comparative transcriptomics reveals key differences in the response to milk oligosaccharides of infant gut-associated bifidobacteria
Garrido, Scientific reports 2015 - “...4 ). These genes encode important functions such as an ATPase associated to ABC transporters (Blon_2475), galactose metabolism genes and a -galactosidase with lactase activity 36 , Blon_2334 ( Fig. 4 and Table S9 ). Among genes associated with HMO consumption in B. infantis ( Table...”
- “...924 ATP synthase F1, alpha subunit(EC:3.6.3.14) Blon_2211 3882 972 912 DNA-directed RNA polymerase, alpha subunit(EC:2.7.7.6) Blon_2475 3016 1753 450 ABC transporter related, ATPase component Blon_0382 2871 1094 294 narrowly conserved hypothetical protein Blon_1738 2421 1455 414 hypothetical protein Table 3 Most highly transcribed genes in all...”
BAB1_0241 ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase from Brucella melitensis biovar Abortus 2308
Q2YP95 ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase from Brucella abortus (strain 2308)
59% identity, 66% coverage
- ClpP protease modulates bacterial growth, stress response, and bacterial virulence in Brucella abortus
Sun, Veterinary research 2023 - “...the proteomic analysis, the top 10 upregulated proteins were BAB2_0880, RibH2, BAB1_0239, BAB1_1744, UreG2, UbiG, BAB1_0241, SucC, BAB1_1964, and Bpt, while the top 10 down-regulated proteins were ClpS, BAB1_0115, BAB1_0018, BAB1_0296, BAB1_0875, BAB1_1435, BAB1_1357, BAB2_0019, BAB1_1214, and BAB2_0547. Integrated analysis revealed the global roles of ClpP...”
- Brucella abortus Encodes an Active Rhomboid Protease: Proteome Response after Rhomboid Gene Deletion
Marchesini, Microorganisms 2022 - “...Fumarylacetoacetate (FAA) hydrolase Q2YP90 BAB1_0246 Short-chain dehydrogenase/reductase SDR: Glucose/ribitol dehydrogenase Q2YP92 BAB1_0244 Oxidoreductase, N-terminal Q2YP95 BAB1_0241 ATP/GTP-binding site motif A (P-loop):ABC transporter: AAA ATPase Q2YRS4 BAB1_1579 OmpW family...”
- Characterization of Three Small Proteins in Brucella abortus Linked to Fucose Utilization
Budnick, Journal of bacteriology 2018 - “...putative ABC-type sugar transport system (BAB1_0238 to BAB1_0241), and proteins potentially involved in sugar metabolism (BAB1_0242 to BAB1_0248). To test...”
- “...by guest BAB designation BAB1_0238 BAB1_0239 BAB1_0241 BAB1_0240 BAB1_0242 BAB1_0244 BAB1_0246 BAB1_0247 BAB1_0248 BAB1_0243 BAB1_0237 BAB1_0236 Small Proteins...”
- Iron-dependent reconfiguration of the proteome underlies the intracellular lifestyle of Brucella abortus
Roset, Scientific reports 2017 - “...transporter complex GI:82699142 BAB1_0238 ABC-type sugar transport system, periplasmic comp. U YES 0.60 0.09 GI:82699145 BAB1_0241 ABC-type sugar transport systems, ATPase comp. U NO 0.60 0.06 GI:82700425 BAB1_1648 ABC-type sugar transport system, periplasmic comp U NO 0.55 0.07 GI:83269394 BAB2_0491 ABC-type sugar transport system, periplasmic comp....”
- Transcriptome analysis of the Brucella abortus BvrR/BvrS two-component regulatory system
Viadas, PloS one 2010 - “..., [34] . These included the already mentioned vjbR , but also motB (BAB2_1103), malK (BAB1_0241), norC (BAB2_0955), oppA (BAB1_1601), aspB (BAB1_1397), mosA (BAB1_0666) and three genes encoding hypothetical proteins (BAB1_1717, BAB1_0597 y BAB2_1127). B. melitensis malK mutant and B. suis aspB mutant were attenuated in...”
- Brucella abortus Encodes an Active Rhomboid Protease: Proteome Response after Rhomboid Gene Deletion
Marchesini, Microorganisms 2022 - “...(P-loop): Fumarylacetoacetate (FAA) hydrolase Q2YP90 BAB1_0246 Short-chain dehydrogenase/reductase SDR: Glucose/ribitol dehydrogenase Q2YP92 BAB1_0244 Oxidoreductase, N-terminal Q2YP95 BAB1_0241 ATP/GTP-binding site motif A (P-loop):ABC transporter: AAA ATPase Q2YRS4 BAB1_1579 OmpW family...”
Balac_1610 ATP binding protein of ABC transporter for sugars from Bifidobacterium animalis subsp. lactis Bl-04
51% identity, 71% coverage
- An ATP Binding Cassette Transporter Mediates the Uptake of α-(1,6)-Linked Dietary Oligosaccharides in Bifidobacterium and Correlates with Competitive Growth on These Substrates
Ejby, The Journal of biological chemistry 2016 - “...ABC transport system (Balac_1598, Balac_1597, and Balac_1610). The -galactosidase (Balac_1601) and the -(1,6)-glucosidase are responsible for the degradation...”
- Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
Andersen, BMC genomics 2013 - “...solute-binding protein (SBP) (Balac_1565), and an ATP-binding protein associated with oligosaccharide uptake by ABC transporters (Balac_1610) were both found, linking catabolic adaptation to the primary physiological functions of B. lactis Bl-04. These findings correlate with previously proposed molecular functions related to probiotic mechanisms in B. lactis...”
- Comparison of the complete genome sequences of Bifidobacterium animalis subsp. lactis DSM 10140 and Bl-04
Barrangou, Journal of bacteriology 2009 - “...ATP-binding protein, Balac_0062 (COG1129) and Balac_1610 (COG3839), were identified in Bifidobacterium animalis subsp. lactis. No phosphotransferase...”
AH67_08590 ABC transporter ATP-binding protein from Bifidobacterium pseudolongum PV8-2
51% identity, 71% coverage
BAD_RS08375 ABC transporter ATP-binding protein from Bifidobacterium adolescentis ATCC 15703
51% identity, 71% coverage
- Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
Yang, Food science & nutrition 2019 - “...409.27 196.97 BAD_RS00370 1.04 livH Branchedchain amino acid ABCtype transport system permease components 17.92 8.75 BAD_RS08375 1.02 msmX ABC transporter ATPbinding protein 38,386.82 18,870.88 BAD_RS03070 1.01 artQ Glutamine ABC transporter permease 89.94 181.07 BAD_RS02355 1.03 braC Solutebinding protein of ABC transporter for branchedchain amino acids 83.57...”
- “...BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58), cellobiose (meta_991), Dmannose (meta_166), Lisoleucine (meta_82), maltotriose (meta_1695), Dbiotin (meta_651), and glycerol (meta_15) involved in ABC...”
RL2793 putative ATP-binding component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
45% identity, 88% coverage
- Harnessing Rhizobia to Improve Heavy-Metal Phytoremediation by Legumes
Fagorzi, Genes 2018 - “...(gene annotation corresponds to Rlv 3841 genome): RL2862, RL2436, RL2322, pRL110066, RL1351, RL4539, pRL90287, RL4188, RL2793, RL2100, RL0615, RL1589, pRL110071, RL1553 Ni, Co [ 83 ]...”
2d62A / O57933 Crystal structure of multiple sugar binding transport atp-binding protein
44% identity, 88% coverage
- Ligand: pyrophosphate 2- (2d62A)
PH0194 multiple sugar-binding transport ATP-binding protein from Pyrococcus horikoshii OT3
44% identity, 88% coverage
NGR_c33090 ABC transporter ATP-binding protein from Sinorhizobium fredii NGR234
NGR_c33090 putative sugar ABC transporter, ATP-binding protein from Rhizobium sp. NGR234
51% identity, 80% coverage
sugC / P9WQI3 ABC-type trehalose transporter ATP-binding protein from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
SUGC_MYCTU / P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
TC 3.A.1.1.31 / O50454 PROBABLE SUGAR-TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER SUGC, component of The trehalose-recycling ABC transporter, LpqY-SugA-SugB-SugC (essential for virulence) from Mycobacterium tuberculosis (see 2 papers)
NP_215754 sugar ABC transporter ATP-binding protein SugC from Mycobacterium tuberculosis H37Rv
MT1276 sugar ABC transporter, ATP-binding protein from Mycobacterium tuberculosis CDC1551
Rv1238 PROBABLE SUGAR-TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER SUGC from Mycobacterium tuberculosis H37Rv
45% identity, 84% coverage
- function: Part of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence (PubMed:21118978). Responsible for energy coupling to the transport system (PubMed:32092417).
catalytic activity: alpha,alpha-trehalose(out) + ATP + H2O = alpha,alpha- trehalose(in) + ADP + phosphate + H(+) (RHEA:75203)
subunit: Monomer. Homodimerizes in the presence of ATP (PubMed:32092417). The complex is composed of two ATP-binding proteins (SugC), two transmembrane proteins (SugA and SugB) and a solute-binding protein (LpqY) (PubMed:21118978).
disruption phenotype: Mutants show no growth on trehalose as the sole carbon and energy source, but grow normally on glucose. They secrete substantial amounts of trehalose during growth on glycerol. - substrates: Trehalose
- Trehalose-recycling ABC transporter LpqY-SugA-SugB-SugC is essential for virulence of Mycobacterium tuberculosis.
Kalscheuer, Proceedings of the National Academy of Sciences of the United States of America 2010 - GeneRIF: Data show that the LpqY-SugA-SugB-SugC ATP-binding cassette transporter is a recycling system mediating the retrograde transport of released trehalose.
- Designer arrays for defined mutant analysis to detect genes essential for survival of Mycobacterium tuberculosis in mouse lungs
Lamichhane, Infection and immunity 2005 - “...The genes MT0110 (Rv0101), MT0684 (Rv0655), MT0694 (Rv0666), MT1276 (Rv1238), MT1847 (Rv1798), and MT3706.1 (Rv3601c) seem to be arranged in operons but are...”
- Genomic analysis of Mycobacterium brumae sustains its nonpathogenic and immunogenic phenotype
Renau-Mínguez, Frontiers in microbiology 2022 - “...Protein ABC transporter 73.1 93.8 Rv1237 sugB 1,379,855 1,380,679 Forward Protein ABC transporter 81.1 98.9 Rv1238 sugC 1,380,684 1,381,865 Forward Protein ABC transporter 78.7 100 Rv1293 lysA 1,448,028 1,449,371 Forward Other virulence factors 76.1 99.6 Rv1346 mbtN 1,510,846 1,512,006 Forward Other virulence factors 75.7 99 Rv1540...”
- Shotgun proteomic profiling of dormant, 'non-culturable' Mycobacterium tuberculosis
Nikitushkin, PloS one 2022 - “...proteins of the ABC trehalose transporter complex LpqYSugASugBSugC ( Rv1235 , Rv1236 , Rv1237 , Rv1238 ): out of four annotated in the Mtb genome only Rv1235 and Rv1238 were detected in the current study, albeit with a different sign of FC in dormancy, rather indicating...”
- Heat-killed Mycolicibacterium aurum Aogashima: An environmental nonpathogenic actinobacteria under development as a safe novel food ingredient
Nouioui, Food science & nutrition 2021 - “...orf03428 Rv1236 53.0 <60% 3E91 sug B orf03427 Rv1237 57.1 <60% 3E109 sug C orf03426 Rv1238 53.9 <60% 8E142 Copper uptake Copper exporter ctp V orf03576 Rv0969 54.3 <60% 0 fad D33 orf02653 Rv1345 61.7 <95% 0 Mbt A orf00510 Rv2384 64.3 <95% 0 Mbt B...”
- Biochemical and biophysical characterization of nucleotide binding domain of Trehalose transporter from Mycobacterium tuberculosis
Sabharwal, International journal of biological macromolecules 2020 (PubMed)- “...false Mycobacterium tuberculosis Rv1238 SugC ABC transporter Biophysical characterization...”
- “...Mycobacterium tuberculosis. Keywords Mycobacterium tuberculosis Rv1238 SugC ABC transporter Biophysical characterization 1 Introduction ATP-binding cassette...”
- ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
Soni, Emerging microbes & infections 2020 - “...] Trehalose importer (LpqY-SugABC/Rv1235-Rv1238) SBP: LpqY (Rv1235) TMD: SugA (Rv1236) and SugB (Rv1237) NBD: SugC (Rv1238) (two copies) LpqY-SugABC mutant shows reduced virulence in mice [ 43 ] Uptake and recycle disaccharide trehalose [ 43 ] Involved in biofilm formation [ 43 ] Amino-sugar importer (UspABC/Rv2316-Rv2318)...”
- Characterization of Conserved and Novel Septal Factors in Mycobacterium smegmatis
Wu, Journal of bacteriology 2018 - “...Rv2400 Rv2748 Rv3850 Rv3610 Rv2219 Rv2969 Rv1821 NAb Rv1238 Rv1747 Rv2921 Rv2553 Rv1111 Rv0338 Rv1819 Rv3102 NA Rv0018 Rv2905 NA Rv2187 Rv3802 MSMEG_6942...”
- A genome-wide structure-based survey of nucleotide binding proteins in M. tuberculosis
Bhagavat, Scientific reports 2017 - “...transcriptional antitermination regulator lends vital support for our identification 54 . Further, proteins like Rv0092, Rv1238, Rv1310, and Rv0342, to name a few, are identified to be NTP binding from our structure-based studies, for which, a sequence level of tuberculist annotation and experimental evidence exists for...”
- Development and analysis of an in vivo-compatible metabolic network of Mycobacterium tuberculosis
Fang, BMC systems biology 2010 - “...dimycocerosate to the biomass objective function [ 62 ] 27 32 33 34 Rv1236 Rv1237 Rv1238 sugA sugB sugC FN Transport Transport of glucose, maltoheptaose, maltose, ribose, trehalose, and xylose into cell (1) Allowed xylose uptake and added xylose to the biomass objective function 28 35...”
- More
SLGD_00111 multiple sugar-binding transport ATP-binding protein from Staphylococcus lugdunensis HKU09-01
47% identity, 87% coverage
PD0347 sugar ABC transporter ATP-binding protein from Xylella fastidiosa Temecula1
46% identity, 90% coverage
BCAN_B0688 Maltose/maltodextrin import ATP-binding protein malK from Brucella canis ATCC 23365
50% identity, 80% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623,...”
XF1067 sugar ABC transporter ATP-binding protein from Xylella fastidiosa 9a5c
46% identity, 90% coverage
B4602_RS00875 ABC transporter ATP-binding protein from Staphylococcus aureus
46% identity, 89% coverage
SAPIG0223 ABC transporter ATP-binding protein from Staphylococcus aureus subsp. aureus ST398
46% identity, 89% coverage
- Rapid differentiation between livestock-associated and livestock-independent Staphylococcus aureus CC398 clades
Stegger, PloS one 2013 - “...Genomic position b Codon Humanclade Livestockclade 15 9,319 (SAPIG0006) GCC (Ala) GTC (Val) 237 244,322 (SAPIG0223) ATG (Met) ATA (Ile) 476 425,594 (SAPIG0409) CCA (Pro) TCA (Thr) 748 551,946 (SAPIG053) CCA (Pro) TCA (Thr) 1,002 732,619 (SAPIG0698) CTA (Leu) ATA (Ile) 2,167 1,518,366 (SAPIG1434) GCG (Ala)...”
WP_011677800 ABC transporter ATP-binding protein from Oenococcus oeni S14
46% identity, 81% coverage
BMEI1713 MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING PROTEIN MALK from Brucella melitensis 16M
58% identity, 66% coverage
- Analyses of Brucella pathogenesis, host immunity, and vaccine targets using systems biology and bioinformatics
He, Frontiers in cellular and infection microbiology 2012 - “...Mice 12414147 48 gnd BMEII1124 Mice 12761078 49 ilvD BMEI1848 Mice, macrophages 15271960 50 malK BMEI1713 Macrophages 14979322 51 manB BMEII0899 Mice, macrophages, HeLa 14979322 52 mocC BMEII0570 Mice, HeLa 14979322 53 ndvB BMEI1837 Mice, HeLa 14979322 54 pgi BMEI1636 Macrophages 10678941 55 pgm BMEI1886 Mice...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BCAN_B0408 OPN Oligopeptide import ABC BMEII0864 BruAb20797 BRA0404 BOV_A0348 BCAN_B0407 75 OSP Maltose import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716...”
- Brucella melitensis global gene expression study provides novel information on growth phase-specific gene regulation with potential insights for understanding Brucella:host initial interactions
Rossetti, BMC microbiology 2009 - “...genes encoding transporters specific for amino acids (BMEI02630264, BMEII00989 and BMEII0861 to II0864), carbohydrates (BMEI1580, BMEI1713, BMEII06212 and II0624) and uncharacterized transporters (BMEI1554, BMEII0481, BMEII0483, BMEII0662). Collectively, these data indicate an active conversion of metabolites to components of the cell envelope structure at late-log phase, which...”
SA0206 multiple sugar-binding transport ATP-binding protein from Staphylococcus aureus subsp. aureus N315
46% identity, 89% coverage
- Isothermal titration calorimetry analysis of the binding between the maltodextrin binding protein malE of Staphylococcus aureus with maltodextrins of various lengths
Takemiya, Biochemical and biophysical research communications 2024 (secret) - The use of 4-Hexylresorcinol as antibiotic adjuvant
Nikolaev, PloS one 2020 - “...Russia) were used: Staphylococcus aureus ATCC 29213 (reference strain) and isolates MRSA S. aureus (SA0077, SA0206, SA0411 SA0318); clinical isolates Enterococcus faecalis E23 and E28; Escherichia coli ATCC 25922 (reference strain) and Escherichia coli isolates (1273, 1263); clinical isolates of Klebsiella pneumoniae (1191, 204, 895); Pseudomonas...”
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...aldA 4.8 56.6 Aldehyde dehydrogenase-like Yes NWMN_0134 SA0184 4.4 7.2 Hypothetical (NWMN_01340137; carbohydrate metabolism) NWMN_0151 SA0206 8.6 7.5 Hypothetical (NWMN_01510154 operon) Yes NWMN_0162 SA0218 pflB 8.1 Formate acetyltransferase NWMN_0163 SA0219 19.1 Formate-lyase activating enzyme NWMN_0173 SA0229 2.2 7.5 Hypothetical NWMN_0174 SA0230 2.1 16.0 Hypothetical Yes (3.4)...”
- “...reductase b + NWMN_0031 SA0087 5.8 Hypothetical NWMN_0113 SA0162 aldA 5.3 Aldehyde dehydrogenase-like + NWMN_0151 SA0206 7.7 Putative ABC sugar transporter (NWMN_01510154) NWMN_0329 SA0325 5.2 Glycerol-3-phosphate transporter NWMN_1207 SA1140 glpF 16.7 Glycerol uptake facilitator protein + NWMN_1224 4.1 Hypothetical (82 residues) NWMN_1378 SA1301 ndk 3.9 Nucleotide...”
- Daptomycin resistance mechanisms in clinically derived Staphylococcus aureus strains assessed by a combined transcriptomics and proteomics approach
Fischer, The Journal of antimicrobial chemotherapy 2011 - “...SdhB SA1533 SA0995 SA0996 Eno GapA MsmX SA0731 SA0727 SA0207 SA0206 PurH SA0925 FabF SA0843 CrtN SA2348 SA0587 RpsJ RpsM RpsB RpsC RpsD RpsE RpsF RpsG RplL TufA...”
- Genome-wide transcriptional profiling of the response of Staphylococcus aureus to cryptotanshinone
Feng, Journal of biomedicine & biotechnology 2009 - “...SA0325 CGCCCAATCAAGTACACCA oppFfor SA0198 TCAGAAGGCTTTATTTGGT oppFrev SA0198 GAATGATTAGTGGTCGTTTA SA2135for SA2135 AACTTAAAGCCTCAACATAG SA2135rev SA2135 TAACTTCCAACTGCCATAC msmXfor SA0206 CATTTGGGCTAAAGCTACG msmXrev SA0206 GACGCTGTCCACCAGATAA opp-1Ffor SA2251 TCATCATTACACCCATTTC opp-1Frev SA2251 GCCTTAGATAGACCGACTT dpsfor SA1941 TTAGCGGTAGGAGGAAAC dpsrev SA1941 ATCATCGCCAGCATTACC SA0302for SA0302 GAATGGAAAAACAGGAAAAC SA0302rev SA0302 GCAAACACATAGCCAATAAG (a) ORF, open reading frame. (b) refer to...”
- “...2.8 0.5 2.5 0.8 SA2135 Hypothetical protein, similar to sodium/glutamate symporter 2.8 0.8 2.1 0.8 SA0206 msmX Multiple sugar-binding transport ATP-binding protein 3.4 1.0 2.5 0.8 SA2251 opp-1F Oligopeptide transporter putative ATPase domain 2.6 0.7 2.6 0.6 SA1941 dps General stress protein 20U 10.5 2.8 4.9...”
- Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
Seggewiss, Journal of bacteriology 2006 - “...AL. J. BACTERIOL. TABLE 2--Continued Fold changeb SA0432 SA0209 SA0206 SA0640 0.00 0.00 0.00 0.00 2.52 0.20 0.20 2.01 SA0172 SA0186 SA0639 0.00 0.00 0.01 2.19...”
Atu0308 ABC transporter, nucleotide binding/ATPase protein (sn-Glycerol-3-phosphate) from Agrobacterium tumefaciens str. C58 (Cereon)
48% identity, 91% coverage
MSMEG_0518 ABC transporter, nucleotide binding/ATPase protein, sn-Glycerol-3-phosphate from Mycobacterium smegmatis str. MC2 155
46% identity, 86% coverage
HMPREF0421_20105 ABC transporter ATP-binding protein from Gardnerella vaginalis ATCC 14019
51% identity, 71% coverage
- Phase variable colony variants are conserved across Gardnerella spp. and exhibit different virulence-associated phenotypes
Garcia, mSphere 2024 - “...cell wall synthesis (HMPREF0421_20394), DNA recombination and segregation (RecA, FtsK, HMPREF0421_20072), ABC (ATP-binding cassette) transport (HMPREF0421_20105, HMPREF0421_20232, HMPREF0421_20436, HMPREF0421_20240), and RNA posttranscriptional modification (HMPREF0421_20849). In addition to the similarly expressed proteins presented in Tables S2 and S3 , each strain displayed unique differences in protein expression...”
SACOL0192 maltose ABC transporter, ATP-binding protein, putative from Staphylococcus aureus subsp. aureus COL
SAOUHSC_00175 multiple sugar-binding transport ATP-binding protein, putative from Staphylococcus aureus subsp. aureus NCTC 8325
NWMN_0151 hypothetical protein from Staphylococcus aureus subsp. aureus str. Newman
46% identity, 89% coverage
- In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
Sadaka, PloS one 2014 - “...IIBC components 21.1 (1.2) 8.3 (1.3) SACOL0179 Phosphosugar-binding transcriptionalregulator, RpiR family 12.1 (1.2) 6.2 (1.5) SACOL0192 Maltose ABC transporter, ATP-binding protein, putative 21.5 (1.5) 6.5 (1.6) SACOL0193 Maltose ABC transporter, maltose-bindingprotein, putative 14.4 (1.3) 3.4 (1.2) 4.2 (1.4) SACOL0194 Maltose ABC transporter permease protein 11.1 (1.5)...”
- Staphylococcus aureus gene expression in a rat model of infective endocarditis
Hanses, Genome medicine 2014 - “...ABC transporter, maltose-binding malF SACOL0194 7.4 3.9 6.0 3.5 maltose ABC transporter, permease protein malK SACOL0192 14.7 14.7 6.2 6.8 maltose ABC transporter, ATP-binding protein opuD SACOL2176 2.0 2.4 ns ns osmoprotectant transporter, BCCT family tet38 SACOL0122 21.2 12.2 13.1 8.9 tetracycline-resistance protein, putative ulaA SACOL0400...”
- A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
Chen, Molecular microbiology 2009 - “...SACOL0248 lrgB 3.2 Holinlike protein SACOL1428 lysC 4.4 Aspartokinase, and subunits SACOL1551 malA 4.7 -glucosidase SACOL0192 msmX 2.1 Maltose ABC transporter SACOL2397 nirD 3.0 -2.2 NAD (P) H Nitrite recuctase, small subunit SACOL1475 norB 5.7 Drug transporter SACOL2031 nrgA 4.7 Ammonium transporter family protein SACOL0872 ohr...”
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...transporter periplasmic binding protein putative SAOUHSC_01656 4.262 Conserved hypothetical protein SAOUHSC_01657 4.964 ABC transporter putative SAOUHSC_00175 10.497 Multiple sugar-binding transport ATP-binding protein putative SAOUHSC_02640 22.861 Conserved hypothetical protein SAOUHSC_02641 37.417 Permease putative domain protein Carotenoid biosynthesis SAOUHSC_02879 0.222 Squalene desaturase putative SAOUHSC_02877 0.321 Squalene synthase putative...”
- Bacteria Are New Targets for Inhibitors of Human Farnesyltransferase
Weber, Frontiers in microbiology 2021 - “...encoding an oxygen-dependent choline dehydrogenase (SAOUHSC_02932), a gene encoding a multiple sugar-binding transport ATP-binding protein (SAOUHSC_00175), a multidrug ABC transporter permease (SAOUHSC_01312), and two hypothetical proteins (SAOUHSC_02640, SAOUHSC_A00526) ( Figure 6 ). The significant upregulated genes are: SAOUHSC_01311, encoding an ABC-transporter, HrtB , encoding a hemin...”
- Staphylococcus aureus Preferentially Liberates Inorganic Phosphate from Organophosphates in Environments where This Nutrient Is Limiting
Kelliher, Journal of bacteriology 2020 (secret) - Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...encoding an uncharacterized aldehyde dehydrogenase, and hypothetical operons beginning with NWMN_0134 (NWMN_0134 to NWMN_0137) and NWMN_0151 (NWMN_0151 to NWMN_0154), the latter of which is associated with changes in carbohydrate metabolism and uptake in other Staphylococcus strains. Although some of these sulfide-inducible genes are also induced in...”
- “...SA0162 aldA 4.8 56.6 Aldehyde dehydrogenase-like Yes NWMN_0134 SA0184 4.4 7.2 Hypothetical (NWMN_01340137; carbohydrate metabolism) NWMN_0151 SA0206 8.6 7.5 Hypothetical (NWMN_01510154 operon) Yes NWMN_0162 SA0218 pflB 8.1 Formate acetyltransferase NWMN_0163 SA0219 19.1 Formate-lyase activating enzyme NWMN_0173 SA0229 2.2 7.5 Hypothetical NWMN_0174 SA0230 2.1 16.0 Hypothetical Yes...”
BMEII0593 GLUCOSE ABC TRANSPORTER ATPASE from Brucella melitensis 16M
50% identity, 80% coverage
- Erythritol triggers expression of virulence traits in Brucella melitensis
Petersen, Microbes and infection 2013 - “...Sugar transport system permease protein 6.93 1.00 BMEII0592 Sugar transport system permease protein 7.56 1.00 BMEII0593 Glucose ABC transporter ATPase 4.11 1.00 Other BMEI0095 Succinoglycan biosynthesis regulator 2.39 0.95 BMEI0102 Universal stress protein family 4.16 1.00 BMEI0347 Phosphoserine aminotransferese 2.27 0.90 BMEI0454 Outer membrane protein W...”
- Global analysis of quorum sensing targets in the intracellular pathogen Brucella melitensis 16 M
Uzureau, Journal of proteome research 2010 - “...912 53 157 Maldi-TOF BMEII0033 Channel protein VirB9 homologue AAL53274.1 0.49 611 36 100 Maldi-TOF BMEII0593 Glucose ABC transporter ATPase AAL53835.1 2.92 11116 45 133 Maldi-TOF BMEII0863 Oligopeptide transport ATP-binding protein appD AAL54105.1 1.45 17124 38 183 Maldi-TOF Unassigned BMEI1193 Cell wall degradation protein AAL52374.1 0.75...”
- “...Q-TOF Stress/chaperone BMEI1367 Superoxide Dismutase Mn AAL52548.1 1.38 LLEGSGLEGK 4 48 501,78 2+ Q-TOF Transport/secretion BMEII0593 ATP GDP Binding protein ABC transporter AAL53835.1 1.93 SVFFDSASQTR 2 51 622,8208 2+ Q-TOF Unassigned BMEI1939 D-3-phosphoglycerate dehydrogenase AAL53120.1 0.60 GSLQNEPDILAALDR 4 121 806,4188 2+ Q-TOF vjbR , pH 711...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM BMEII0622, ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP...”
BBPR_1824 ABC transporter ATP-binding protein from Bifidobacterium bifidum PRL2010
51% identity, 71% coverage
TC 3.A.1.1.11 / Q93KB8 TogA, component of Saturated and unsaturated oligogalacturonide transporter, TogMNAB (transports di- to tetrasaccharide pectin degradation products which consist of D-galacuronate, sometimes with 4-deoxy-L-threo-5-hexosulose uronate at the reducing end of the oligosaccharide) (Hugouvieux-Cotte-Pattat et al. 2001). Regulated by pectin utilization regulator KdgR from Erwinia chrysanthemi (see paper)
44% identity, 86% coverage
- substrates: Oligogalacturonides
VS_RS21245 ABC transporter ATP-binding protein from Vibrio atlanticus
50% identity, 81% coverage
- Indole decreases the virulence of the bivalve model pathogens Vibrio tasmaniensis LGP32 and Vibrio crassostreae J2-9
Zhang, Scientific reports 2022 - “...A Glycerol metabolism VS_RS15345 2.643136518 Down 3.52E22 Glycerol-3-phosphate dehydrogenase VS_RS15355 4.989217537 Down 8.10E59 Glycerol kinase VS_RS21245 3.165892799 Down 4.78E27 MULTISPECIES: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC VS_RS07525 2.58950755 Down 1.19E20 Glycerol-3-phosphate transporter Chemotaxis VS_RS15830 2.1220644 Down 1.73E15 Methyl-accepting chemotaxis protein VS_RS19890 2.589006414 Down 9.30E20 Methyl-accepting chemotaxis...”
RHE_RS12565 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
45% identity, 86% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS29410 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS12565 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS24950 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 Bacteroid RHE_RS28400...”
- “..., ggtA , msiK ; multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding...”
RHE_PE00248 probable sugar ABC transporter, ATP-binding protein from Rhizobium etli CFN 42
47% identity, 95% coverage
SYNPCC7002_A2039 ABC transporter, ATP-binding subunit from Synechococcus sp. PCC 7002
55% identity, 72% coverage
EF0938 ABC transporter, ATP-binding/TOBE domain protein from Enterococcus faecalis V583
OG1RF_10665, OG1RF_RS03455 ABC transporter ATP-binding protein from Enterococcus faecalis OG1RF
48% identity, 79% coverage
- Genes Contributing to the Unique Biology and Intrinsic Antibiotic Resistance of Enterococcus faecalis
Gilmore, mBio 2020 - “...surviving antibiotic challenge. Interestingly, most of those genes contribute to either rifampin resistance (including EF0933, EF0938, EF0941, and EF0947) or ciprofloxacin resistance (EF0949). Additionally, EF0948 contributes to trimethoprim-sulfamethoxazole resistance. This group of genes appears to connect DNA helicity to intracellular sugar phosphate balance. With the above...”
- Examination of Enterococcus faecalis Toxin-Antitoxin System Toxin Fst Function Utilizing a Pheromone-Inducible Expression Vector with Tight Repression and Broad Dynamic Range
Weaver, Journal of bacteriology 2017 - “...FWD EF1304 REV EF0758 FWD EF0758 REV EF0938 FWD EF0938 REV 16S rRNA FWD 16S rRNA REV GCATCACATGTACGAGATTGTC GCAACTTGTTTATTCCTGGTTCT GTTGGTTATCGCACCAATCTTT...”
- Transcriptional response of Enterococcus faecalis V583 to erythromycin
Aakra, Antimicrobial agents and chemotherapy 2005 - “...function Unknown function EF0402 EF0576 EF0793 EF0892 EF0907 EF0938 EF1057 EF1100 EF1128 EF1254 EF1268 EF1304 EF1331 EF1344 EF1345 EF1352 EF1492 EF1673 EF1720...”
- Radezolid Is More Effective Than Linezolid Against Planktonic Cells and Inhibits Enterococcus faecalis Biofilm Formation
Zheng, Frontiers in microbiology 2020 - “...ATP-binding cassette transporter, mdlB2 ) and three ABC superfamily ATP-binding cassette transporter genes ( OG1RF_10126, OG1RF_10665 , and OG1RF_10495 ) were amplified by PCR. The amplicons were purified and digested with endonucleases, and then cloned into the pIB166 plasmid for gene overexpression. Correct cloning was verified...”
- “...that the transcriptional levels of four ABC superfamily ATP-binding cassette transporter genes ( OG1RF_12220, OG1RF_10126, OG1RF_10665 , and OG1RF_10495 ) were increased in the high-level LZD-resistant OG1RF-55 isolate ( Table 4 ). Finally, to confirm that the four genes were involved in the resistance to RZD...”
- “...ABC protein 9.046 8.073 OG1RF_RS00635 OG1RF_10126 ABC superfamily ATP-binding cassette transporter, ABC protein 6.334 4.813 OG1RF_RS03455 OG1RF_10665 ABC superfamily ATP-binding cassette transporter, ABC protein 5.449 6.538 OG1RF_RS02620 OG1RF_10495 ABC superfamily ATP-binding cassette transporter, ABC protein 4.349 3.452 OG1RF_RS13115 OG1RF_12562 (oadA) Oxaloacetate decarboxylase 3.422 1.698 OG1RF_RS00860 OG1RF_10171...”
- Enterococcus faecalis Maltodextrin Gene Regulation by Combined Action of Maltose Gene Regulator MalR and Pleiotropic Regulator CcpA
Grand, Applied and environmental microbiology 2020 (secret) - (p)ppGpp and CodY Promote Enterococcus faecalis Virulence in a Murine Model of Catheter-Associated Urinary Tract Infection
Colomer-Winter, mSphere 2019 - “...uptake +32.5 treB PTS, trehalose uptake +11.9 2.0 ulaB PTS, ascorbate uptake +5.1 ABC-type transporters OG1RF_10665 ABC-type transporter +3.4 2.5 OG1RF_10879 ABC-type transporter +2.2 OG1RF_11003 ABC-type transporter +15.9 OG1RF_11188 ABC-type transporter +8.1 OG1RF_11763 ABC-type transporter +3.2 OG1RF_11774 Sugar ABC-type transporter +38.5 OG1RF_12466 ABC-type transporter +3.5 mdlB...”
- Examination of Enterococcus faecalis Toxin-Antitoxin System Toxin Fst Function Utilizing a Pheromone-Inducible Expression Vector with Tight Repression and Broad Dynamic Range
Weaver, Journal of bacteriology 2017 - “...RNA IEF0409 but only 8-fold by RNA IpAD1. OG1RF_RS03455, annotated as corresponding to a multiple-sugar ABC transporter, was induced approximately 3-fold by RNA...”
- “...RNA-seq results with OG1RF_RS12145, OG1RF_RS01655, OG1RF_RS026108, and OG1RF_RS03455 were confirmed by RT-qPCR (Fig. 6). While June 2017 Volume 199 Issue 12...”
Bbr_1890 ABC transporter ATP-binding protein from Bifidobacterium breve UCC2003
51% identity, 71% coverage
- Bifidobacterial biofilm formation is a multifactorial adaptive phenomenon in response to bile exposure
Kelly, Scientific reports 2020 - “...synthesis 3.81 2.43E08 Bbr_0521 Solute binding protein of ABC transporter, bac 3 family 3.76 1.65E07 Bbr_1890 ATP binding protein for ABC transporter 3.67 4.95E09 Bbr_0492 Galactokinase 3.52 0.004216372 Bbr_0188 Formate tetrahydrofolate ligase 3.00 0.000253137 Bbr_1719 Type I Multi-functional Fatty Acid Synthase 2.78 1.07E07 Bbr_1615 DNA- directed...”
- “...predicted to encode an ABC-type transporter permease (Bbr_1558), an ATP-binding protein for an ABC-type transporter (Bbr_1890), galactokinase (Bbr_0492), acetate kinase (Bbr_0771) and xylulose-5-phosphate/Fructose-6-phosphate phosphoketolase (Bbr_0776) were shown to be transcriptionally upregulated under these conditions, indicating that carbohydrate uptake and active carbohydrate metabolism are associated with the...”
- The essential genomic landscape of the commensal Bifidobacterium breve UCC2003
Ruiz, Scientific reports 2017 - “...studied in pathogenic bacteria. Also two genes encoding predicted orphan ATP binding proteins (Bbr_1490 and Bbr_1890), not located in proximity to any ABC transporter-encoding genes, were found to be essential in our analysis therefore suggesting they might energize crucial transport systems in the cell. Remarkably, 53...”
TC 3.A.1.1.6 / Q48394 CymD, component of Cyclodextrin porter from Klebsiella oxytoca (see paper)
47% identity, 77% coverage
MSMEG_0508 glycerol-phosphate porter from Mycobacterium smegmatis str. MC2 155
47% identity, 94% coverage
GGTA_SYNY3 / Q79EE4 Osmoprotective compounds uptake ATP-binding protein GgtA; EC 7.5.2.- from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) (see 2 papers)
TC 3.A.1.1.32 / Q55035 Orf 363 aka ATP-binding subunit of an ABC-type osmolyte transporter, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) from Synechocystis sp. (strain PCC 6803) (see 2 papers)
slr0747 ATP-binding subunit of an ABC-type osmolyte transporter from Synechocystis sp. PCC 6803
49% identity, 81% coverage
- function: Part of the ABC transporter complex GgtABCD involved in the uptake of the osmoprotective compounds glucosylglycerol (GG), sucrose and trehalose (PubMed:11081796, PubMed:9006025). Responsible for energy coupling to the transport system (Probable).
subunit: The complex is composed of two ATP-binding proteins (GgtA), two transmembrane proteins (GgtC and GgtD) and a solute-binding protein (GgtB).
disruption phenotype: Insertion mutant loses its GG uptake ability, and shows leakage of glucosylglycerol from the cells into the medium. Mutation does not affect salt tolerance. - substrates: Glucosylglycerol
- Integrative analysis of the salt stress response in cyanobacteria
Klähn, Biology direct 2021 - “...2 sll1085 Glycerol-3-phosphate dehydrogenase (GlpD) 2.55 0.71 2 slr1672 Glycerol kinase (GlpK) 2.14 2.71 2 slr0747 ATP-binding subunit of GG transporter (GgtA) 1.83 2.43 2 slr0529 Substrate-binding subunit of GG transporter (GgtB) 1.33 1.48 2 slr0531 Integral membrane protein of GG transporter (GgtD) 2.02 2.13 2...”
- The Response Regulator Slr1588 Regulates spsA But Is Not Crucial for Salt Acclimation of Synechocystis sp. PCC 6803
Song, Frontiers in microbiology 2017 - “...second step in GG synthesis ( Hagemann et al., 1997b ), whereas the second gene slr0747 ( ggtA ) encodes the ATP-binding subunit of the ABC-transporter for GG, trehalose, and sucrose ( Hagemann et al., 1997a ). It has been reported that the ggpP mutant of...”
- Protein Network Signatures Associated with Exogenous Biofuels Treatments in Cyanobacterium Synechocystis sp. PCC 6803
Pei, Frontiers in bioengineering and biotechnology 2014 - “...transporters were also involved in tolerance to many environmental perturbations. For example, ggtA gene ( slr0747 ) encodes a subunit of the transport system for the osmoprotective compound glucosylglycerol that is necessary for Synechocystis grown under salt stress (Hagemann et al., 1997 ). Our analysis found...”
- Computational prediction of the osmoregulation network in Synechococcus sp. WH8102
Mao, BMC genomics 2010 - “...Kdp expression under osmotic stress sll0045 SpsA Sucrose synthetase slr1312 SpeA Arginine synthetase slr0662 SpeA slr0747 GgtA Glucosylglycerol/trehalose/sucrose slr0529 GgtB transporter slr0530 GgtC slr0531 GgtD sll1546 GgpS Glucosylglycerol synthetases slr0746 GgpP sll0306 RpoD RNA polymerase, Sigma 70 (sigma D) factor A. halo has three genes encoding...”
- “...PCC7418 AB094498 SdmT SYNW1913 PCC7418 sll1566 GgpS SYNW1281 SYNW1279-1286 0.99 PCC6803 slr0746 GgpP SYNW0860 PCC6803 slr0747 GgtA SYNW1285 SYNW1279-1286 0.99 PCC6803 slr0530 GgtC SYNW1283 SYNW1279-1286 0.99 PCC6803 slr0531 GgtD SYNW1284 SYNW1279-1286 0.99 PCC6803 ABX75857 GpgS SYNW2436 P.marina ABX75858 GpgP SYNW2434 P.marina slr0662 SpeA SYNW2359 0.99 PCC6803...”
TC 3.A.1.1.27 / Q8DT25 MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) from Streptococcus mutans (see paper)
SMU_1571 ABC transporter ATP-binding protein from Streptococcus mutans UA159
45% identity, 86% coverage
OENOO_37007 multiple sugar ABC transporter ATP-binding protein from Oenococcus oeni ATCC BAA-1163
46% identity, 77% coverage
AT5A_19386 ABC transporter ATP-binding protein from Agrobacterium tumefaciens 5A
46% identity, 95% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...AT5A_19376 Multiple sugar transport system permease protein 4.2 4.6 9.1 3.1 30.9 3.7 3.5 3.0 AT5A_19386 Sugar ABC transporter ATP-binding protein 2.2 2.5 17.2 33.6 2.1 2.0 AT5A_19781 Ribose ABC transporter transmembrane protein AT5A_22281 Sugar ABC transporter permease 2.4 AT5A_22286 Sugar ABC transporter substrate-binding protein 2.4...”
- “...As(III) exposure. An example of this pattern is the sugar transporter system (AT5A_19366, AT5A_19371, AT5A_19376, AT5A_19386) in the arsR1 mutant ( Supplementary Table 3 ). The third pattern involved no deviation from wild type in the absence of As(III), followed by a significant change in expression...”
GRH99_08730 ABC transporter ATP-binding protein from Lactobacillus crispatus
46% identity, 79% coverage
SSUSC84_1724 multiple sugar-binding transport ATP-binding protein from Streptococcus suis SC84
SSU1701 multiple sugar-binding transport ATP-binding protein from Streptococcus suis P1/7
44% identity, 87% coverage
- Exogenous glycogen utilization effects the transcriptome and pathogenicity of Streptococcus suis serotype 2
Tan, Frontiers in cellular and infection microbiology 2022 - “...SSUSC84_1079 citZ Citrate synthase -16.67 -33.33 1.82 SSUSC84_1262 PTS transporter subunit EIIC 16.99 17.15 1.25 SSUSC84_1724 msmK ABC transporter ATP-binding protein 5.81 2.98 0.59 SSUSC84_1871 apuA Surface-anchored amylopullulanase 65.44 43.57 2.07 SSUSC84_1959 mnmG tRNA uridine-5-carboxymethylaminomethyl synthesis enzyme -5.26 -6.25 1.04 Functional enrichment analysis was performed on...”
- MsmK, an ATPase, Contributes to Utilization of Multiple Carbohydrates and Host Colonization of Streptococcus suis
Tan, PloS one 2015 - “...maltotriose in S . mutans [ 36 ]. In this study, we identified the gene SSUSC84_1724 which is annotated msmK in S . suis SC84 genome and encodes an ATPase to energize both ABC transporters MsmEFG and MalXCD. The MsmK is responsible for utilization of raffinose,...”
- “...S . suis genome sequences available in GenBank and found that the protein encoded by SSUSC84_1724 in the genome of S . suis strain SC84 showed the highest similarity to the MsmK of S . pneumoniae (79.5%) and S . mutans (78.5%) ( Fig 2A )...”
- Transcriptomic Analysis Reveals Selective Metabolic Adaptation of Streptococcus suis to Porcine Blood and Cerebrospinal Fluid
Koczula, Pathogens (Basel, Switzerland) 2017 - “...galactose, N -acetylgalactosamine, mannose, fructose, or ascorbate, or ATP-binding-cassette (ABC) transporters such as msmK ( SSU1701 ), which encodes for an ATPase subunit of ABC transporters and thereby contributes to the utilization of multiple carbohydrates and the host colonization of S. suis [ 16 ]. These...”
TC 3.A.1.1.20 / Q7WWQ6 ATP-binding protein MsmK aka ABC transporter nucleotide binding protein, component of The fructooligosaccharide porter, MsmEFGK from Lactobacillus acidophilus (see 2 papers)
46% identity, 79% coverage
- substrates: Fructooligosaccharides
SP_1580 sugar ABC transporter, ATP-binding protein from Streptococcus pneumoniae TIGR4
44% identity, 87% coverage
XOC_2606 ABC transporter ATP-binding protein from Xanthomonas oryzae pv. oryzicola BLS256
47% identity, 88% coverage
- VmsR, a LuxR-Type Regulator, Contributes to Virulence, Cell Motility, Extracellular Polysaccharide Production and Biofilm Formation in Xanthomonas oryzae pv. oryzicola
Zhang, International journal of molecular sciences 2024 - “...proteins: XOC_2212 , XOC_2478 , XOC_2590 , XOC_2602 , XOC_2603 , XOC_2604 , XOC_2605 , XOC_2606 , XOC_2610 , XOC_2612 , XOC_2614 , XOC_2615 , XOC_2617 , and XOC_2861 . The expression levels of the mRNA for these genes corresponded closely with the RNA-Seq data (...”
B1745_06760 ABC transporter ATP-binding protein from Lactobacillus amylolyticus
56% identity, 66% coverage
- Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
Fei, Food science & nutrition 2022 - “...(B1745_01805) (Table 2 ). However, several genes involved in sucrose transportation, especially sugar ABC transporters (B1745_06760, B1745_06745 and B1745_06745), and galactose metabolism (B1745_05485 and B1745_05490) were significantly downregulated in logarithmic phase. Microbes intend to utilize easily metabolizable carbohydrate and inhibit the metabolism of the other carbohydrate...”
- “...3ketoacylCoA thiolase 1.08 B1745_00695 ddl DalanineDalanine ligase A 1.27 B1745_05485 B1745_05490 tagA galactosyltransferase 1.33 1.56 B1745_06760 Malk sugar ABC transporter ATPbinding protein 1.36 B1745_02355 acyP acylphosphatase 1.50 B1745_06765 pgmB betaphosphoglucomutase 1.61 B1745_06730 gpmB hypothetical protein 2.38 B1745_06745 ganQ sugar ABC transporter permease 2.58 B1745_06750 ganP sugar...”
llmg_0446 multiple sugar-binding transport ATP-binding protein from Lactococcus lactis subsp. cremoris MG1363
LLNZ_RS02280 ABC transporter ATP-binding protein from Lactococcus cremoris subsp. cremoris NZ9000
45% identity, 81% coverage
GRI01_08425 ABC transporter ATP-binding protein from Lactobacillus gasseri
45% identity, 85% coverage
XAC2072 sugar ABC transporter ATP-binding protein from Xanthomonas axonopodis pv. citri str. 306
46% identity, 92% coverage
GRH99_04495 ABC transporter ATP-binding protein from Lactobacillus crispatus
43% identity, 90% coverage
VC1552 glycerol-3-phosphate ABC transporter, ATP-binding protein from Vibrio cholerae O1 biovar eltor str. N16961
48% identity, 80% coverage
- Impact of Gene Repression on Biofilm Formation of Vibrio cholerae
Pombo, Frontiers in microbiology 2022 - “...kinase/response regulator 1 VC1446-1448 VC1447 RTX toxin transporter, rtxD 1 VC1492 Hypothetical protein 1 VC1549-1553 VC1552 Glycerol-3-phosphate transporter ATP-binding subunit 1 VC1602-1605 VC1602 Chemotaxis protein, CheV 2 VC1605 Hypothetical protein 2 VC1612 Fimbrial biogenesis and twitching motility protein, type IV pilus assembly protein, PilF 1 VC1620...”
Halsa_1981 ABC transporter ATP-binding protein from Halanaerobium hydrogeniformans
45% identity, 89% coverage
- Going from microbial ecology to genome data and back: studies on a haloalkaliphilic bacterium isolated from Soap Lake, Washington State
Mormile, Frontiers in microbiology 2014 - “...ability to utilize various carbon sources can be inferred by the transporters that it contains. Halsa_1981 was identified as possibly being involved with uptake of glucose/mannose ( MalK ), maltose/maltodextrin ( MalK ), galactose oligomer/maltooligosaccharide ( MsmX ), arabinooligosaccharide ( MsmX ), raffinose/stachyose/melibiose ( MsmK ),...”
- “...( AglK ), cellobiose ( MsiK ), and chitobiose ( MsiK ). In addition to Halsa_1981, other genes are present that could encode for other carbon-intake ABC transporters. A total of 10 putative genes for ABC transporters for ribose/autoinducer 2/ D -xylose, RbsB , RbsC ,...”
SPD_1409 sugar ABC transporter, ATP-binding protein from Streptococcus pneumoniae D39
44% identity, 87% coverage
- A Tn-seq Screen of Streptococcus pneumoniae Uncovers DNA Repair as the Major Pathway for Desiccation Tolerance and Transmission
Matthews, Infection and immunity 2021 (secret) - Integrated Translatomics with Proteomics to Identify Novel Iron-Transporting Proteins in Streptococcus pneumoniae
Yang, Frontiers in microbiology 2016 - “...0.005 0.21 0.000 444 gi|116516896 SPD_0913 Hypothetical protein SPD_0913 0.34 0.008 0.29 0.000 454 gi|116515506 SPD_1409 Sugar ABC transporter, ATP-binding protein 2.24 0.007 2.72 0.000 702 gi|116515427 SPD_1609 ABC transporter, substrate-binding protein 1.83 0.027 8.46 0.000 804 gi|116515596 SPD_1832 PTS system, IIB component 1.67 0.042 15.86...”
- “...five ABC transporters. In particular, up-regulated ABC transporters here included two sugar ABC transporter proteins, SPD_1409, malX, and two putative conserved ABC transporter SBPs, SPD_0090, and SPD_1609. SPD_0090 protein is located immediately adjacent to two predicted permease proteins SPD_0088 and SPD_0089 of the same transport system...”
- Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
Paixão, Frontiers in microbiology 2015 - “...SPD_1047 lacE-2 PTS system, lactose-specific IIBC components 0.78 SPD_1057 PTS system, IIB component, putative 1.48 SPD_1409 Sugar ABC transporter, ATP-binding protein 0.52 SPD_1493 Sugar ABC transporter, permease protein 0.61 SPD_1494 Sugar ABC transporter, permease protein 0.54 SPD_1495 Sugar ABC transporter, sugar-binding protein 0.56 SPD_1496 PTS system,...”
- “...0.63 SPD_1050 lacD tagatose 1,6-diphosphate aldolase 3.00 2.02 SPD_1384 cation efflux family protein 0.58 0.44 SPD_1409 sugar ABC transporter, ATP-binding protein 0.81 0.86 0.52 0.68 SPD_1464 tpx thiol peroxidase 0.80 0.64 0.47 SPD_1634 galK galactokinase 0.64 0.77 3.30 1.69 0.89 SPD_1636 alcohol dehydrogenase, zinc-containing 0.62 0.69...”
- The Small Molecule DAM Inhibitor, Pyrimidinedione, Disrupts Streptococcus pneumoniae Biofilm Growth In Vitro
Yadav, PloS one 2015 - “...activity -1.4 (0.05) SPD_1425 transporter, major facilitator family protein transporter activity transmembrane transport -4.2 (0.03) SPD_1409 sugar ABC transporter, ATP-binding protein hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances -1.4 (0.02) SPD_1820 (secE) preprotein translocase, SecE subunit P-P-bond-hydrolysis-driven protein transmembrane transporter activity protein...”
- Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
Paixão, PloS one 2015 - “...PTS system transporter subunit IIA 6.5 SPD_1834 Bifunctional acetaldehyde-CoA/alcohol dehydrogenase 5.8 SPD_0292 Gluconate 5-dehydrogenase 5.3 SPD_1409 Sugar ABC transporter ATP-binding protein 4.8 SPD_1934 malX Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 4.8 SPD_0297 PTS system transporter subunit IID 4.4 SPD_1496 PTS system transporter subunit IIBC 4.4 SPD_1006 glgC...”
- Role of dihydrolipoamide dehydrogenase in regulation of raffinose transport in Streptococcus pneumoniae
Tyx, Journal of bacteriology 2011 - “...Jose, CA). To verify that the deletion of rafK (SPD_1409) did not produce polar effects on downstream genes, we compared the expression of the downstream gene...”
- “...Streptococcus mutans (18, 19). The gene (open reading frame SPD_1409 in the D39 genome sequence) was found independently located in the genome with a distinct...”
rrnAC2352 sugar ABC transporter ATP-binding protein from Haloarcula marismortui ATCC 43049
44% identity, 83% coverage
- Genome information management and integrated data analysis with HaloLex
Pfeiffer, Archives of microbiology 2008 - “...HQ1359A rrnAC2278 528 600 Shortened NP3368A, HQ2565A, rrnAC0868, OE2992R rrnAC2284 1,038 993 Extended NP5368A, OE2438R rrnAC2352 1,167 1,188 Shortened pNG7026, OE5170F, HQ1989A rrnAC2356 999 1,251 Shortened NP5048A, HQ1275A, OE4196R rrnAC2359 432 180 Extended NP4806A, rrnAC0738, OE3162F, HQ2346A rrnAC2377 1,281 924 Extended NP0578A, OE4634F, HQ3141A rrnAC2440 684...”
BOV_0231 sugar ABC transporter, ATP-binding protein from Brucella ovis ATCC 25840
57% identity, 66% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...ABC BMEII0864 BruAb20797 BRA0404 BOV_A0348 BCAN_B0407 75 OSP Maltose import ABC BMEI1713, malK BruAb10233 BR0238 BOV_0231 BCAN_A0241 OSP Maltose import IM BMEI1714, malG BruAb10231 BR0237 BOV_0230 BCAN_A0240 OSP Maltose import IM BMEI1715, malF BruAb10232 BR0236 BOV_0229 BCAN_A0239 OSP Maltose import BP BMEI1716 BruAb10230 BR0235 BOV_0228 BCAN_A0238...”
SAG1925 sugar ABC transporter, ATP-binding protein from Streptococcus agalactiae 2603V/R
SAK_1884 sugar ABC transporter, ATP-binding protein from Streptococcus agalactiae A909
gbs1912 Unknown from Streptococcus agalactiae NEM316
46% identity, 82% coverage
- Adaptive response of neonatal sepsis-derived Group B Streptococcus to bilirubin
Hansen, Scientific reports 2018 - “...SAG1900 PTS system transporter subunit IIB 1.55 2.67E-04 4.02E-02 SAG0795 Hypothetical protein 2.83 2.73E-04 4.02E-02 SAG1925 Sugar ABC transporter ATP-binding protein 2.02 3.37E-04 4.60E-02 SAG1441 Maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein 2.19 4.69E-04 5.91E-02 SAG1690 PTS system transporter subunit IIABC 2.01 5.22E-04 5.91E-02 SAG2072 Uridine phosphorylase 1.70...”
- Adaptive response of Group B streptococcus to high glucose conditions: new insights on the CovRS regulation network
Di, PloS one 2013 - “...sag1441 to sag1443 ORFs, encoding for the maltose-maltodextrin transport system ( malE-F-G) ; sag0955 and sag1925 ( msmK ) genes, encoding a sugar-ABC transporter and a sugar transport ATP-binding protein, respectively; the ribose ABC transporter region (from sag0114 to sag0117 , namely rbsA-B-C-D ); the cellobiose...”
- A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
Cook, Infection and immunity 2018 - “...sak_1595 sak_1596 sak_1597 sak_1646 sak_1647 sak_1747 sak_1884 sak_1925 sak_1927 sak_1966 sak_2068 sak_2069 Starch and sucrose metabolism sak_1472 sak_0976...”
- Transcriptome adaptation of group B Streptococcus to growth in human amniotic fluid
Sitkiewicz, PloS one 2009 - “...gbs1850 - 2.5 9.9 Transaldolase gbs1893 - 11.6 6.5 2-dehydro-3-deoxygluconokinase gbs1911 dexB 2.9 Glucan 1,6-alpha-glucosidase gbs1912 2.9 Multiple sugar transport ATP-binding protein msmK gbs1914 - 7.3 169.1 Aldose 1-epimerase family protein gbs1915 - 3.3 61.2 2.5 Tagatose-bisphosphate aldolase gbs1916 - 3.1 92.2 Tagatose-6-phosphate kinase gbs1917 -...”
- Extensive adaptive changes occur in the transcriptome of Streptococcus agalactiae (group B streptococcus) in response to incubation with human blood
Mereghetti, PloS one 2008 - “...the maltose-maltodextrin region gbs1507-gbs1508 and gbs1510-gbs1512, gbs1911 ( dexB ) encoding a glucan 1,6-alpha-glucosidase, and gbs1912 ( msmK ) encoding a multiple sugar transport ATP-binding protein. Interestingly, in GAS, homologues of all of these genes are controlled by the same negative regulator (MalR) [27] , which...”
SGO_0352 ABC transporter ATP-binding protein SP1580 from Streptococcus gordonii str. Challis substr. CH1
SGO_RS01740 ABC transporter ATP-binding protein from Streptococcus gordonii str. Challis substr. CH1
44% identity, 88% coverage
- Transcriptional profiling of coaggregation interactions between Streptococcus gordonii and Veillonella parvula by Dual RNA-Seq
Mutha, Scientific reports 2019 - “...2-fold. The cluster also contained SGO_RS03795 (SGO_0773), encoding carbon catabolite protein A ccpA , SGO_RS01740 (SGO_0352), encoding a sugar ABC-type transporter ATP binding protein, and SGO_10300 ( abpA ), encoding an amylase binding protein, which were each down-regulated 1.8- to 1.9-fold in coaggregates. Figure 6 Interacting...”
- Effect of starch and amylase on the expression of amylase-binding protein A in Streptococcus gordonii
Nikitkova, Molecular oral microbiology 2012 - “...represented by annotated genes malD SGO_0102, malC SGO_0103, maltose/maltodextrin-binding protein precursor SGO_0104, and ATP-binding protein SGO_0352. A potential transcriptional regulator for this operon is the upstream positioned transcriptional repressor SGO_0100, which is a LacI/GalR family protein with a sugar-binding domain and a DNA-binding domain. Considering the...”
- Transcriptional profiling of coaggregation interactions between Streptococcus gordonii and Veillonella parvula by Dual RNA-Seq
Mutha, Scientific reports 2019 - “...to 2-fold. The cluster also contained SGO_RS03795 (SGO_0773), encoding carbon catabolite protein A ccpA , SGO_RS01740 (SGO_0352), encoding a sugar ABC-type transporter ATP binding protein, and SGO_10300 ( abpA ), encoding an amylase binding protein, which were each down-regulated 1.8- to 1.9-fold in coaggregates. Figure 6...”
MED193_11308 sugar ABC transporter, ATP-binding protein from Roseobacter sp. MED193
A3XC79 Sugar ABC transporter, ATP-binding protein from Roseobacter sp. MED193
46% identity, 86% coverage
- Bacterial catabolism of membrane phospholipids links marine biogeochemical cycles
Westermann, Science advances 2023 - “...MED193_11293 A3XC84 Sugar ABC transporter, periplasmic substrate binding protein ++ 4.03 0.47 ++ 3.27 0.01 MED193_11308 A3XC79 Sugar ABC transporter, ATPase ++ 5.47 0.02 N/D N/D MED193_11419 A3XFL5 PotA Spermidine/putrescine transporter, ATPase ++ 2.64 0.07 0.29 0.01 MED193_11424 A3XFK5 PotD Spermidine/putrescine transporter, periplasmic substrate binding protein...”
- Bacterial catabolism of membrane phospholipids links marine biogeochemical cycles
Westermann, Science advances 2023 - “...A3XC84 Sugar ABC transporter, periplasmic substrate binding protein ++ 4.03 0.47 ++ 3.27 0.01 MED193_11308 A3XC79 Sugar ABC transporter, ATPase ++ 5.47 0.02 N/D N/D MED193_11419 A3XFL5 PotA Spermidine/putrescine transporter, ATPase ++ 2.64 0.07 0.29 0.01 MED193_11424 A3XFK5 PotD Spermidine/putrescine transporter, periplasmic substrate binding protein ++...”
CAC3237 Multiple sugar-binding ABC-transporter, MSMX ATP-binding protein from Clostridium acetobutylicum ATCC 824
42% identity, 89% coverage
- A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
Janssen, Applied microbiology and biotechnology 2010 - “...9.5 5.4 5.2 3.1 C CAC3236 Transcriptional regulator 2.7 2.1 13.2 8.5 6.6 5.3 T,Q CAC3237 msmX Sugar ABC transporter, ATP binding protein 2.5 2.2 10.9 8.1 5.9 4.3 G CAC3379 Hypothetical protein 3.6 3.5 5.6 6.3 4.7 1.4 S CA_P0036 Uncharacterized, ortholog of YgaT gene...”
- “...at pH5.7, e.g., a putative ATP binding protein involved in sugar transport ( msmX , CAC3237) and the genes cac0427 , cac0428 , and cac0429 of a glycerol-3-phosphate ABC transporter system which are organized in a common operon together with glycerophosphoryl diester phosphodiesterase ( cac0430 ;...”
M5005_Spy_1682 multiple sugar transport ATP-binding protein from Streptococcus pyogenes MGAS5005
47% identity, 82% coverage
GRH99_01765 ABC transporter ATP-binding protein from Lactobacillus crispatus
58% identity, 65% coverage
Q8NMV1 ABC-type maltose transporter (EC 7.5.2.1) from Corynebacterium glutamicum (see paper)
TC 3.A.1.1.45 / Q8NMV1 ABC-type sugar transport system, ATPase component, component of Maltose transporter, MusEFGKI from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
cg2708 ABC-type sugar transport system, ATPase component from Corynebacterium glutamicum ATCC 13032
52% identity, 72% coverage
- substrates: Maltose
tcdb comment: All five genes have been reported to be essential for uptake activity (Henrich et al. 2013). The MusI gene product is of 215 aas with 5 TMSs and comprises the founding member of a distinct family of poorly characterized protein in TC family 9.B.28 - Maltose uptake by the novel ABC transport system MusEFGK2I causes increased expression of ptsG in Corynebacterium glutamicum
Henrich, Journal of bacteriology 2013 - “...system as an ABC transporter encoded by musK (cg2708; ATPase subunit), musE (cg2705; substrate binding protein), musF (cg2704; permease), and musG (cg2703;...”
- “...mutant of C. glutamicum WT In-frame deletion of genes cg2708 to cg2703 of C. glutamicum WT C. glutamicum WT with insertion of pDrive in cg2708 C. glutamicum...”
- Comprehensive analysis of the Corynebacterium glutamicum transcriptome using an improved RNAseq technique
Pfeifer-Sancar, BMC genomics 2013 - “...observed 2,292,509 2,292,267 cg2402 msiK RNA motif RF01747 2,582,375 2,582,317 52.13 - observed 2,582,404 2,582,315 cg2708 (msiK1) yybP-ykoY leader RF00080 2,649,004 2,648,890 49.90 - not observed - - - a Name, ID, coordinates, and bit score of predicted regulatory 5-UTRs for C. glutamicum were taken from...”
- Elastase digests: new ammunition for shotgun membrane proteomics
Rietschel, Molecular & cellular proteomics : MCP 2009 - “...Cg2925 Cg2404 Cg1366 Cg3138 16 27 21 Cg2780 17 18 27 26 19 13 Cg2403 Cg2708 19 20 21 22 23 24 25 26 25 23 22 22 22 19 18 18 12 0 1 5 1 2 6 5 Cg2875 Cg1332...”
all1823 sugar ABC transportor, ATP-binding protein from Nostoc sp. PCC 7120
46% identity, 89% coverage
- Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
Stebegg, Journal of bacteriology 2012 - “...of PCC 7120, 16 genes (all0261, all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367,...”
RHE_RS28085 ABC transporter ATP-binding protein from Rhizobium etli CFN 42
44% identity, 90% coverage
- Rhizobium etli CFN42 proteomes showed isoenzymes in free-living and symbiosis with a different transcriptional regulation inferred from a transcriptional regulatory network
Taboada-Castro, Frontiers in microbiology 2022 - “...RHE_RS26890 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS28085 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS29410 msmX, msmK, malK, sugC, ggtA, msiK; multiple sugar transport system ATP-binding protein K10112 MM RHE_RS12565...”
- “...multiple sugar transport system ATP-binding protein, in MM represented by RHE_RS12565, RHE_RS18950, RHE_RS22575, RHE_RS23370, RHE_RS26890, RHE_RS28085, RHE_RS29410 were found, while the RHE_RS24520, RHE_RS24950 and RHE_RS28400 were identified in bacteroid ( Table 1 ). For the lacK ; lactose/L-arabinose transport system ATP-binding protein, sn-glycerol-3-phosphate ABC transporter, the...”
TK1775 ABC-type maltdextrin transport system, ATPase component from Thermococcus kodakaraensis KOD1
57% identity, 65% coverage
LBA1439 ABC transporter nucleotide binding protein from Lactobacillus acidophilus NCFM
57% identity, 65% coverage
cgR_2369 hypothetical protein from Corynebacterium glutamicum R
51% identity, 72% coverage
BCAL3038 ABC transporter ATP-binding component from Burkholderia cenocepacia J2315
55% identity, 67% coverage
- The Small RNA ncS35 Regulates Growth in Burkholderia cenocepacia J2315
Kiekens, mSphere 2018 - “...2.4 3.0 Sugar ABC transport system BCAL1550 2.3 Sugar ABC transport system BCAL1661 2.0 Ribokinase BCAL3038 2.0 ABC-type glycerol-3-phosphate transport BCAL3039 2.0 ABC-type glycerol-3-phosphate transport Ornibactin biosynthesis BCAL1696 2.3 Ornibactin biosynthesis protein BCAL1697 2.8 Ornibactin biosynthesis protein BCAL1698 2.5 Ornibactin biosynthesis protein Respiration BCAL2141 13.4 3.5...”
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...1.5 BCAL1754 Major facilitator superfamily protein, carbohydrate transport 3.5 BCAL2040 Polysaccharide deacetylase, carbohydrate transport 1.5 BCAL3038 ABC transporter ATP-binding component, carbohydrate ABC transporter 1.6 BCAL3039 ABC transporter, membrane permease 1.5 BCAL3040 ABC transporter, membrane permease 1.7 BCAL3041 MalE, maltose-binding protein 2.1 BCAL3364 Putative gluconokinase 1.7 BCAM0094...”
- “...exported protein 1.52 BCAL3024 Putative exported protein 1.57 BCAL3033 Probable outer membrane lipoproteins carrier 1.53 BCAL3038 ABC transporter ATP-binding component 1.61 BCAL3039 ABC transporter, membrane permease 1.54 BCAL3040 ABC transporter, membrane permease 1.71 BCAL3041 Maltose-binding protein 2.09 BCAL3163 Putative nucleotidyltransferase 1.68 BCAL3203 Putative periplasmic TolB protein...”
PF1744 trehalose/maltose transport ATP-hydrolyzing from Pyrococcus furiosus DSM 3638
44% identity, 88% coverage
- Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
Noll, BMC evolutionary biology 2008 - “...starch [ 10 , 11 ]. In P. furiosus , the mal operon (PF1739-1741 and PF1744) encodes MalE Pf , a protein that binds maltose and trehalose, but it does not appear to function as its major maltose transporter [ 10 - 13 ]. The orthologous...”
- Disruption of a sugar transporter gene cluster in a hyperthermophilic archaeon using a host-marker system based on antibiotic resistance
Matsumi, Journal of bacteriology 2007 - “...sugar transporters present in Pyrococcus furiosus (Mal-I, PF1739 to PF1744, and Mal-II, PF1933 to PF1938) (33), only one putative gene cluster is found on the...”
- Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
Chou, Applied and environmental microbiology 2007 - “...Membrane protein, DUF835 Mal I operon PF1739 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 1.6 NC NC 1.7 1.8 1.6 NC NC NC 1.9 NC 2.1 NC...”
- Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
Lee, Journal of bacteriology 2006 - “...protein (Mal-I) PF1740 PF1741 PF1742 PF1743 PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose transport (Mal-I) Maltose/trehalose transport (Mal-I)...”
- “...coli. One is the Mal-I transporter (PF1739 to PF1741, PF1744), which in P. furiosus has been shown to recognize and transport maltose and trehalose but not...”
- Metabolic and evolutionary relationships among Pyrococcus Species: genetic exchange within a hydrothermal vent environment
Hamilton-Brehm, Journal of bacteriology 2005 - “...and malK, represented by PF1739 to PF1741 and PF1744, respectively), as well as a trehalose-degrading enzyme (PF1742) (1, 32, 36, 37, 44, 66). Interestingly,...”
- “...PF0798 PF1337 PF1339 PF1340 PF1737 PF1738 PF1339 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 PF1750 PF1751 * * * * * * * * * * * * *...”
- Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus
Koning, Archaea (Vancouver, B.C.) 2002 - “...1, Figure 1). One of the clusters (PF1739-PF1741, PF1744) is identical (99-100% amino acid sequence identity) to the trehalose/maltose transport operon found in...”
- “...Escherichia coli MalE PF1938 PF1937 PF1936 PF1933 PF1739 PF1740 PF1741 PF1744 1 2 Identity. Similarity. 1 MalF MalG MalK 2 28 (46) 35 (56) 33 (55) 47 (63) 28...”
Gocc_1613 ABC transporter ATP-binding protein from Gaiella occulta
47% identity, 91% coverage
Cthe_1862 ABC transporter related protein from Clostridium thermocellum ATCC 27405
Clo1313_2554, Cthe_1862 ABC transporter ATP-binding protein from Acetivibrio thermocellus DSM 1313
46% identity, 89% coverage
- Deciphering Cellodextrin and Glucose Uptake in Clostridium thermocellum
Yan, mBio 2022 - “...we noticed that one potential sugar-transporter ATPase gene, clo1313_2554 in C. thermocellum DSM 1313 ( cthe_1862 in C. thermocellum ATCC 27405), was highly expressed together with transporter A and B genes. We therefore suspected that Clo1313_2554 represents the ATPase subunit of transporter B. Therefore, we deleted...”
- Filling gaps in bacterial catabolic pathways with computation and high-throughput genetics
Price, PLoS genetics 2022 - “...to transport several different substrates or are ambiguous about substrates transported (for instance, the gene Cthe_1862 for Clostridium thermocellum which is annotated as multiple sugar transport system ATP-binding protein). Is it permissive (e.g., assuming such a system could transport anything marked as a sugar) or strict...”
- Specialized activities and expression differences for Clostridium thermocellum biofilm and planktonic cells
Dumitrache, Scientific reports 2017 - “...in the KEGG database indicating a more promiscuous transport function. A sixth ABC transporter gene, Cthe_1862, containing the conserved ATPase domain of the maltose transporter MalK was highly expressed in biofilm cells. Our findings suggest that CbpA, CbpB and Cthe_1862 are the only highly expressed sugar...”
- Integrated omics analyses reveal the details of metabolic adaptation of Clostridium thermocellum to lignocellulose-derived growth inhibitors released during the deconstruction of switchgrass
Poudel, Biotechnology for biofuels 2017 - “...during cellulose hydrolysis [ 43 ]. Out of seven detected cellodextrin ABC transporter components, three (Cthe_1862, Cthe_1020, and Cthe_1019) were classified into cluster 4, whereas Cthe_0393 was a member of cluster 3. This suggests the majority of proteins required for the cellodextrin uptake remain relatively constant,...”
- Comparison of transcriptional profiles of Clostridium thermocellum grown on cellobiose and pretreated yellow poplar using RNA-Seq
Wei, Frontiers in microbiology 2014 - “...et al., 2011 ; Riederer et al., 2011 ). Previously, six cellodextrin ABC transporter genes (Cthe_1862, Cthe_0391-0393, and 1019-1020, including CbpA and CbpB) were found to be expressed at high levels throughout the course of Avicel alone fermentation (Raman et al., 2011 ). Most recently, Cthe_0391-0393...”
- Proteomic analysis of Clostridium thermocellum core metabolism: relative protein expression profiles and growth phase-dependent changes in protein expression
Rydzak, BMC microbiology 2012 - “...transporters [ 68 ]. Of the five encoded cello-oligosaccharide ABC transporters, only Cthe_0391-0393, Cthe_1018-1020, and Cthe_1862 were detected in significant amounts, consistent with mRNA expression levels reported by Raman et al. [ 37 ]. While the RAI was low for membrane spanning domains of these transporters,...”
- A blue native-PAGE analysis of membrane protein complexes in Clostridium thermocellum
Peng, BMC microbiology 2011 - “...synthase 33392 469 25 57 20 Cthe_1104 125713844 prepilin-type cleavage/methylation 19233.2 183 21 65 21 Cthe_1862 125974366 ABC transporter related protein 42056.4 317 31 38 22 Cthe_1754 125714483 solute-binding protein 35734.5 143 19 48 1 23 Cthe_2709 125975191 hypothetical protein 55140 95 14 19 24 Cthe_1020...”
- “...C11 16 Cthe_1020 solute-binding protein 190 18 Cthe_1018 binding-protein-dependent transport systems inner membrane component 21 Cthe_1862 ABC transporter related protein C12 17 Cthe_1557 ABC transporter related protein ATP-binding protein 140 C13 22 Cthe_1754 solute-binding protein 170 C14 12 Cthe_2348 S-layer-like region; Ig-related 140 C15 20 Cthe_1104...”
- Deciphering Cellodextrin and Glucose Uptake in Clostridium thermocellum
Yan, mBio 2022 - “...as the major cellodextrin transporter, we further identified its cryptic, hitherto unknown ATPase-encoding gene as clo1313_2554 , which is located outside the transporter B gene cluster. The crystal structure of the ATPase was solved, showing that it represents a typical nucleotide-binding domain of the ATP-binding cassette...”
- “...and proteomic studies ( 39 44 ), we noticed that one potential sugar-transporter ATPase gene, clo1313_2554 in C. thermocellum DSM 1313 ( cthe_1862 in C. thermocellum ATCC 27405), was highly expressed together with transporter A and B genes. We therefore suspected that Clo1313_2554 represents the ATPase...”
LBA1867 multiple sugar-binding ABC transport system from Lactobacillus acidophilus NCFM
56% identity, 66% coverage
BSQ49_10590 ABC transporter ATP-binding protein from Liquorilactobacillus hordei
44% identity, 89% coverage
Ccel_2909 ABC transporter related from Clostridium cellulolyticum H10
Ccel_2909 ABC transporter ATP-binding protein from Ruminiclostridium cellulolyticum H10
42% identity, 89% coverage
SSA_1007 ABC transporter ATP-binding protein-multiple sugar transport, putative from Streptococcus sanguinis SK36
43% identity, 87% coverage
AT5A_24035 ABC transporter ATP-binding protein from Agrobacterium tumefaciens 5A
45% identity, 88% coverage
- Introducing the ArsR-Regulated Arsenic Stimulon
Rawle, Frontiers in microbiology 2021 - “...Sugar ABC transporter substrate-binding protein 2.4 AT5A_24025 Sugar ABC transporter substrate-binding protein 2.3 2.6 2.2 AT5A_24035 Sugar ABC transporter nucleotide ATPase 2.0 2.6 2.2 AT5A_24045 Sugar ABC transporter permease 2.0 2.9 2.1 AT5A_24050 Sugar ABC transporter permease 2.40 Gray highlighted data identifies genes uniquely affected in...”
Rfer_1094 ABC transporter related from Rhodoferax ferrireducens DSM 15236
45% identity, 93% coverage
SMc04256 ABC transporter for D-Cellobiose and D-Salicin, ATPase component from Sinorhizobium meliloti 1021
44% identity, 89% coverage
- mutant phenotype: Specific phenotype on D-Salicin; D-Cellobiose.
HVO_B0227 ABC-type transport system ATP-binding protein (probable substrate sugar) from Haloferax volcanii DS2
43% identity, 88% coverage
MALK_THELN / Q9YGA6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see 5 papers)
44% identity, 88% coverage
- function: Part of the ABC transporter complex MalEFGK involved in trehalose/maltose import. Responsible for energy coupling to the transport system.
catalytic activity: D-maltose(out) + ATP + H2O = D-maltose(in) + ADP + phosphate + H(+) (RHEA:22132)
subunit: Homodimer. The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE). - Sugar alcohol degradation in Archaea: uptake and degradation of mannitol and sorbitol in Haloarcula hispanica
Ortjohann, Extremophiles : life under extreme conditions 2024 - “...prediction (AF-G0I055-F1-model_v4). UniProt accession: MscK, G0I055; MtlK, O30494; XacJ, D4GP38; XacK, D4GP39; RhcJ, D4GPB1; Tl-MalK, Q9YGA6; P68187 Mannitol and sorbitol are oxidized to fructose via two distinct dehydrogenases The msc cluster contains two genes, mscS (HAH_5138) and mscM (HAH_5147) , that encode putative dehydrogenases. The functional...”
MGAS10750_Spy1776 Multiple sugar transport ATP-binding protein msmK from Streptococcus pyogenes MGAS10750
47% identity, 82% coverage
1vciA / O57758 Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
45% identity, 93% coverage
- Ligand: adenosine-5'-triphosphate (1vciA)
TTC0611 No description from Thermus thermophilus HB27
45% identity, 94% coverage
lpg1729 sn-glycerol-3-phosphate transport, ATP binding protein from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
45% identity, 84% coverage
Gocc_2323 ABC transporter ATP-binding protein from Gaiella occulta
47% identity, 73% coverage
DIP0539 Putative sugar ABC transport syste ATP-binding protein from Corynebacterium diphtheriae NCTC 13129
50% identity, 76% coverage
- Transcriptome sequencing of the human pathogen Corynebacterium diphtheriae NCTC 13129 provides detailed insights into its transcriptional landscape and into DtxR-mediated transcriptional regulation
Wittchen, BMC genomics 2018 - “...60.0 + observed c 922,838 922,969 DIP0951 msiK RF01747 509,334 509,277 48.2 observed 509,334 509,277 DIP0539 TPP riboswitch RF00059 27,456 27,566 57.6 + not observed a n.a. n.a. n.a. a No TSS detected and insufficient read coverage in that area b Motif of the mraW region...”
- Prediction of DtxR regulon: identification of binding sites and operons controlled by Diphtheria toxin repressor in Corynebacterium diphtheriae
Yellaboina, BMC microbiology 2004 - “...nonribosomal peptide synthase 3.99985 -74 TTTTCTTTGCCTAGCCTAA irp6A DIP0108** Ferrisiderophore receptor Irp6A 3.99195 -241 TTAGGCACCCCTAACCTAG - DIP0539 Putative sugar ABC transport syste ATP-binding protein 3.98554 -72 TTAGCTTAGCCCTAGCTAA - DIP0169 Putative secreted protein 3.9296 -26 CTAGGATTGCCTACACTTA Irp5 DIP0894** Conserved hypothetical protein 3.9073 -93 GTTGGGTTGCCCAACCTAC - DIP2106 Putative ABC...”
- “...COG2021 Homoserine acetyltransferase DIP0624 - - Putative membrane protein DIP0415 - Pfam01022 Bacterial regulatory protein DIP0539 - COG3839 ABC-type sugar transport systems DIP0168 - - Putative glycosyl transferase DIP0417 - - Putative membrane protein DIP0142 - - Hypothetical protein DIP0143 - - - DIP0144 tra8 COG2826...”
OKIT_0712 ABC transporter ATP-binding protein from Oenococcus kitaharae DSM 17330
44% identity, 89% coverage
1g291 / Q9YGA6 Malk (see paper)
57% identity, 65% coverage
- Ligands: magnesium ion; pyrophosphate 2- (1g291)
ML1424 probable binding-protein-dependent transport protein from Mycobacterium leprae TN
48% identity, 86% coverage
TC 3.A.1.1.28 / Q00752 MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides from Streptococcus mutans (see 2 papers)
SMU_882, SMU_RS04100 ABC transporter ATP-binding protein from Streptococcus mutans UA159
44% identity, 82% coverage
HFX_5025 ABC transporter ATP-binding protein from Haloferax mediterranei ATCC 33500
44% identity, 87% coverage
- Halophilic archaea and their potential to generate renewable fuels and chemicals
Kasirajan, Biotechnology and bioengineering 2021 - “...grow on colloidal or powdered chitin and accumulate poly(3-hydroxybutyrate-co-3-hydroxyvalerate)(PHBV). The researchers identified the gene cluster (HFX_5025 to HVO_5039) responsible for the pathway of chitin catabolism. Addition of colloidal or powdered chitin induced the expression of four putative chitinases (ChiAHme, ChiBHme, ChiCHme, and ChiDHme, HFX_50365039), the LmbE-like...”
- Characterization of genes for chitin catabolism in Haloferax mediterranei
Hou, Applied microbiology and biotechnology 2014 (PubMed)- “...(HFX_5036-5039), a putative ABC transport system (HFX_5025, HFX_5030-5032), a glycosidase (HFX_5029), and an LmbE-like deacetylase (HFX_5027), which might...”
HSERO_RS17020 ABC transporter for D-sorbitol/xylitol, ATPase component from Herbaspirillum seropedicae SmR1
47% identity, 80% coverage
- mutant phenotype: Specifically important for utilization of D-sorbitol and xylitol.
2awnC / P68187 Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
48% identity, 90% coverage
- Ligand: adenosine-5'-diphosphate (2awnC)
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory