PaperBLAST

PaperBLAST Hits for reanno::Smeli:SMc03062 ABC transporter for D-maltose/D-trehalose/sucrose, permease component 1 (AglF) (Sinorhizobium meliloti 1021) (336 a.a., MEQLIAAILT...)

Show query sequence

>reanno::Smeli:SMc03062 ABC transporter for D-maltose/D-trehalose/sucrose, permease component 1 (AglF) (Sinorhizobium meliloti 1021)
MEQLIAAILTMVAGVLVCAAYFWSTNLVLDWIFPSKGKFGAVASRNLRIANSIRPWLFLA
PALLALTLYLVYPVVQSVWLSLHGRGGQNFVGLSNYSWMINDGEFRQSIFNNFLWLLVVP
ALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKFIYDYRAAGSEQIGLLN
AIVVALGGEPQAWITLPFWNNFFLMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGA
NGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNGQWQSQVLANLMFDWMFRG
GGDFGRGAAIAVVIMILVVPIMIWNIRNATRESGGH

Running BLASTp...

Found 251 similar proteins in the literature:

SMc03062 ABC transporter for D-maltose/D-trehalose/sucrose, permease component 1 (AglF) from Sinorhizobium meliloti 1021
TC 3.A.1.1.8 / Q9Z3R6 AglF aka R00696 aka SMC03062, component of Sucrose/maltose/trehalose porter (sucrose-inducible) from Rhizobium meliloti (Sinorhizobium meliloti) (see 2 papers)
100% identity, 100% coverage

• mutant phenotype: Specific phenotype on D-Maltose monohydrate; D-Trehalose dihydrate. Also mildly important for D-cellobiose utilization, which has its own ABC transporter, so the cause is unclear. Also reported to transport sucrose (PMID:10400573, PMID:12003938)
• substrates: Maltose, Sucrose, Trehalose

RSP_2872 ABC alpha-glucoside transporter, inner membrane subunit AglF from Rhodobacter sphaeroides 2.4.1
71% identity, 99% coverage

• A cluster of four homologous small RNAs modulates C1 metabolism and the pyruvate dehydrogenase complex in Rhodobacter sphaeroides under various stress conditions
  Billenkamp, Journal of bacteriology 2015
  • “...biosynthesis protein PqqB 1,19 RSP_1195 (comF) 21.7 RSP_2749 21.5 RSP_2872 (aglF) 21.4 20.17 2 RSP_2870, 4 RSP_2871, 3 RSP_2873, 1 RSP_0573 (phoB) 21.2 19.86 5...”

Atu0592 ABC transporter, membrane spanning protein from Agrobacterium tumefaciens str. C58 (Cereon)
73% identity, 91% coverage

• Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
  Jin, Biomolecules 2022
  • “...( ssuA = atu1884 ), mannopine ( attC = atu5129 ), alpha-glucoside ( aglF = atu0592 , aglG = atu0593 , aglK = atu0595 ), and dipeptide ( dppA = atu4113 ) were all down-regulated during the whole process of co-cultivation in the tea groups (...”

Dshi_1651 glucose/maltose/trehalose/sucrose ABC transporter, permease component 1 from Dinoroseobacter shibae DFL-12
61% identity, 99% coverage

• mutant phenotype: Related to alpha-glucoside transporter component aglF. Specifically important for utilization of D-glucose, D-maltose, D-trehalose, and sucrose.

GGTC_SYNY3 / Q55472 Osmoprotective compounds uptake permease protein GgtC from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) (see paper)
TC 3.A.1.1.32 / Q55472 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) from Synechocystis sp. (strain PCC 6803) (see paper)
slr0530 membrane bound sugar transport protein from Synechocystis sp. PCC 6803
54% identity, 81% coverage

• function: Part of the ABC transporter complex GgtABCD involved in the uptake of the osmoprotective compounds glucosylglycerol (GG), sucrose and trehalose (PubMed:11081796). Responsible for the translocation of the substrate across the membrane (Probable).
  subunit: The complex is composed of two ATP-binding proteins (GgtA), two transmembrane proteins (GgtC and GgtD) and a solute-binding protein (GgtB).
  disruption phenotype: Inactivation of the gene results in loss of the ability to take up glucosylglycerol and sucrose, as well as to accumulate exogenous trehalose. Insertion causes leakage of glucosylglycerol from the cells into the medium.
• substrates: Glucosylglycerol
• Identification of the key functional genes in salt-stress tolerance of Cyanobacterium Phormidium tenue using in silico analysis
  Shahbazi, 3 Biotech 2021
  • “...protein, slr1384 hypothetical protein, slr0613 ggtC, slr0530 probable RNA methyltransferase, sll1967 ribF, slr1882 hypothetical protein, slr1827 ycf85, slr0251...”
• Integrative analysis of the salt stress response in cyanobacteria
  Klähn, Biology direct 2021
  • “...Among the 19 salt-induced genes, whose proteins were not identified in our study, only the slr0530 gene product as component of the GG transporter is functionally related to known processes in salt acclimation. The good correlation of transcriptomic and proteomic changes extends to the alterations on...”
• RNA-seq Profiling Reveals Novel Target Genes of LexA in the Cyanobacterium Synechocystis sp. PCC 6803
  Kizawa, Frontiers in microbiology 2016
  • “...215.11 5.97 slr0529 ggtB Glucosylglycerol transport system substrate-binding protein 17.28 79.09 4.58 18.76 76.80 4.09 slr0530 ggtC Glucosylglycerol transport system permease protein 21.55 102.21 4.74 23.34 88.37 3.79 HYDROGENASE sll1220 hoxE Diaphorase subunit of the bidirectional hydrogenase 100.28 48.94 0.49 62.85 32.54 0.52 sll1221 hoxF Diaphorase...”
• Computational prediction of the osmoregulation network in Synechococcus sp. WH8102
  Mao, BMC genomics 2010
  • “...SpsA Sucrose synthetase slr1312 SpeA Arginine synthetase slr0662 SpeA slr0747 GgtA Glucosylglycerol/trehalose/sucrose slr0529 GgtB transporter slr0530 GgtC slr0531 GgtD sll1546 GgpS Glucosylglycerol synthetases slr0746 GgpP sll0306 RpoD RNA polymerase, Sigma 70 (sigma D) factor A. halo has three genes encoding a Na + /H + antiporter...”
  • “...GgpS SYNW1281 SYNW1279-1286 0.99 PCC6803 slr0746 GgpP SYNW0860 PCC6803 slr0747 GgtA SYNW1285 SYNW1279-1286 0.99 PCC6803 slr0530 GgtC SYNW1283 SYNW1279-1286 0.99 PCC6803 slr0531 GgtD SYNW1284 SYNW1279-1286 0.99 PCC6803 ABX75857 GpgS SYNW2436 P.marina ABX75858 GpgP SYNW2434 P.marina slr0662 SpeA SYNW2359 0.99 PCC6803 sll0045 Sps SYNW2520 0.69 PCC6803 b0855...”
• A novel Sinorhizobium meliloti operon encodes an alpha-glucosidase and a periplasmic-binding-protein-dependent transport system for alpha-glucosides
  Willis, Journal of bacteriology 1999
  • “...oligo-1,6-glucosidase (65) Synechocystis Slr0531 (35, 37) Synechocystis Slr0530 (35, 37) Synechocystis Slr0529 (35, 37) Escherichia coli RafR (4) Pseudomonas...”
  • “...also implies that the uncharacterized Synechocystis proteins Slr0529, Slr0530, and Slr0531 are involved in sugar transport. Sucrose and trehalose are known to...”

RLO149_c015780 carbohydrate ABC transporter permease from Roseobacter litoralis Och 149
32% identity, 83% coverage

• Comparative genome analysis and genome-guided physiological analysis of Roseobacter litoralis
  Kalhoefer, BMC genomics 2011
  • “...chain dehydrogenase RLO149_c015760 RafA: alpha-galactosidase (EC 3.2.1.22) RLO149_c015770 putative galactoside ABC transporter inner membrane component RLO149_c015780 putative galactoside ABC transporter inner membrane component RLO149_c015790 putative extracellular galactoside-binding protein RLO149_c015800 HTH-type transcriptional regulator, IclR family RLO149_c015810 putative galactoside ABC transporter ATP-binding protein Cluster 2 RLO149_c021930 putative HTH-type...”

TC 3.A.1.1.4 / P29823 LacF, component of Lactose porter from Agrobacterium radiobacter (see paper)
31% identity, 83% coverage

• substrates: Lactose

SCO1057 sugar transport integral membrane protein from Streptomyces coelicolor A3(2)
28% identity, 90% coverage

• Evidence of a role for CutRS and actinorhodin in the secretion stress response in Streptomyces coelicolor M145
  McLean, Microbiology (Reading, England) 2023
  • “...a benzoisochromanequinone homodimer, actinorhodin has the potential to act as an alternate electron acceptor for SCO1057 [ 26 ]. It is interesting to note that Lejeune et al . have proposed that the quinones in actinorhodin can capture excess electrons from reactive oxygen and nitrogen species...”

PF1740 trehalose/maltose transport inner membrane protein from Pyrococcus furiosus DSM 3638
29% identity, 83% coverage

• Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
  Chou, Applied and environmental microbiology 2007
  • “...binding module Membrane protein, DUF835 Mal I operon PF1739 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 1.6 NC NC 1.7 1.8 1.6 NC NC...”
• Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
  Lee, Journal of bacteriology 2006
  • “...Maltodextrin phosphorylase Maltose/trehalose-binding protein (Mal-I) PF1740 PF1741 PF1742 PF1743 PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose...”
• Metabolic and evolutionary relationships among Pyrococcus Species: genetic exchange within a hydrothermal vent environment
  Hamilton-Brehm, Journal of bacteriology 2005
  • “...PF0796 PF0797 PF0798 PF1337 PF1339 PF1340 PF1737 PF1738 PF1339 PF1740 PF1741 PF1742 PF1743 PF1744 PF1745 PF1746 PF1747 PF1748 PF1749 PF1750 PF1751 * * * * * *...”
• Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
  Schut, Journal of bacteriology 2003
  • “...PF1709 PF1710 PF1711 PF1713 PF1739 [Maltose transport] PF1740 PF1741 PF1742 PF1784 PF1852 PF1870 [Maltose transport] PF1935 PF1936 PF1937 PF1938 PF1951 PF1975...”
• Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus
  Koning, Archaea (Vancouver, B.C.) 2002
  • “...furiosus Escherichia coli MalE PF1938 PF1937 PF1936 PF1933 PF1739 PF1740 PF1741 PF1744 1 2 Identity. Similarity. 1 MalF MalG MalK 2 28 (46) 35 (56) 33 (55)...”

B9H01_RS00985, BFP66_RS00850 carbohydrate ABC transporter permease from Streptococcus suis
32% identity, 67% coverage

• A novel aquaporin Aagp contributes to Streptococcus suis H₂O₂ efflux and virulence
  Zhu, Virulence 2023
  • “...BFP66_RS00790 2.16 type I glyceraldehyde-3-phosphatedehydrogenase; BFP66_RS00845 2.35 sugar ABC transporter substrate-binding protein; sugar ABC transporters BFP66_RS00850 2.22 sugar ABC transporter permease; BFP66_RS02995 8.65 sugar ABC transporter permease; BFP66_RS07040 15.41 sugar ABC transporter permease; BFP66_RS07045 10.83 sugar ABC transporter substrate-binding protein; BFP66_RS08960 2.20 sugar ABC transporter substrate-binding...”
• Screening for Virulence-Related Genes via a Transposon Mutant Library of Streptococcus suis Serotype 2 Using a Galleria mellonella Larvae Infection Model
  Fan, Microorganisms 2022
  • “...protein 2/6; 2/6; 3/6 Tn1673 B9H01_RS04375 MULTISPECIES: ABC transporter ATP-binding protein 1/6; 3/6; 3/6 Tn1 B9H01_RS00985 Sugar ABC transporter permease 0/6; 2/6; 4/6 Others Tn1862 B9H01_RS01125 Formate C-acetyltransferase (PFL) 0/6; 0/6; 0/6 Tn509 B9H01_RS05230 Peptidase 1/6; 2/6; 2/6 Tn513 B9H01_RS05380 SAM-dependent methyltransferase 0/6; 1/6; 2/6 Tn1712...”

MALF_THELN / O51924 Trehalose/maltose transport system permease protein MalF from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see 3 papers)
29% identity, 80% coverage

• function: Part of the ABC transporter complex MalEFGK involved in trehalose/maltose import. Responsible for the translocation of the substrate across the membrane.
  subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE).

Ccel_2111 binding-protein-dependent transport systems inner membrane component from Clostridium cellulolyticum H10
Ccel_2111 carbohydrate ABC transporter permease from Ruminiclostridium cellulolyticum H10
30% identity, 71% coverage

• Internal Transcription Terminators Control Stoichiometry of ABC Transporters in Cellulolytic Clostridia
  Wu, Microbiology spectrum 2022
  • “...cluster harbors an SBP gene (Ccel_2112) at the 5 end, followed by two TMD genes (Ccel_2111 and Ccel_2110), and has a 106-bp long intergenic region between Ccel_2112 and Ccel_2111. Ccel_2112, encoding SBPs, was transcribed at significantly higher levels than its downstream genes ( Fig.3A ). Northern...”
  • “...an operon, and the transcripts of Ccel_2112-2110 were terminated at the 3 ends of Ccel_2112, Ccel_2111, and Ccel_2110. Subsequently, three stem-loop structures were predicted at the 3 ends of Ccel_2112, Ccel_2111, and Ccel_2110 ( Fig.3D ), suggesting that they potentially terminate the transcription of the cluster...”

Rv2040c Probable sugar-transport integral membrane protein ABC transporter from Mycobacterium tuberculosis H37Rv
MT2100 sugar ABC transporter, permease protein from Mycobacterium tuberculosis CDC1551
30% identity, 82% coverage

• Identification of positively selected genes in Mycobacterium tuberculosis from southern Xinjiang Uygur autonomous region of China
  Deng, Frontiers in microbiology 2024
  • “...transcriptional regulator M1a_M2a katG a , b Rv1908c 62 56 5 11 Catalase-peroxidase M1a_M2a M7_M8 Rv2040c Rv2040c 7 5 1 1 Sugar ABC transporter permease M7_M8 pncA a , b Rv2043c 33 25 6 2 Pyrazinamidase/nicotinamidase PncA M1a_M2a M7_M8 pks12 a Rv2048c 148 86 62 14...”
• Prolonged survival of a patient with active MDR-TB HIV co-morbidity: insights from a Mycobacterium tuberculosis strain with a unique genomic deletion
  Rubinstein, Frontiers in medicine 2023
  • “...severely affected the pathogens proliferation inside the host. Two of the deleted genes, Rv2028 and Rv2040c, have been previously identified in a comprehensive screen for genes that are important for in-host survival ( 48 ). acg has also been shown to be an essential virulence factor,...”
• Comparison of carbohydrate ABC importers from Mycobacterium tuberculosis
  De, BMC genomics 2021
  • “...Group 1 was formed by SugB, Rv2039c, UspB, and UgpE and group 2 by SugA, Rv2040c, UspA, and UgpA. Putative orthologs of SugAB permeases formed a separated group from the three other systems, as shown in SugC NBD group (Fig. 2 A). According to the alignments,...”
  • “...member of each transporter. Group 1: SugB, Rv2039c, UspB, and UgpE, and Group 2: SugA, Rv2040c, UspA, and UgpA. Dark gray: M. tuberculosis complex group (MTBC), light gray: other pathogenic mycobacteria, and white: environmental species, represented by M. smegmatis. The amino acid sequences of TTH_RS04960 and...”
• Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
  Lin, Infection and immunity 2016
  • “...Rv1877 Rv1922 Rv1946c Rv1964 Rv1979c Rv1986 Rv2037c Rv2040c Rv2041c Rv2273 Rv2281 Rv2398c Rv2400c Rv2522c Rv2835c MT3080 MT3951 Rv3000 Rv3843c MT0691 MT0699...”
• Anti-mycobacterial activity of marine fungus-derived 4-deoxybostrycin and nigrosporin
  Wang, Molecules (Basel, Switzerland) 2013
  • “...0.07 Metabolism: Carbohydrate transport and metabolism Rv2471 - 1.83 0.12 Metabolism: Carbohydrate transport and metabolism Rv2040c - 2.11 0.19 Metabolism: Carbohydrate transport and metabolism panB Rv2225 0.52 0.03 Metabolism: Coenzyme metabolism Rv1335 - 1.66 0.04 Metabolism: Coenzyme metabolism nadA Rv1594 1.73 0.09 Metabolism: Coenzyme metabolism cobU...”
  • “...1.243 1.01 0.964 0.739 0.933 0.961 Rv0282 Rv3673c Rv3132c cobU narL rplT cysA rplQ fadD32 Rv2040c Rv1354c Rv1200 1.989 9.219 0.742 0.919 0.937 0.728 0.805 0.807 1 0.817 0.801 0.924 Rv3044 Rv1372 Rv1257c htpX pgk ctaC infB rpsD ogt Rv2264c Rv0907 Rv1335 15.46 0.59 1.023 0.846...”
• Reprogramming the Mycobacterium tuberculosis transcriptome during pathogenesis
  Waddell, Drug discovery today. Disease mechanisms 2010
  • “...[ 2 ]. By contrast, the predicted carbohydrate transporters of unknown specificity ( sugI , Rv2040c and Rv2041c ) were induced on macrophage infection [ 2 , 3 ], highlighting that the acquisition (or export) of carbohydrate moieties may still be important for successful infection. Genes...”
• Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
  Lin, Infection and immunity 2016
  • “...MT1642 MT1926 MT1973 MT1997 MT2016 MT2031 MT2040 MT2097 MT2100 MT2101 MT2334 MT2339 MT2469 MT2471 MT2598 MT2901 Rv1607 Rv1877 Rv1922 Rv1946c Rv1964 Rv1979c...”

SM_b21653 ABC transporter for Lactose, permease component 1 from Sinorhizobium meliloti 1021
SMb21653 probable lactose uptake ABC transporter permease protein from Sinorhizobium meliloti 1021
29% identity, 82% coverage

• mutant phenotype: Specific phenotypes on Beta-Lactose. Not important for arabinose utilization but there is no other clear arabinose tranpsorter so who knows
• Members of the Sinorhizobium meliloti ChvI regulon identified by a DNA binding screen
  Bélanger, BMC microbiology 2013
  • “...transporter) F14 143 3412878 3413020 inter SMc03297 pSymB F15 184 1266 1449 inter & intra SMb21653 ( lacF ) lactose ABC transporter, permease component F16 148 43628 43775 inter SMb20032 F17 150 132970 133119 inter SMb20119 putative site-specific recombinase F18 97 221089 221185 intra SMb20213 (upstream...”

Blon_2369 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
27% identity, 82% coverage

• Comparative Pangenomics of the Mammalian Gut Commensal Bifidobacterium longum
  Albert, Microorganisms 2019
  • “...membrane transport proteins (Blon_2331 and Blon_2332) to terminate with a carbohydrate ABC transporter membrane protein (Blon_2369), with carbohydrate-related enzymes and transporter components interspersed between [ 15 ]. The HMO utilization gene cluster was first identified in B. longum subspecies infantis ATCC15697 T and subsequently determined to...”

TC 3.A.1.1.25 / Q72H67 Maltose transport system permease protein malF aka TT_C1628, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) (see paper)
TTC1628 No description from Thermus thermophilus HB27
30% identity, 73% coverage

• substrates: Maltose, Palatinose, Sucrose, Trehalose
  tcdb comment: The structures have been solved to a resolution range of 1.6-2.0 Å (Chandravanshi et al. 2019). D
• The high-affinity maltose/trehalose ABC transporter in the extremely thermophilic bacterium Thermus thermophilus HB27 also recognizes sucrose and palatinose
  Silva, Journal of bacteriology 2005
  • “...E. coli 429 291 280 398 442 439 TTC1627 TTC1628 TTC1629 TTC1288 TTC1287 TTC1286 50/36 60/41 47/34 40/26 48/28 49/31 38/22 56/27 36/27 47/31 55/36 57/41 MalEs...”

NH13_08155 carbohydrate ABC transporter permease from Lactobacillus acidophilus
27% identity, 85% coverage

• Draft Genome Sequence of the Probiotic Strain Lactobacillus acidophilus ATCC 4356
  Palomino, Genome announcements 2015
  • “...components (NH13_02050), as well as the N -acetyl- d -glucosamine ABC transport system, permease protein (NH13_08155). Mechanisms of the enzymes degrading N -acetylglucosamine ( 15 ) are predicted: NagB, GlcN6P deaminase (NH13_09645) and NagA, GlcNAc6P deacetylase (NH13_00815). A transcriptional regulator of N -acetylglucosamine utilization (NH13_02010) from...”

H9Q64_10120 carbohydrate ABC transporter permease from Enterococcus faecalis
EF2233 ABC transporter, permease protein from Enterococcus faecalis V583
28% identity, 87% coverage

• Genetically distant bacteriophages select for unique genomic changes in Enterococcus faecalis
  Johnson, MicrobiologyOpen 2022
  • “...control protein A Tyr94Asn 33 2912438 manX ManX Asn77Lys 43 1858079 Intergenic region Upstream of H9Q64_10120 NA 37 1081166 H9Q64_06285 Phage Infection Protein (PIP) Ser36 * 96 2 2576939, 2576930 H9Q64_13860 Restriction endonuclease subunit S Asn157Asp, Thr160Ala 47, 56 2573891, 2573901 H9Q64_13845 Restriction endonuclease subunit S...”
• Influence of the Alternative Sigma Factor RpoN on Global Gene Expression and Carbon Catabolism in Enterococcus faecalis V583
  Keffeler, mBio 2021
  • “...6 EF2237-32 EF2232 ABC transporter, permease protein 4.20 35 21 ATTAAAG CG CTTTCT 0.997 6 EF2233 ABC transporter, permease protein 8.46 35 21 ATTAAAG CG CTTTCT 0.972 5 EF2234 Sugar ABC transporter, sugar binding protein; putative 17.24 35 21 ATTAAAG CG CTTTCT 1.000 1 EF2237 Lipoprotein...”

Tsac_0150 carbohydrate ABC transporter permease from Thermoanaerobacterium saccharolyticum JW/SL-YS485
28% identity, 82% coverage

• Dynamic cell responses in Thermoanaerobacterium sp. under hyperosmotic stress
  Zhu, Scientific reports 2017
  • “...6.4941.230 Tsac_1295 Galactokinase 2.38E-03 7.989 2.7800.085 Tsac_1296 UDP-glucose 4-epimerase 1.51E-02 5.780 3.0610.270 ko02010: ABC transporters Tsac_0150 ABC-type transporter, integral membrane subunit 1.07E-02 7.972 1.4500.283 Tsac_0151 Extracellular solute-binding protein family 1 2.38E-03 8.140 1.6680.139 Tsac_2231 Extracellular ligand-binding receptor 6.67E-03 8.017 1.3040.023 ko00250: Alanine, aspartate and glutamate metabolism...”

PH1215 sugar-binding transport system permease protein from Pyrococcus horikoshii OT3
31% identity, 82% coverage

• Glucose transport in the extremely thermoacidophilic Sulfolobus solfataricus involves a high-affinity membrane-integrated binding protein
  Albers, Journal of bacteriology 1999
  • “...ORFs are located in the same transcription direction, PH1215 (accession no. G3915506) and PH1216 (accession no. G3915506) (Fig. 6). These two ORFs code for...”
  • “...several ATP-binding proteins (Fig. 7). Furthermore, ORF34 and PH1215 (28% identity, 51% similarity), and ORF35 and PH1216 (24% identity, 54% similarity) are...”

MAP1768c hypothetical protein from Mycobacterium avium subsp. paratuberculosis str. k10
30% identity, 79% coverage

• Genomic variations associated with attenuation in Mycobacterium avium subsp. paratuberculosis vaccine strains
  Bull, BMC microbiology 2013
  • “...MAP1765c rssA Patatin like esterase Fatty acid Metabolism MAP1766c Cellobiose ABC transporter MAP1767c ABC transporter MAP1768c ABC transporter MAP1769c Transcriptional regulator MAP1770c Sigma-70 factor MAP1771c IS 900 MAP1772 Unknown MAP1773c Nuclear transport factor 2 Steroid metabolism MAP1774c pncA Isochorismatase Nicotinamide metabolism MAP1775 doxX Unknown MAP1776c Nucleotide...”

pRL120007 putative permease component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
30% identity, 85% coverage

• Lifestyle adaptations of Rhizobium from rhizosphere to symbiosis
  Wheatley, Proceedings of the National Academy of Sciences of the United States of America 2020 (secret)

ACPL_3200 carbohydrate ABC transporter permease from Actinoplanes sp. SE50/110
28% identity, 83% coverage

• Reconstruction and in silico analysis of an Actinoplanes sp. SE50/110 genome-scale metabolic model for acarbose production
  Wang, Frontiers in microbiology 2015
  • “...acarbose in Actinoplanes sp. SE50/110 . The genes mal EFG in the pathway were ACPL_6402, ACPL_3200, ACPL_4618, ACPL_5585, ACPL_6401, ACPL_6726, ACPL_3782, ACPL_5386, and ACPL_6400. Figure 6 Chemical structure for acarbose . The essential genes for acarbose production were studied in acarbose synthesis medium. One hundred and...”

TC 3.A.1.1.41 / G4FGN7 ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
30% identity, 81% coverage

• substrates: Trehalose

SGO_0121 ABC transporter permease protein SP1689 from Streptococcus gordonii str. Challis substr. CH1
28% identity, 83% coverage

• Effect of starch and amylase on the expression of amylase-binding protein A in Streptococcus gordonii
  Nikitkova, Molecular oral microbiology 2012
  • “...msmF SGO_1304, and msmG SGO_1303 with transcriptional regulator msmR SGO_1306; another Msm-like ABC transporter SGO_0120, SGO_0121, SGO_0122 with each gene having up to 54% amino acid identity with Msm proteins of S. mutans and closely positioned on the chromosome phosphosugar-binding transcriptional regulator SGO_0127; and yet another...”

Balac_0515 putative binding protein-dependent transporter from Bifidobacterium animalis subsp. lactis Bl-04
28% identity, 81% coverage

• Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
  Andersen, BMC genomics 2013
  • “...Xylobiose D 3.0 10.1 Balac_0514 ABC transporter, oligosaccharide-binding protein xyloside A,C XOS D 9.0 16.0 Balac_0515 ABC transporter, permease component xyloside A,C XOS D 16.8 16.5 Balac_0516 ABC transporter, permease component xyloside A,C XOS D 18.3 17.5 Balac_0517 -xylosidase, GH43 xyloside A,C XOS D 17.9 16.1...”

MT2901 sugar ABC transporter, permease protein from Mycobacterium tuberculosis CDC1551
Rv2835c PROBABLE Sn-GLYCEROL-3-PHOSPHATE TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER UGPA from Mycobacterium tuberculosis H37Rv
27% identity, 81% coverage

• Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
  Lin, Infection and immunity 2016
  • “...MT2097 MT2100 MT2101 MT2334 MT2339 MT2469 MT2471 MT2598 MT2901 Rv1607 Rv1877 Rv1922 Rv1946c Rv1964 Rv1979c Rv1986 Rv2037c Rv2040c Rv2041c Rv2273 Rv2281 Rv2398c...”
• Identification of outer membrane proteins of Mycobacterium tuberculosis
  Song, Tuberculosis (Edinburgh, Scotland) 2008
  • “...proteins such as the sugar permease UgpA (Rv2835c, MT2901), the efflux protein EfpA (Rv2846c, MT2912) and the ammonium transporter AmtB (Rv2920c, MT2988) and...”
• Microsatellite polymorphism across the M. tuberculosis and M. bovis genomes: implications on genome evolution and plasticity
  Sreenu, BMC genomics 2006
  • “...family protein Rv2566 (1140) MT2642 (1156) Mb2595 (533), Mb2596 (597) T4 3 ugpA *Rv2835c (303) MT2901 (303) Mb2859c (180), Mb2860c (123) C2 3 fadE22 *Rv3061c (721) MT3147 (721) Mb3087c (600), Mb3088c (114) C4 3 mesT *Rv3176c (318) MT3265 (339) Mb3201c (105), Mb3202c (208) C4 3 Cyp142...”
• ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
  Soni, Emerging microbes & infections 2020
  • “...Rv0073 Experimentally not characterized. Sugar importers Glycerophosphocholine importer (UgpABCE /Rv2832c-Rv2835c) SBP: UgpB (Rv2833c) TMD: UgpA (Rv2835c) and UgpE (Rv2834c) NBD: UgpC (Rv2832c) (two copies) UgpB is a substrate of the twin-arginine translocation (Tat) pathway [ 39 ] Import glycerophosphocholine instead of sn-glycerol-3-phosphate and maltose [ 39...”
• Regulation of the CRISPR-Associated Genes by Rv2837c (CnpB) via an Orn-Like Activity in Tuberculosis Complex Mycobacteria
  Zhang, Journal of bacteriology 2018
  • “...2018 by University of California, Berkeley Rv1955 Rv2835c Rv3862c Rv2450c Rv2816c Rv0341 Rv2836c Rv2817c Mobile element protein Isoniazid inducible protein IniA...”
• Transcriptional Profiling of Mycobacterium tuberculosis Exposed to In Vitro Lysosomal Stress
  Lin, Infection and immunity 2016
  • “...Rv2040c Rv2041c Rv2273 Rv2281 Rv2398c Rv2400c Rv2522c Rv2835c MT3080 MT3951 Rv3000 Rv3843c MT0691 MT0699 MT1338 MT1463 MT1589 MT2042 MT2247 MT2488 MT2535...”
• From Corynebacterium glutamicum to Mycobacterium tuberculosis--towards transfers of gene regulatory networks and integrated data analyses with MycoRegNet
  Krawczyk, Nucleic acids research 2009
  • “...( glnA1 ) Rv2832c ( ugpC ), Rv2833c ( ugpB ), Rv2834c ( ugpE ), Rv2835c ( ugpA ), Rv2918c ( glnD ) Rv2919c ( glnB ), Rv2920c ( amt ), Rv3859c ( gltB ) SOS and stress response Rv0867c ( rpfA ), Rv3048c ( nrdF2...”
  • “...( phoH2 ) Rv2832c ( ugpC ), Rv2833c ( ugpB ), Rv2834c ( ugpE ), Rv2835c ( ugpA ) Rv0827c Macroelement and metal homeostasis Rv0827c (-) Rv1994c Macroelement and metal homeostasis Rv1994c (-) IdeR Carbohydrate metabolism Rv0247c (-), Rv3318 ( sdhA ) Macroelement and metal homeostasis...”
• Identification of outer membrane proteins of Mycobacterium tuberculosis
  Song, Tuberculosis (Edinburgh, Scotland) 2008
  • “...membrane proteins such as the sugar permease UgpA (Rv2835c, MT2901), the efflux protein EfpA (Rv2846c, MT2912) and the ammonium transporter AmtB (Rv2920c,...”

BL0189 sugar permease of ABC transporter system from Bifidobacterium longum NCC2705
29% identity, 85% coverage

• The Pleiotropic Effects of Carbohydrate-Mediated Growth Rate Modifications in Bifidobacterium longum NCC 2705
  Duboux, Microorganisms 2023
  • “...substantially larger number of functions, including the relatively high-level induction of carbohydrate transporters (ABC ( BL0189 ) and an MFS transport system ( BL0165 ), upregulated 3.0 and 3.5 fold, respectively) that we propose to be involved in galactose import. Furthermore, functions related to the catabolism...”

TC 3.A.1.1.16 / Q8TZP9 MalF, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) from Pyrococcus furiosus
PF1937 putative sugar transport inner membrane protein (malf-like) from Pyrococcus furiosus DSM 3638
23% identity, 83% coverage

• substrates: Maltooligosaccharides
• Impact of substrate glycoside linkage and elemental sulfur on bioenergetics of and hydrogen production by the hyperthermophilic archaeon Pyrococcus furiosus
  Chou, Applied and environmental microbiology 2007
  • “...Putative sulfate transport, permease Mal II operon PF1933 PF1934 PF1935 PF1936 PF1937 PF1938 PF1939 3.9 8.3 8.4 8.1 NC 9.1 NC NC NC NC NC 2.1 NC NC NC 1.9 2.2...”
• Transcriptional and biochemical analysis of starch metabolism in the hyperthermophilic archaeon Pyrococcus furiosus
  Lee, Journal of bacteriology 2006
  • “...maltose, white; soluble starch, solid black. The expression of PF1937 in the Mal-II cluster is not included. PF1934 and PF1935 refer to the genes in the...”
  • “...PF1743 PF1744 PF1933 PF1935*d PF1936 PF1937 PF1938 Maltose/trehalose transport (Mal-I) Maltose/trehalose transport (Mal-I) Trehalose synthetase...”
• Whole-genome DNA microarray analysis of a hyperthermophile and an archaeon: Pyrococcus furiosus grown on carbohydrates or peptides
  Schut, Journal of bacteriology 2003
  • “...PF1742 PF1784 PF1852 PF1870 [Maltose transport] PF1935 PF1936 PF1937 PF1938 PF1951 PF1975 Mean intensity ratio (log SD)b Descriptiona 3940 SCHUT ET AL. fivefold...”
• Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus
  Koning, Archaea (Vancouver, B.C.) 2002
  • “...transporter clusters. Pyrococcus furiosus Escherichia coli MalE PF1938 PF1937 PF1936 PF1933 PF1739 PF1740 PF1741 PF1744 1 2 Identity. Similarity. 1 MalF MalG...”

Pden_1089 binding-protein-dependent transport systems inner membrane component from Paracoccus denitrificans PD1222
30% identity, 83% coverage

• Genome-Wide Discovery of Putative sRNAs in Paracoccus denitrificans Expressed under Nitrous Oxide Emitting Conditions
  Gaimster, Frontiers in microbiology 2016
  • “...1922 2763 3999 Pden_4936 FAD dependent oxidoreductase Intergenic 149 1574733 1574818 85 + 1204 1403 Pden_1089 binding-protein-dependent transport system inner membrane protein Antisense 11 85367 85457 90 + 548 149 351 Pden_1370 hypothetical protein A Strand + positive DNA strand; - negative DNA strand; B Reads...”

Bbr_1859 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
29% identity, 82% coverage

• Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
  Bottacini, Scientific reports 2018
  • “...Bbr_1858 Permease protein of ABC transporter system for sugars PF00528 OConnell et al . 23 Bbr_1859 Permease protein of ABC transporter system for sugars PF00528 OConnell et al . 23 Bbr_1860 Solute binding protein of ABC transporter system for sugars X PF01547 OConnell et al ....”
• Transcription of two adjacent carbohydrate utilization gene clusters in Bifidobacterium breve UCC2003 is controlled by LacI- and repressor open reading frame kinase (ROK)-type regulators
  O'Connell, Applied and environmental microbiology 2014
  • “...of California, Berkeley Bbr_1862 Bbr_1861 Bbr_1860 Bbr_1859 Bbr_1858 Bbr_1857 Bbr_1856 Regulation of Bifidobacterial Carbohydrate Metabolism growth on 1%...”
• Metabolism of four α-glycosidic linkage-containing oligosaccharides by Bifidobacterium breve UCC2003
  O'Connell, Applied and environmental microbiology 2013
  • “...Bbr_0030 Bbr_0100 Bbr_1855 Bbr_1856 Bbr_1857 Bbr_1858 Bbr_1859 Bbr_1860 Bbr_1865 Bbr_1866 Bbr_1867 Bbr_1868 Bbr_1869 Gene name Function Stachyose Raffinose...”

SPD_1501 ABC transporter, permease protein from Streptococcus pneumoniae D39
28% identity, 83% coverage

• Deletion of the Zinc Transporter Lipoprotein AdcAII Causes Hyperencapsulation of Streptococcus pneumoniae Associated with Distinct Alleles of the Type I Restriction-Modification System
  Durmort, mBio 2020
  • “...protein 1.56 1.61 1.17 SPD_1455 Hypothetical protein 1.84 3.29 1.25 SPD_1498 Oxidoreductase 2.21 2.23 1.34 SPD_1501 Sugar ABC transporter permease 3.73 3.58 1.42 SPD_1503 Hypothetical protein 3.25 4.03 1.09 SPD_1513 Hypothetical protein 1.77 2.68 1.40 SPD_1568 GTP cyclohydrolase 1.80 1.55 1.53 SPD_1584 ABC transporter permease 2.30...”

AT5A_09940 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
28% identity, 82% coverage

• Introducing the ArsR-Regulated Arsenic Stimulon
  Rawle, Frontiers in microbiology 2021
  • “...nucleotide-binding 2.4 AT5A_03260 Sugar ABC transporter ATPase 2.6 AT5A_09935 Sugar ABC transporter substrate-binding protein 2.6 AT5A_09940 Sugar ABC transporter transmembrane protein 2.3 AT5A_09945 Sugar ABC transporter transmembrane protein 2.1 AT5A_09950 Sugar ABC transporter nucleotide-binding ATPase 2.2 AT5A_18906 Maltose ABC transporter transmembrane protein 2.4 AT5A_18911 Maltose ABC...”

SP_1689 carbohydrate ABC transporter permease from Streptococcus pneumoniae TIGR4
28% identity, 83% coverage

• Multi-omic profiling to assess the effect of iron starvation in Streptococcus pneumoniae TIGR4
  Jiménez-Munguía, PeerJ 2018
  • “...Downregulated 38765 SP_1465, SP_1466 2/2 Downregulated 38778 SP_1522, SP_1523 2/7 Downregulated 38815 SP_1686, SP_1687, SP_1688, SP_1689 4/4 Downregulated 38822 SP_1724, SP_1725 2/2 Downregulated 38840 SP_1809, SP_1810 2/2 Downregulated 38867 SP_1920, SP_1922 2/3 Downregulated 38868 SP_1923, SP_1924, SP_1925, SP_1926 4/4 Downregulated 38873 SP_1948, SP_1949 2/2 Downregulated 38874...”

GRD61_RS02140 carbohydrate ABC transporter permease from Clavibacter michiganensis subsp. michiganensis
31% identity, 69% coverage

• Comparative Genomics of Pathogenic Clavibacter michiganensis subsp. michiganensis Strains from Chile Reveals Potential Virulence Features for Tomato Plants
  Méndez, Microorganisms 2020
  • “...present in strain VL527, genes encoding a peptidase (GRD61_RS13055), three carbohydrate ABC transporter permeases (GRD61_RS02135, GRD61_RS02140 and GRD61_RS02145), two LacI family transcriptional regulator (GRD61_RS00220 and GRD61_RS02125), and 21 hypothetical proteins were detected and identified. MSF322 possesses exclusively genes encoding two hydrolases (GRD74_RS03640 and GRD74_RS08035), two peptidases...”

TC 3.A.1.1.7 / O51924 MalF, component of Maltose/trehalose porter from Thermococcus litoralis (see paper)
29% identity, 80% coverage

• substrates: Maltose, Trehalose

alr0789 ABC transporter sugar permease from Nostoc sp. PCC 7120
29% identity, 79% coverage

• Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
  Stebegg, Journal of bacteriology 2012
  • “...all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and alr5368) are currently...”

CAC0427 Glycerol-3-phosphate ABC-transporter, permease component from Clostridium acetobutylicum ATCC 824
24% identity, 82% coverage

• A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
  Janssen, Applied microbiology and biotechnology 2010
  • “...7.3 5.3 4.4 2.3 S CAC0412 TPR-repeat-containing protein 2.0 1.7 5.5 3.9 3.3 1.8 R CAC0427 Glycerol-3-phosphate ABC transporter, permease component 3.1 3.1 5.7 2.9 3.7 1.3 G CAC0428 Sugar permease 4.2 2.7 11.2 3.5 5.4 3.9 G CAC0429 Glycerol-3-phosphate ABC transporter, periplasmic component 4.6 3.3...”
  • “...putative ATP binding protein involved in sugar transport ( msmX , CAC3237) and the genes cac0427 , cac0428 , and cac0429 of a glycerol-3-phosphate ABC transporter system which are organized in a common operon together with glycerophosphoryl diester phosphodiesterase ( cac0430 ; Karp et al. 2005...”

PM1761 unknown from Pasteurella multocida subsp. multocida str. Pm70
28% identity, 79% coverage

• Screening of Streptococcus pneumoniae ABC transporter mutants demonstrates that LivJHMGF, a branched-chain amino acid ABC transporter, is necessary for disease pathogenesis
  Basavanna, Infection and immunity 2009
  • “...SsuiDRAFT_0077 Spy1227 SAK_1051 Spy0928 PM1760 PM1761 PM1762 SsuiDRAFT_0524 SsuiDRAFT_0525 SsuiDRAFT_0526 Lxx14070 STH2752 Lxx14040 RUMOBE_00498 Cthe_1604...”

HVO_0531 ABC-type transport system permease protein (probable substrate sugar) from Haloferax volcanii DS2
29% identity, 66% coverage

• TroR is the primary regulator of the iron homeostasis transcription network in the halophilic archaeon Haloferax volcanii
  Martinez, Nucleic acids research 2024
  • “...corresponding peak was located in a positiondiscordant with the direction of transcription. The peak neighboring hvo_0531 was removed, as proteins binding this region are known to cross-react with the HA epitope ( 45 ). SirR ChIP-seq peaks were subjected to additional filtering steps due to technical...”

BRA0305 sugar ABC transporter, permease protein from Brucella suis 1330
BCAN_B0306 binding-protein-dependent transport systems inner membrane component from Brucella canis ATCC 23365
26% identity, 84% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...OSP Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine betaine/L-proline import ABC BMEI0439, proV BruAb11568 BR1581 BOV_1526 BCAN_A1616 OTCN Glycine...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine betaine/L-proline import ABC BMEI0439, proV BruAb11568 BR1581 BOV_1526 BCAN_A1616 OTCN Glycine betaine/L-proline import...”

Hlac_2863 binding-protein-dependent transport systems inner membrane component from Halorubrum lacusprofundi ATCC 49239
28% identity, 67% coverage

• Cloning, overexpression, purification, and characterization of a polyextremophilic β-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi
  Karan, BMC biotechnology 2013
  • “...family transposases; Hlac_2860, 2-keto-3-deoxy-6-phosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; Hlac_2861, IclR family transcriptional regulator; Hlac_2862, sugar-binding periplasmid protein; Hlac_2863, ABC-type sugar transport system permease component; Hlac_2864, sugar permease; Hlac_2865, ABC-type sugar transport system; ATPase component; Hlac_2866, L-alanine-DL-glutamate epimerase and related enzymes of enolase; Hlac_2867, short-chain dehydrogenase/reductase SDR; Hlac_2868, -galactosidase;...”

TC 3.A.1.1.19 / Q8L125 PalF, component of Platinose (isomaltulose) (6-O-α-D-glucopyranosyl-D-fructofuranose) porter from Agrobacterium tumefaciens (see 3 papers)
25% identity, 86% coverage

• substrates: Palatinose

BOV_A0280 sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
26% identity, 84% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...Maltose import IM BMEII0942 BruAb20875 BRA0306 BOV_A0281 BCAN_B0307 OSP Maltose import IM BMEII0943 BruAb20876 BRA0305 BOV_A0280 BCAN_B0306 OSP Maltose import BP BMEII0944 BOV_A0279 OSP Maltose import BP BMEII0945 BruAb20877 BRA0304 BCAN_B0305 82 OTCN Glycine betaine/L-proline import ABC BMEI0439, proV BruAb11568 BR1581 BOV_1526 BCAN_A1616 OTCN Glycine betaine/L-proline...”

Blon_0884 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
31% identity, 73% coverage

• Human Milk Oligosaccharide Utilization in Intestinal Bifidobacteria Is Governed by Global Transcriptional Regulator NagR
  Arzamasov, mSystems 2022
  • “...N -Acetylglucosamine-6-phosphate deacetylase EC 3.5.1.25 Blon_0883 gltF LNB/GNB ABC transporter substrate-binding protein TC 3.A.1.1 39 Blon_0884 gltG LNB/GNB ABC transporter permease protein 1 TC 3.A.1.1 Blon_0885 gltH LNB/GNB ABC transporter permease protein 2 TC 3.A.1.1 Blon_2171 lnpD UDP-hexose 4-epimerase EC 5.1.3.2 59 Blon_2172 lnpC UTP-hexose-1-phosphate uridylyltransferase...”
• Inefficient Metabolism of the Human Milk Oligosaccharides Lacto-N-tetraose and Lacto-N-neotetraose Shifts Bifidobacterium longum subsp. infantis Physiology
  Özcan, Frontiers in nutrition 2018
  • “...). Interestingly, both LNT and LNnT induced the F1SBP Blon_0883, although its adjacent permease proteins Blon_0884 and Blon_0885 were not induced ( p > 0.05). Main effect analysis via two-way ANOVA indicates that Blon_2347 exhibits the strongest induction among the four F1SBP genes regardless of substrate...”
• Exposure of Bifidobacterium longum subsp. infantis to Milk Oligosaccharides Increases Adhesion to Epithelial Cells and Induces a Substantial Transcriptional Response
  Kavanaugh, PloS one 2013
  • “...1.38 0.0300 1.36 0.0300 1.69 0.0030 Blon_0790 Proteinase inhibitor 1.25 0.0500 1.28 0.0300 1.46 0.0040 Blon_0884 Extracellular solute binding protein 1.31 0.0200 1.29 0.0300 1.47 0.0500 Blon_0885 Binding protein dependent sugar transport inner membrane protein 1.25 0.0200 1.40 0.0020 1.50 0.0000 Blon_2174 Hypothetical protein 1.40 0.0200...”

pRL120557 putative transmembrane permease transporter component from Rhizobium leguminosarum bv. viciae 3841
28% identity, 78% coverage

• Lifestyle adaptations of Rhizobium from rhizosphere to symbiosis
  Wheatley, Proceedings of the National Academy of Sciences of the United States of America 2020 (secret)

C289_1911 ABC transporter permease subunit from Anoxybacillus ayderensis
29% identity, 55% coverage

• A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
  Kahar, International journal of molecular sciences 2013
  • “...(C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National Center for Biotechnology Information (NCBI) Bioproject with accession no. PRJNA174378. 2.2. Analysis of...”

BAD_RS02260 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
26% identity, 82% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...sequence Tm Length (bp) BAD_RS02255 Sugar ABC transporter substratebinding protein F:AGGAAGGTGCTTTGATGGG 57.2 116 R:GGCGTATTTCTCCTGATTTGA 57.2 BAD_RS02260 Sugar ABC transporter permease F:CTTCGTGCCGTATGTCGTTT 58.7 246 R:TGGCTGCTTCATACAGTTCC 57.9 BAD_RS00875 Phosphoenolpyruvateprotein phosphotransferase F:TGTTCCGTACCGAATTCCTGT 59.5 117 R:TGCGGATCACGACCTTCTT 58.5 BAD_RS01940 PTS betaglucoside transporter subunit EIIBCA F:ACGCTCGGCTACGACTTCAT 59.9 200 R:AGCTTGTACCGCAGGTGGAT 58.5 BAD_RS06365 Betaglucosidase...”
  • “...transporter substratebinding protein 30.52 6.05 BAD_RS02265 2.38 yurM Thiamine ABC transporter ATPbinding protein 2,679.25 514.59 BAD_RS02260 2.34 malF Sugar ABC transporter permease 2,356.22 466 BAD_RS00385 2.28 livF ABCtype branchedchain amino acid transport systems ATPase component 25.2 5.2 BAD_RS08210 1.99 amyD Permease of ABC transporter possibly for...”

BAD_RS08210 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
31% identity, 84% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...2,356.22 466 BAD_RS00385 2.28 livF ABCtype branchedchain amino acid transport systems ATPase component 25.2 5.2 BAD_RS08210 1.99 amyD Permease of ABC transporter possibly for oligosaccharides 3,704.78 933.34 BAD_RS00805 1.95 yurO Solutebinding protein of ABC transporter system 2,384.03 618.73 BAD_RS08205 1.88 amyC Sugar ABC transporter permease 2,223.03...”

AT5A_24050 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
29% identity, 84% coverage

• Introducing the ArsR-Regulated Arsenic Stimulon
  Rawle, Frontiers in microbiology 2021
  • “...ABC transporter nucleotide ATPase 2.0 2.6 2.2 AT5A_24045 Sugar ABC transporter permease 2.0 2.9 2.1 AT5A_24050 Sugar ABC transporter permease 2.40 Gray highlighted data identifies genes uniquely affected in the respective arsR mutant and presumed to be controlled directly or indirectly by only that ArsR. Under...”

PD1465 ABC transporter sugar permease from Xylella fastidiosa Temecula1
26% identity, 84% coverage

• Xylella fastidiosa: Host Range and Advance in Molecular Identification Techniques
  Baldi, Frontiers in plant science 2017
  • “...e PD1840 CCAAACATAGAAGCACGCCG CGTATGTCTGTGCGGTGTG Siroheme synthase leuA e PD1047 GGCCAGTGCTGTGTTTTGTT GGGCTACTTGCTGGAGGAAG 2-Isopropylmalate synthase lacF e PD1465 TTCTTTGGTGGGTTGGGTGT CACACAGCATCAACGTCGTC ABC transporter sugar permease a Schuenzel et al. ( 2005 ) . b Almeida et al. ( 2008 ) . c Yuan et al. ( 2010 ) ....”

HVO_B0229 ABC-type transport system permease protein (probable substrate sugar) from Haloferax volcanii DS2
28% identity, 79% coverage

• D-xylose degradation pathway in the halophilic archaeon Haloferax volcanii
  Johnsen, The Journal of biological chemistry 2009
  • “...ABC transporter substrate-binding protein, putative HVO_B0229, putative integral membrane-binding protein-dependent transport protein HVO_B0230, sugar ABC...”

ARAP_BACSU / P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see 3 papers)
TC 3.A.1.1.34 / P94529 L-arabinose transport system permease protein AraP, component of The arabinosaccharide transporter AraNPQMsmX. Transports α-1,5-arabinooligosaccharides, at least up to four L-arabinosyl units; the key transporter for α-1,5-arabinotriose and α-1,5-arabinotetraose, but not for α-1,5-arabinobiose which is transported by AraE. MsmX is also used by the MdxEFG-MsmX system (3.A.1.1.36) (Ferreira and Sá-Nogueira, 2010). Involved in the uptake of pectin oligosaccharides with either MsmX or YurJ as the ATPase from Bacillus subtilis (see 4 papers)
araP / GB|CAB14834.1 L-arabinose transport system permease protein AraP from Bacillus subtilis (see 4 papers)
27% identity, 79% coverage

• function: Part of the ABC transporter complex AraNPQ involved in the uptake of arabinooligosaccharides. Transports alpha-1,5- arabinooligosaccharides, at least up to four L-arabinosyl units (PubMed:20693325). Responsible for the translocation of the substrate across the membrane (Probable).
  subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (AraP and AraQ) and a solute-binding protein (AraN).
• substrates: Arabinosides
• CharProtDB Part of the binding-protein-dependent transport system for L-arabinose. Probably responsible for the translocation of the substrate across the membrane. Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily. Contains 1 ABC transmembrane type-1 domain
• The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
  Ferreira, PloS one 2017
  • “...Residues selected for deletion in the C-terminal end of AraQ are boxed. Accession numbers: AraP (P94529), AraQ (P94530), MdxF (O06990), MdxG (O06991), GanP (O32261), GanQ (O07011), OpuAB (P46921), MalF (P02916), and MalG (P68183). 10.1371/journal.pone.0189483.t008 Table 8 Effect of mutations in AraP and AraQ in the uptake...”

SM_b20326 ABC transporter for D-trehalose/D-maltose/sucrose, permease component 1 (ThuF) from Sinorhizobium meliloti 1021
TC 3.A.1.1.17 / Q9R9Q6 ThuF aka RB0312 aka SMB20326, component of Trehalose/maltose/sucrose porter (trehalose inducible) from Rhizobium meliloti (Sinorhizobium meliloti) (see 3 papers)
24% identity, 86% coverage

• mutant phenotype: Specific phenotype on trehalose, but also reported to transport maltose and sucrose (PMID:12003938; also PMC1635973)
• substrates: Maltose, Sucrose, Trehalose

ML1768 sugar transport integral membrane protein from Mycobacterium leprae TN
26% identity, 78% coverage

• Implications of high level pseudogene transcription in Mycobacterium leprae
  Williams, BMC genomics 2009
  • “...ML1598 ML1595 73 ML1581 ML1598 ML1662 77 ML1658 ML1664 ML1693 79 ML1691 ML1696 ML1771c 83 ML1768 ML1800 ML1772c 83 ML1768 ML1800 ML1850c 86 ML1840 ML1895 ML1851c 86 ML1840 ML1895 ML1852c 86 ML1840 ML1895 ML1866c 86 ML1840 ML1895 ML1868c 86 ML1840 ML1895 ML1870c 86 ML1840 ML1895 ML1871c...”

CPE0372 probable ABC transporter from Clostridium perfringens str. 13
29% identity, 67% coverage

• Changes in the expression of genes encoding type IV pili-associated proteins are seen when Clostridium perfringens is grown in liquid or on surfaces
  Soncini, BMC genomics 2020
  • “...0.0276 ugpB ABC-type sugar transport system, periplasmic component CPE0371 3.351 0.0405 ugpA Probable ABC transporter CPE0372 3.083 0.0405 ugpE Probable ABC transporter CPE0373 3.126 0.0405 aga Alpha-galactosidase CPE0374 3.251 0.0276 skn1 Endo-beta-galactosidase C CPE0375 3.511 0.0276 arcD Probable amino acid permease CPE0389 3.325 0.0276 dchS Histidine...”

SACTE_2288 carbohydrate ABC transporter permease from Streptomyces sp. SirexAA-E
29% identity, 71% coverage

• Aerobic deconstruction of cellulosic biomass by an insect-associated Streptomyces
  Takasuka, Scientific reports 2013
  • “...SACTE_3159 CBM33 CBM2 Cellulose-binding domain TGGGAGCGCTCCCA 3 16.2 SACTE_0482 GH5 CBM2 Endo-1,4-beta-glucosidase TGGGAGCGCTCCCA 4 15.4 SACTE_2288 Transport systems inner membrane component TGGGAGCGCTCCCA 5 11.2 SACTE_3717 GH9 CBM2 1,4-beta cellobiohydrolase TGGGAGCGCTCCCA 6 9.7 SACTE_6428 CBM33 Chitin-binding, domain 3 GGGAGCGCTCCCA 9 7.9 SACTE_2347 GH5 CBM2 Beta-mannosidase TGGGAGCGCTCCCA 11...”

MELD_BACSU / O34706 Melibiose/raffinose/stachyose import permease protein MelD from Bacillus subtilis (strain 168) (see paper)
BSU30280 carbohydrate ABC transporter (permease) from Bacillus subtilis subsp. subtilis str. 168
27% identity, 83% coverage

• function: Part of the ABC transporter complex MelEDC-MsmX involved in melibiose, raffinose and stachyose import. Probably responsible for the translocation of the substrate across the membrane.
  subunit: The complex is composed of two ATP-binding proteins (MsmX), two transmembrane proteins (MelC and MelD) and a solute-binding protein (MelE).
  disruption phenotype: Deletion of the gene abolishes induction in the presence of melibiose and raffinose.
• rocF affects the production of tetramethylpyrazine in fermented soybeans with Bacillus subtilis BJ3-2
  Liu, BMC biotechnology 2022
  • “...Up BSU36550 417.195 1556.086 1.9 5.17E-05 3.63E-03 Up BSU19050 7.277 27.08 1.88 1.08E-03 3.68E-02 Up BSU30280 10.263 35.571 1.78 4.72E-04 1.96E-02 Up BSU30290 8.444 28.629 1.75 9.44E-04 3.34E-02 Up BSU38080 223.922 747.383 1.74 1.76E-04 9.59E-03 Up BSU31060 17.602 58.817 1.73 2.31E-04 1.16E-02 Up BSU25150 9.698 32.51...”
• Regulon of the N-acetylglucosamine utilization regulator NagR in Bacillus subtilis
  Bertram, Journal of bacteriology 2011
  • “...J. BACTERIOL. yvfM, ganQ amyD dhaS yjdB BSU34140 BSU30280 BSU19310 BSU11990 a --, cis-acting element, trans-acting regulator, pathway, or regulon unknown. Genes...”

Rv2316 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER USPA from Mycobacterium tuberculosis H37Rv
P71896 Probable sugar-transport integral membrane protein ABC transporter UspA from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
29% identity, 79% coverage

• Assessing the propensity of TB clinical isolates to form viable but non-replicating subpopulations
  Coetzee, Scientific reports 2024
  • “...P9WHU1 prcA R135P 248 Proteasome core protein PrcA Rv2307c P9WLC7 rv2307c M24T 281 Uncharacterized protein Rv2316 P71896 uspA V127L 290 Probable sugar-transport integral membrane protein ABC transporter Rv2333c P9WG91 stp D69Y 537 Multidrug resistance protein Stp (Spectinomycin tetracycline efflux pump) Rv2347c P9WNI5 esxP T3S 98 ESAT-6-like...”
• Mechanistic Insight into the Enzymatic Inhibition of β-Amyrin against Mycobacterial Rv1636: In Silico and In Vitro Approaches
  Beg, Biology 2022
  • “...signaling pathway, which is essential in host protective immunity, albeit the exact mechanism is unknown. Rv2316 (uspA) is an integral membrane protein involved in the active transport of sugar across the membrane. This protein oversees transporting sugar across the membrane (import). The proteinchemical interaction using the...”
  • “...signaling pathway, which is important in host protective immunity, albeit the exact mechanism is unknown. Rv2316 (UspA) is an integral membrane protein involved in the active transport of sugar across the membrane. STITCH server showed the interaction of Rv1636 with the SeMet, carboxy, chloride, nitrate, MgATP,...”
• ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
  Soni, Emerging microbes & infections 2020
  • “...Involved in biofilm formation [ 43 ] Amino-sugar importer (UspABC/Rv2316-Rv2318) SBP: UspC (Rv2318) TMD: UspA (Rv2316) and UspB (Rv2317) NBD: Remains to be identify Essential for in vitro growth [ 50 ] UspC have a substrate preference for sugars containing an amino group at the C2...”
• Whole genome sequencing reveals genomic heterogeneity and antibiotic purification in Mycobacterium tuberculosis isolates
  Black, BMC genomics 2015
  • “...targeted PCR and sanger sequencing Gene a Sanger chromatogram result Read frequency (%) Sanger result Rv2316 Single peak 127/127 (100.0) True Rv1703c Single peak 152/154 (98.7) True Rv0820 Single peak 193/200 (96.5) True Rv3220c Single peak 129/134 (96.3) True Rv0537c Single peak 98/126 (77.8) True Rv2692...”
• Assessing the propensity of TB clinical isolates to form viable but non-replicating subpopulations
  Coetzee, Scientific reports 2024
  • “...prcA R135P 248 Proteasome core protein PrcA Rv2307c P9WLC7 rv2307c M24T 281 Uncharacterized protein Rv2316 P71896 uspA V127L 290 Probable sugar-transport integral membrane protein ABC transporter Rv2333c P9WG91 stp D69Y 537 Multidrug resistance protein Stp (Spectinomycin tetracycline efflux pump) Rv2347c P9WNI5 esxP T3S 98 ESAT-6-like protein...”

BAD_1586 ABC transporter_ membrane spanning protein[sugar] from Bifidobacterium adolescentis ATCC 15703
30% identity, 78% coverage

• Metagenomic identification, purification and characterisation of the Bifidobacterium adolescentis BgaC β-galactosidase
  Mulualem, Applied microbiology and biotechnology 2021
  • “...LacI family transcriptional regulator (BAD_1584), carbohydrate ABC transporter substrate-binding protein (BAD_1585), sugar ABC transporter permease (BAD_1586), and carbohydrate ABC transporter permease (BAD_1587). The numbers at the start and end of each clone show location of the nucleotide sequences on the ATCC15703 genome Through bioinformatic analysis, BAD_1582...”
  • “...). Downstream are genes encoding an ABC transporter substrate-binding protein (BAD_1585), sugar ABC transporter permease (BAD_1586) and carbohydrate ABC transporter permease (BAD_1587) which together form a complex to transport sugars (possibly lactose and other oligosaccharides) into the cell. In addition, the genome of B. adolescentis encodes...”

XF2447 ABC transporter sugar permease from Xylella fastidiosa 9a5c
26% identity, 84% coverage

• Xylella fastidiosa: Host Range and Advance in Molecular Identification Techniques
  Baldi, Frontiers in plant science 2017
  • “...XF1632 CAATGAAGATTCACGGCAATA ATAGTTAATGGCTCCGCTATG Twitching motility protein leuA a XF18188 GGGCGTAGACATTATCGAGAC GTATCGTTGTGGCGTACACTG 2-Isopropylmalate synthase lacF a XF2447 TTGCTGGTCCTGCGGTGTTG CCTCGGGTCATCACATAAGGC ABC transporter sugar permease rfbD b XF0257 TTTGGTGATTGAGCCGAGGGT a TCCATAAACGGCGCCTTC dTDP-4-dehydrorhamnose-3, 5-epimerase cysG b XF0832 GGCGGCGGTAAGGTTG a GCATATGTCTGTGCGGTGTGC cysG Siroheme synthase holC c XF0136 ATGGCACGCGCCGACTTCT ATGTCGTGTTTGTTCATGTGCAGG DNA polymerase...”
  • “...GCTGCCATTCGTTGAAGTACCT GCACGTCCTCCCAATAAGCCT Ubiquinol cytochrome c oxidoreductase leuA c XF18188 GGTGCACGCCAAATCGAATG GTATCGTTGTGGCGTACACTG 2-Isopropylmalate synthase malF c XF2447 TTGCTGGTCCTGCGGTGTTG GACAGCAGAAGCACGTCCCAGAT ABC transporter sugar permease pilU c XF1632 CCGTAATCACAACTCAACAGGACA CTGCGAATCAGCATGGCGTA Twitching motility protein acvB d PD_1902 ACAGTATCGCCGTCGAAGTGATGA CATGCATACRGCGATGYTTCCGAT Virulence protein: suggested to regulate pathogenicity copB d PD_0101 ATGAACACCCGTACCTGGTTCGTA ATTTAGTCTCCACCATGAGCCGCA...”
• A multigene phylogenetic study of clonal diversity and divergence in North American strains of the plant pathogen Xylella fastidiosa
  Schuenzel, Applied and environmental microbiology 2005
  • “...Siroheme synthase XF0910 petC XF1632 pilU XF1818 leuA XF2447 lacF a b Ubiquinol cytochrome c oxidoreductase, cytochrome c1 subunit Twitching motility protein...”
• Multilocus sequence type system for the plant pathogen Xylella fastidiosa and relative contributions of recombination and point mutation to clonal diversity
  Scally, Applied and environmental microbiology 2005
  • “...Glutamate symport protein Siroheme synthase XF1632 XF1818 XF2447 Information based on information reported in reference 39. MATERIALS AND METHODS X. fastidiosa...”
• Whole-genome analysis of transporters in the plant pathogen Xylella fastidiosa
  Meidanis, Microbiology and molecular biology reviews : MMBR 2002
  • “...XF1344 XF1346 XF1345 XF1475 XF1409 XF0421 XF0419 XF0418 XF0420 XF0874 XF2695 XF0875 XF2448 XF2447 XF2446 XF1067 ORF 0 5 6 0 0 0 0 0 3 4 0 0 0 4 5 0 No. of TMSs...”

mtlF / Q4KC56 polyol ABC-type transporter permease component MtlF from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) (see paper)
30% identity, 87% coverage

RUMGNA_02697 hypothetical protein from Ruminococcus gnavus ATCC 29149
30% identity, 68% coverage

• The mucin-degradation strategy of Ruminococcus gnavus: The importance of intramolecular trans-sialidases
  Crost, Gut microbes 2016
  • “...the ABC transporter composed of a solute-binding protein (RUMGNA_02698 or RGNV35913_01296) and two putative permeases (RUMGNA_02697 and RUMGNA_02696, or RGNV35913_01295 and RGNV35913_01294) ( Fig.5A ). It is not known whether this transporter is specific of the 2,7-anhydro-Neu5Ac or could also transport Neu5Ac. Once inside the cell,...”
  • “...of a solute-binding protein (RUMGNA_02698 in ATCC 29149;RGNV35913_01296 in ATCC 35913) and two putative permeases (RUMGNA_02697 and RUMGNA_02696 in ATCC 29149; RGNV35913_01295 and RGNV35913_01294 in ATCC 35913) and then hydrolyzed into Neu5Ac, possibly by the action of RUMGNA_02701 or RGNV35913_01299, before being catabolized into GlcNAc-6-P following...”
• Utilisation of mucin glycans by the human gut symbiont Ruminococcus gnavus is strain-dependent
  Crost, PloS one 2013
  • “...The following 3 genes code for a predicted solute-binding protein (RUMGNA_02698) and two putative permeases (RUMGNA_02697, RUMGNA_02696), components of a sugar ABC transporter; RUMGNA_02696gp has specific homology with putative sialic acid transporters of the SAT2 family [54] . The following gene has no known function. The...”

BAD_RS00810 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
26% identity, 82% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...Sugar ABC transporter permease 911.12 326.41 BAD_RS08280 1.46 msmF Sugar ABC transporter permease 1,353.65 491.14 BAD_RS00810 1.45 yurN Sugar ABC transporter permease 762.04 278.86 BAD_RS03705 1.35 ABC transporter permease 91.4 35.95 BAD_RS00990 1.33 ABC transporter substratebinding protein 34.99 13.91 BAD_RS03325 1.29 MJ1508 ABC transporter ATPbinding protein...”
  • “...Compared to xylose treatment, genes including the sugar transporter permease protein (encoded by BAD_RS00815, BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58), cellobiose (meta_991),...”

TM0431 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
29% identity, 68% coverage

• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...TM1192 TM0972 TM1193 TM1044 2 TM1194 TM1190 TM1195 TM1191 TM1196 TM1192 TM1197 TM1193 TM1198 TM1194 TM0431 TM1199 TM1195 TM0810 TM1193 TM1200 TM1200 TM1200 TM1200 TM1201 TM1201 TM1201 TM1201 TM1202 TM1202 TM1202 TM1202 TM1203 TM1203 TM1203 TM1203 TM1204 TM1204 TM1204 TM1204 TM1578 TM1205 TM1217 TM1205 TM0372 X...”
• Several archaeal homologs of putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugars
  Nanavati, Applied and environmental microbiology 2006
  • “...(myo-inositol-1-P-synthase [1]) malE3b malF3 ugpE malK2 TM0430 TM0431 TM0432 MSP MSP SBP 1 aguG aguF aguE -Galactouronate transport TM0434, agu (-glucuronidase...”

SMc02872 ABC transporter for N-Acetyl-D-glucosamine, permease protein 1 from Sinorhizobium meliloti 1021
27% identity, 82% coverage

• mutant phenotype: Specific phenotypes on N-Acetyl-D-Glucosamine; N-Acetyl-D-Glucosamine.

SCO2945 sugar transporter membrane protein from Streptomyces coelicolor A3(2)
28% identity, 84% coverage

• SepG coordinates sporulation-specific cell division and nucleoid organization in Streptomyces coelicolor
  Zhang, Open biology 2016 (no snippet)
• The dasABC gene cluster, adjacent to dasR, encodes a novel ABC transporter for the uptake of N,N'-diacetylchitobiose in Streptomyces coelicolor A3(2)
  Saito, Applied and environmental microbiology 2007
  • “...Position of the signature sequence SCO0532 SCO0533 SCO2945 SCO2944 SCO5233 (DasB) SCO5234 (DasC) 302 285 316 281 328 276 ESARMDGAGAARVERSVTFP...”

P73352 Lactose transport system permease protein LacF from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
slr1202 lactose transport system permease protein; LacF from Synechocystis sp. PCC 6803
32% identity, 71% coverage

• Characterization of the binding protein-dependent cellobiose and cellotriose transport system of the cellulose degrader Streptomyces reticuli
  Schlösser, Applied and environmental microbiology 1999 (secret)
• A global transcriptional activator involved in the iron homeostasis in cyanobacteria
  Liu, Science advances 2024
  • “..., Slr0382, nickel transport protein Motif-1 sll1598 , MntC, Mn transporter MntC Others Sugar transport slr1202 , Slr1202, permease protein of sugar ABC transporter Motif-2, -3 slr1723 , Slr1723, permease protein of sugar ABC transporter Motif-1, -2 slr0044 , CmpD, bicarbonate transport system ATP-binding protein Motif-1,...”
• RNA-Seq analysis provides insights for understanding photoautotrophic polyhydroxyalkanoate production in recombinant Synechocystis Sp
  Lau, PloS one 2014
  • “...and chlorophyll metabolism slr1675 hydrogenase expression/formation protein, HypA 2.01 111.92 225.29 cellular protein modification process slr1202 lactose ABC transporter permease 1.96 16.49 32.23 transport sll1740 50S ribosomal protein L19 1.93 427.21 825.93 translation sll1538 beta-glucosidase 1.92 21.65 41.64 carbohydrate metabolism slr1205 ferredoxin component 1.92 214.39 412.13...”
• Design and characterization of molecular tools for a Synthetic Biology approach towards developing cyanobacterial biotechnology
  Huang, Nucleic acids research 2010
  • “...and hence IPTG, into the cells, but there are candidate genes such as slr1723 and slr1202 (permeases) ( 68 ) and sll1374 (putative sugar transporter) ( 69 ). The low induction problem caused by limited diffusion of IPTG has been previously recognized ( 70 ) and...”

TC 3.A.1.1.18 / Q8RJU9 NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) from Streptomyces olivaceoviridis (Streptomyces corchorusii) (see paper)
27% identity, 82% coverage

• substrates: N,N'-diacetyl chitobiose, N-acetylglucosamine

SCO2979 integral membrane transport protein from Streptomyces coelicolor A3(2)
29% identity, 42% coverage

• Insights into naturally minimised Streptomyces albus J1074 genome
  Zaburannyi, BMC genomics 2014
  • “...sets of genes are responsible for the biosynthesis of wall teichoic acids (WTA): SCO2589-SCO2590 and SCO2979, SCO2998 [ 29 ]. Among these, glycosyltransferases play a central role for WTA production [ 30 ], including SCO2981, SCO2982, SCO2983, SCO2997, SCO2589, SCO2590, SCO2592. S. albus contains only three...”

BMEII0753 SORBITOL/MANNITOL TRANSPORT INNER MEMBRANE PROTEIN from Brucella melitensis 16M
25% identity, 88% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...or polyol import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307...”

AO356_00020 ABC transporter for D-Sorbitol, permease component 2 from Pseudomonas fluorescens FW300-N2C3
29% identity, 75% coverage

• mutant phenotype: Specific phenotypes on D-Sorbitol; D-Sorbitol. (no phenotype on mannitol)

B8809_1436 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum
27% identity, 79% coverage

• Two extracellular α-arabinofuranosidases are required for cereal-derived arabinoxylan metabolism by Bifidobacterium longum subsp. longum
  Friess, Gut microbes 2024
  • “...upregulated. A gene cluster that is upregulated (consisting of four genes with the locus tags B8809_1436, B8809_1437, B8809_1448 and B8809_1449) is predicted to encode a pentose sugar ABC transporter, which may be responsible for xylose/XOS uptake. Gene-trait matching based on genes identified by transcriptome analysis and...”

TC 3.A.1.1.37 / Q9WYB4 Predicted arabinoside porter. Regulated by arabinose-responsive regulator AraR from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
TM0278 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
28% identity, 82% coverage

• substrates: Arabinosides
• In silico method for modelling metabolism and gene product expression at genome scale
  Lerman, Nature communications 2012
  • “...identified a single additional instance in an intergenic region upstream of the TU-containing genes TM0277, TM0278 and TM0279 ( Fig. 6d ). These genes were induced when L -Arab was the carbon source, but not when cellobiose or maltose serves as the carbon source ( Supplementary...”
  • “...are not known. When we examined these genes using the SEED RAST server 37 , TM0278 and TM0279 were classified as permeases of an ABC transporter putatively involved in L -Arab utilization, whereas TM0277 was not classified because it was annotated as containing an authentic frameshift...”
• An expression-driven approach to the prediction of carbohydrate transport and utilization regulons in the hyperthermophilic bacterium Thermotoga maritima
  Conners, Journal of bacteriology 2005
  • “...in the supplemental material). Sugar ABC permease subunits TM0278 and TM0279 do not show strong differential regulation and, together with a frameshifted...”

BCAN_B0517 binding-protein-dependent transport systems inner membrane component from Brucella canis ATCC 23365
24% identity, 88% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP Maltose...”

Bbr_0107 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
26% identity, 75% coverage

• Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
  Bottacini, Scientific reports 2018
  • “...et al . 27 Bbr_0106 Cellodextrin binding protein X PF13416 Pokusaeva et al . 27 Bbr_0107 Cellodextrin transport system permease protein CebF PF00528 Pokusaeva et al . 27 Bbr_0108 Cellodextrin transport system permease protein CebG PF00528 Pokusaeva et al . 27 Bbr_0109 Beta-glucosidase, cellodextrinase, glycosyl hydrolase...”
• A two-component regulatory system controls autoregulated serpin expression in Bifidobacterium breve UCC2003
  Alvarez-Martin, Applied and environmental microbiology 2012
  • “...Bbr_1319 Bbr_1656 Bbr_1657 Bbr_1658 Bbr_1655 Bbr_0249 Bbr_0107 Bbr_1464 Bbr_0106 Bbr_1320 Bbr_0108 Bbr_1293 Bbr_1434 Bbr_0109 Bbr_1433 Bbr_1291 Bbr_1506...”
• Cellodextrin utilization by bifidobacterium breve UCC2003
  Pokusaeva, Applied and environmental microbiology 2011
  • “...UCC2003 Locus tag (gene) Bbr_0106 (cldE) Bbr_0107 (cldF) Bbr_0109 (cldC) Cellodextrin-binding protein Cellodextrin transport system permease protein...”

BH1865 sugar transport system (permease) (binding protein dependent transporter) from Bacillus halodurans C-125
28% identity, 68% coverage

• Widespread occurrence and genomic context of unusually small polyketide synthase genes in microbial consortia associated with marine sponges
  Fieseler, Applied and environmental microbiology 2007
  • “...maltophilia AtsG (CAD74202), Rhodopirellula baltica BH1865 (BAB05584), Bacillus halodurans BH1866 (BAB05585), B. halodurans ABC1215 (BAD63753), Bacillus...”

cg0832 ABC transporter membrane protein from Corynebacterium glutamicum ATCC 13032
27% identity, 76% coverage

• Functional Genomics Uncovers Pleiotropic Role of Rhomboids in Corynebacterium glutamicum
  Luenenschloss, Frontiers in microbiology 2022
  • “...30C. Components of an ABC-type maltose uptake system (Cg2704, Cg2705) and ABC-type trehalose uptake system (Cg0832, Cg0834) were less abundant in the CF as well as MF at 30 and/or 40C. Since 4-alpha-D-((1- > 4)-alpha-D-glucano)trehalose trehalohydrolase (Cg2333) was present at much higher amounts in the MF...”
• Identification and characterization of a bacterial transport system for the uptake of pyruvate, propionate, and acetate in Corynebacterium glutamicum
  Jolkver, Journal of bacteriology 2009
  • “...and 98 bp upstream of the start codon of cg0832. However, the functionality and the significance of these binding sites and the involvement of GlxR in...”
• Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
  Follmann, BMC genomics 2009
  • “...synthase 2 0 -1.39 n.d. - 1.7 0.8 - - - - - - 36 cg0832 ABC-type transporter, permease components 5 -1.33 -0.40 - - - -0.4 - - - 1.0 1.1 37 cg0834 ABC-type transporter, periplasmic component 0 -2.46 -0.03 1.6 3.4 2.7 2.5 3.6...”

CD2549 putative sugar transporter, permease protein from Clostridium difficile 630
27% identity, 87% coverage

• A curated C. difficile strain 630 metabolic network: prediction of essential targets and inhibitors
  Larocque, BMC systems biology 2014
  • “...ribC 3 , CD0557 2 , CD1966 3 *, CD2256 2 *, CD2541 2 *, CD2549 2 * , CD3555 3 , CD3596 1 , pykF 1 (15.51%), CD0994 1 * (15.08%), serA 1 (15.08%), ackA 1 (14.74%), asnA 1 (5.76%) No B. subtilis homolog (8)...”
  • “...that are upregulated during infection and predicted to be essential such as fabD, serA or CD2549, are of additional interest as they could not only affect growth, but also colonisation and pathogenesis processes [ 57 ] (Table 3 ). Detection of potential human cross-reactivity targets Sequence...”

PGA1_c27940 N-Acetyl-D-glucosamine ABC transport system, permease component 1 from Phaeobacter inhibens DSM 17395
28% identity, 82% coverage

• mutant phenotype: Specific phenotypes on N-Acetyl-D-Glucosamine.

XACH_HALVD / D4GP36 Xylose/arabinose import permease protein XacH from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
HVO_B0035 ABC-type transport system permease protein (probable substrate sugar) from Haloferax volcanii DS2
27% identity, 71% coverage

• function: Part of the ABC transporter complex XacGHIJK involved in the uptake of xylose and arabinose (PubMed:31089701). Responsible for the translocation of the substrate across the membrane (Probable).
  subunit: The complex is composed of two ATP-binding proteins (XacJ and XacK), two transmembrane proteins (XacH and XacI) and a solute-binding protein (XacG).
• A sweet new set of inducible and constitutive promoters in Haloferax volcanii
  Rados, Frontiers in microbiology 2023
  • “...HVO_0562 64 ); 4 for xylose ( HVO_B0027 - 29 , HVO_B0030 - 32 , HVO_B0035 , and HVO_B0036 - 38 ); 3 for arabinose ( HVO_B0027 - 29 , HVO_B0030 - 32 , and HVO_B0035; and none for IPTG ( Figures 1C , D )....”
• D-xylose degradation pathway in the halophilic archaeon Haloferax volcanii
  Johnsen, The Journal of biological chemistry 2009
  • “...4-epimerase HVO_B0033, hypothetical protein HVO_B0034, unknown HVO_B0035, sugar ABC transporter permease protein HVO_B0036, ABC transporter permease protein...”

PA2339 probable binding-protein-dependent maltose/mannitol transport protein from Pseudomonas aeruginosa PAO1
30% identity, 71% coverage

• Catabolite repression control protein antagonist, a novel player in Pseudomonas aeruginosa carbon catabolite repression control
  Sonnleitner, Frontiers in microbiology 2023
  • “...Lipoamide dehydrogenase-Val PA2338 4.24 9.03E-16 PA 2338 Probable binding protein component of ABC maltose/mannitol transporter PA2339 4.97 3.00E-07 PA 2339 Probable binding-protein-dependent maltose/mannitol transport protein PA2340 3.98 1.94E-04 PA 2340 Probable binding-protein-dependent maltose/mannitol transport protein PA2341 5.09 6.80E-13 PA 2341 Probable ATP-binding component of ABC maltose/mannitol...”
• Bacterial cis-2-unsaturated fatty acids found in the cystic fibrosis airway modulate virulence and persistence of Pseudomonas aeruginosa
  Twomey, The ISME journal 2012
  • “...PA1325 PA1326 PA1327 PA1467 PA1559 PA1560 PA1797 PA1889 PA2339 PA2966 PA3790 PA4138 PA4357 PA4358 PA4359 PA4599 PA4773 PA4774 PA4775 PA4776 PA4777 PA4781 PA4782...”
• Induction by cationic antimicrobial peptides and involvement in intrinsic polymyxin and antimicrobial peptide resistance, biofilm formation, and swarming motility of PsrA in Pseudomonas aeruginosa
  Gooderham, Journal of bacteriology 2008
  • “...PA1927 PA1976 PA1978 PA1982 PA1983 PA1984 PA1985 PA2124 PA2277 PA2278 PA2339 PA2350 coxA mdcR clpC 3.4 4.8 3.5 3.2 4.8 2.3 4.5 2.6 4.3 3.3 4.2 4.1 2.8 8.9...”
• Identification, timing, and signal specificity of Pseudomonas aeruginosa quorum-controlled genes: a transcriptome analysis
  Schuster, Journal of bacteriology 2003
  • “...PA0485 PA0887 PA1559 PA2007 PA2008 PA2009 PA2250 PA2338 PA2339 PA2340 PA2341 PA2343 PA3038 PA3174 PA3205 PA3233 PA3234 PA3235 PA3281 PA3282 PA3283 PA3284 PA3364...”

blr1890 ABC transporter permease protein from Bradyrhizobium japonicum USDA 110
31% identity, 72% coverage

• DNA Microarray-Based Identification of Genes Regulated by NtrC in Bradyrhizobium japonicum
  Franck, Applied and environmental microbiology 2015
  • “...protein Unknown protein bll5155 blr5803 blr1893 blr1891 blr1890 bsr2847 bll3639 blr1895 bll7395 blr4988 blr5556 bll2292 blr2344 bsr5172 blr8273 bll8202 blr4995...”

Clocel_3200 carbohydrate ABC transporter permease from Clostridium cellulovorans 743B
25% identity, 89% coverage

• Elucidation of the recognition mechanisms for hemicellulose and pectin in Clostridium cellulovorans using intracellular quantitative proteome analysis
  Aburaya, AMB Express 2015
  • “...protein Beta-1,4-mannooligosaccharide/beta-1,4-mannosyl- N -acetylglucosamine phosphorylase 2.65 5.29E03 Clocel_3198 N -acylglucosamine 2-epimerase Mannobiose 2-epimerase 3.19 2.10E03 Clocel_3200 Binding-protein-dependent transport system inner membrane protein Multiple sugar transport system permease protein 4.76 8.61E04 Clocel_3201 Extracellular solute-binding protein Raffinose/stachyose/melibiose transport system substrate-binding protein 4.23 5.49E05 Clocel_3205 Glycoside hydrolase family 2...”

MSMEG_4466 ABC transporter, permease protein UspA from Mycobacterium smegmatis str. MC2 155
27% identity, 74% coverage

• A Mycobacterial Systems Resource for the Research Community
  Judd, mBio 2021
  • “...strain ( TableS1 ). The remaining 14 genes encode full-length proteins (with the exception of MSMEG_4466 , which uses an initiation codon 15 amino acids downstream of the misannotated start). This provides a cautionary note, indicating there are distinct genetic lineages among the laboratory strains of...”

MSMEG_5573 sugar ABC transporter permease protein from Mycobacterium smegmatis str. MC2 155
29% identity, 80% coverage

• A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
  McKenzie, Journal of bacteriology 2012
  • “...C4-dicarboxylate transport protein Sugar alcohol MSMEG_5571 MSMEG_5572 MSMEG_5573 MSMEG_5574 MSMEG_5575 smoK smoG smoF somE smoR 1.80 1.76 1.99 1.92 1.68...”

SPO_RS09350 carbohydrate ABC transporter permease from Ruegeria pomeroyi DSS-3
28% identity, 82% coverage

• Effects of iron concentration and DFB (Desferrioxamine-B) on transcriptional profiles of an ecologically relevant marine bacterium
  LeCleir, PloS one 2023
  • “...but were involved in other cellular processes ( i . e ., carbohydrate (SPO_RS09345 and SPO_RS09350) and amino acid metabolism (SPO_RS05130 and SPO_RS05135) (see Fig 4 and S6 and S7 Tables). These impacts may be due to secondary/ downstream effects of iron stress. For example, when...”

BOV_A0451 sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
26% identity, 82% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308 OSP...”

Bbr_0027 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
29% identity, 84% coverage

• Bifidobacterial biofilm formation is a multifactorial adaptive phenomenon in response to bile exposure
  Kelly, Scientific reports 2020
  • “...of ABC transporter system for sugars galactan metabolism 3.37 4.61E05 Bbr_1790 Phosphoglycerol transferase 3.26 0.003699621 Bbr_0027 Permease protein of ABC transporter system for sugars 3.17 0.000263903 Bbr_0809 Permease protein of ABC transporter system 2.15 0.005541407 Bbr_1889 Cell surface protein with gram positive anchor domain 1.98 0.005000633...”
• Metabolism of four α-glycosidic linkage-containing oligosaccharides by Bifidobacterium breve UCC2003
  O'Connell, Applied and environmental microbiology 2013
  • “...upregulationb during growth on: Gene ID Bbr_0026 Bbr_0027 Bbr_0030 Bbr_0100 Bbr_1855 Bbr_1856 Bbr_1857 Bbr_1858 Bbr_1859 Bbr_1860 Bbr_1865 Bbr_1866 Bbr_1867...”
  • “...when the strain was grown on melibiose: Bbr_0026, Bbr_0027, Bbr_0030, and Bbr_100, which are predicted to encode two ABC-type permeases, a hypothetical protein,...”

Balac_1570 ABC transporter permease from Bifidobacterium animalis subsp. lactis Bl-04
28% identity, 84% coverage

• Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
  Andersen, BMC genomics 2013
  • “...Maltriose E 9.7 14.5 Balac_1569 ABC transporter, permease component glucoside B,D Cellobiose E 5.2 13.7 Balac_1570 ABC transporter, permease component glucoside B,D Cellobiose E 3.7 15.1 Balac_1571 Transcriptional regulator ( lacI type) glucoside B,D Cellobiose E 3.7 13.1 Balac_1572 ABC transporter, oligosaccharide-binding protein glucoside B,D Cellobiose...”
  • “...MFS permeases displaying mainly 12 transmembrane helix topology [ 47 ]. Furthermore, one permease protein (Balac_1570) constituting part of the maltotriose upregulated ABC transporter was found to be N-terminally truncated and lacking two helices implicated in heterodimer formation in the permease domain of the maltose ABC...”
• Genetic and physiological responses of Bifidobacterium animalis subsp. lactis to hydrogen peroxide stress
  Oberg, Journal of bacteriology 2013
  • “...Balac_1598 Balac_1599 Balac_1601 Balac_1567 Balac_1568 Balac_1569 Balac_1570 Balac_1572 Balac_1573 Bifidobacterium lactis H2O2 Stress Response with no H2O2...”

PA14_34410 putative binding-protein-dependent maltose/mannitol transport protein from Pseudomonas aeruginosa UCBPP-PA14
29% identity, 71% coverage

• Evolution of biofilm-adapted gene expression profiles in lasR-deficient clinical Pseudomonas aeruginosa isolates
  Jeske, NPJ biofilms and microbiomes 2022
  • “...PA14_10170 fepB 1.39 PA14_10610 hpcD 1.08 PA14_34390 mtlG 1.45 PA14_13430 fecA 1.15 PA14_10630 hpcC 0.87 PA14_34410 mtlF 1.48 PA14_20010 hasR 1.46 PA14_10640 hpaG2 1.07 PA14_34420 mtlE 1.01 PA14_20030 hasD 1.13 PA14_10650 hpaG1 1.23 PA14_42080 fadB 1.00 PA14_20040 hasE 1.29 PA14_10900 ydjL 1.55 PA14_43420 1.18 PA14_32740 optS...”

BRA0518 sugar ABC transporter, permease protein from Brucella suis 1330
25% identity, 82% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...import IM BMEII0752 BruAb20704 BRA0519 BOV_A0452 BCAN_B0518 OSP Oligosaccharide or polyol import IM BMEII0753 BruAb20705 BRA0518 BOV_A0451 BCAN_B0517 OSP Oligosaccharide or polyol import BP BMEII0754 BruAb20706 BRA0516 BOV_A0449 BCAN_B0516 OSP Oligosaccharide or polyol import BP BMEII0755 81 OSP Maltose import ABC BMEII0940 BruAb20874 BRA0307 BOV_A0282 BCAN_B0308...”

RL2896 putative transmembrane transporter from Rhizobium leguminosarum bv. viciae 3841
28% identity, 85% coverage

• Lifestyle adaptations of Rhizobium from rhizosphere to symbiosis
  Wheatley, Proceedings of the National Academy of Sciences of the United States of America 2020 (secret)

TC 3.A.1.1.49 / O30492 MtlF, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK from Pseudomonas fluorescens
29% identity, 75% coverage

• substrates: Arabitinol, glucitol, mannitol

SCO1899 integral membrane sugar transport protein from Streptomyces coelicolor A3(2)
28% identity, 83% coverage

• The DeoR-like pleiotropic regulator SCO1897 controls specialised metabolism, sporulation, spore germination, and phosphorus accumulation in Streptomyces coelicolor
  Fernández-García, Communications biology 2024
  • “...average amino acid similarity of 92.2%, 88.2%, 86.1%, 89.1%, 91.6%, and 86.8% with SCO1897, SCO1898, SCO1899, SCO1900, SCO1901, and SCO1903 respectively (Fig. 1a ). SCO1902 was less conserved, showing an average similarity of 58.4% in these model Streptomyces strains. Fig. 1 The sco1897::Tn5 mutant phenotype and...”
  • “...) was less abundant than transcript 1 ( sco1897 ) and that transcripts 3 ( sco1899 ) and 4 ( sco1900 ) were more abundant than transcript 2 ( sco1898 ) at 16 and 24h. The abundance of most of the transcripts decreased at 48h and...”
• From waste to health-supporting molecules: biosynthesis of natural products from lignin-, plastic- and seaweed-based monomers using metabolically engineered Streptomyces lividans
  Seo, Microbial cell factories 2023
  • “...SCO1901 100/99.6 SLYA8N_28215 Membrane sugar transporter, smoG SCO1900 100/99.8 SLYA8N_28220 Membrane sugar transport protein, smoF SCO1899 100/100 SLYA8N_28225 Substrate binding protein, smoE SCO1898 100/99.3 SLYA8N_28230 Transcriptional regulator deoR-type, smoR SCO1897 100/99.7 In terms of metabolic adjustment, the use of mannitol or protocatechuate as the growth substrate...”

lmo0766 similar to putative sugar ABC transporter, permease protein from Listeria monocytogenes EGD-e
26% identity, 86% coverage

• Listeria monocytogenes differential transcriptome analysis reveals temperature-dependent Agr regulation and suggests overlaps with other regulons
  Garmyn, PloS one 2012
  • “..., bvrB ) [35] and putative sugar ABC transporters (for example lmo0768 , lmo0767 and lmo0766 ) had higher transcript levels in DG125A compared to EGD-e. Two genes with higher transcript level ( lmo1884 and pyrP ) encode permeases for xanthine and uracil. Both genes are...”
• Probing the pan-genome of Listeria monocytogenes: new insights into intraspecific niche expansion and genomic diversification
  Deng, BMC genomics 2010
  • “...PTS system, beta-glucoside-specific enzyme IIABC IIIA + 119 lmo0739 Similar to 6-phospho-beta-glucosidase IIIA + 119 lmo0766 Similar to putative sugar ABC transporter, permease protein IIIA + - lmo0767 Similar to ABC transporter, permease protein IIIA + - lmo1031 Hypothetical protein IIIA - 166 lmo1032 Similar to...”

PS417_12710 ABC transporter for D-Mannitol and D-Sorbitol, permease component 2 from Pseudomonas simiae WCS417
29% identity, 74% coverage

• mutant phenotype: Very important for utilization of D-sorbitol, D-mannitol. Also important for D-mannose utilization, but closely related to a P. aeruginosa system that is apparently not a mannose transporter (the substrate-binding component PA2338 does not bind mannose, see PMC6829864).

BRA1182 sugar ABC transporter, permease protein, putative from Brucella suis 1330
BCAN_B1213 hypothetical protein from Brucella canis ATCC 23365
28% identity, 86% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...BMEII0113, ugpA BruAb21118 BRA1181 BOV_A1085 BCAN_B1213 OSP Oligosaccharide or polyol import IM BMEII0114, ugpE BruAb21117 BRA1182 BOV_A1084 BCAN_B1212 OSP Oligosaccharide or polyol import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...BruAb21119 BRA1183 BOV_A1086 BCAN_B1214 OSP Oligosaccharide or polyol import IM BMEII0113, ugpA BruAb21118 BRA1181 BOV_A1085 BCAN_B1213 OSP Oligosaccharide or polyol import IM BMEII0114, ugpE BruAb21117 BRA1182 BOV_A1084 BCAN_B1212 OSP Oligosaccharide or polyol import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541...”

NGR_c17820 carbohydrate ABC transporter permease from Sinorhizobium fredii NGR234
NGR_c17820 putative transmembrane component of ABC transporter from Rhizobium sp. NGR234
29% identity, 70% coverage

• Calcium Induces the Cleavage of NopA and Regulates the Expression of Nodulation Genes and Secretion of T3SS Effectors in Sinorhizobium fredii NGR234
  Kim, International journal of molecular sciences 2024
  • “...putative malonate transporter NGR_c14480 0.264455112 2-octaprenyl-6-methoxyphenol hydroxylase NGR_c16750 3.270277309 putative ATP-binding component of ABC transporter NGR_c17820 3.479463771 putative transmembrane component of ABC transporter NGR_c17830 5.767996243 probable sugar ABC transporter substrate-binding protein NGR_c30950 4.271123502 putative ATP-binding protein of sugar ABC transporter NGR_c30960 3.952674083 putative ATP-binding protein of...”

BAB2_0548 Vacuolar H+-transporting two-sector ATPase, C subunit:Binding-protein-dependent transport systems inner membrane component:Ar... from Brucella melitensis biovar Abortus 2308
27% identity, 89% coverage

• Endoribonuclease YbeY Is Linked to Proper Cellular Morphology and Virulence in Brucella abortus
  Budnick, Journal of bacteriology 2018
  • “...an ABC transporter periplasmic binding protein), and bab2_0548 (encoding an ABC transporter permease), were shown previously to be differentially expressed in...”
  • “...(encoding an ABC transporter periplasmic binding protein), bab2_0548 (encoding an ABC transporter permease), bab2_0830 (encoding an ABC transporter periplasmic...”
• Molecular control of gene expression by Brucella BaaR, an IclR-type transcriptional repressor
  Herrou, The Journal of biological chemistry 2018
  • “...BetI TetR transcriptional regulator; bab1_0914, DUF1127; bab2_0548, ABC transmembrane transporter). B, genomic organization of the bab2_0213- bab2_0217 operon....”
  • “...TetR transcriptional regulator), bab1_0914 (DUF1127), and bab2_0548 (ABC transmembrane transporter) also showed significant differential regulation in our data...”
• Evaluation of the effects of erythritol on gene expression in Brucella abortus
  Rodríguez, PloS one 2012
  • “...BAB2_0491 0.55 0.47 Extracellular solute-binding protein COG1653G BAB2_0547 0.61 0.48 Solute-binding family 1 protein COG1653G BAB2_0548 0.67 0.34 Vacuolar H+-transporting ATPase COG1175G BAB2_0712 0.40 Branched chain ketoacid dehydrogenase COG1249C BAB2_0713 0.57 Branched chain ketoacid dehydrogenase COG0508C BAB2_0714 0.53 0.44 Branched chain ketoacid dehydrogenase COG0022C BAB2_0715 0.46...”
  • “...subsequent increased growth. On the other hand, we found 3 down-regulated genes, BAB2_0491, BAB2_0547 and BAB2_0548, ( Table S2 ), that are putatively involved in sugar transport systems. This could indicate that erythritol up-regulates its own transport while down-regulates the transport of other sugars. When Brucella...”

BPHYT_RS16110 ABC transporter for D-Sorbitol, permease component 2 from Burkholderia phytofirmans PsJN
31% identity, 68% coverage

• mutant phenotype: Specific phenotypes on D-Sorbitol.

BOV_A1085 putative sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
28% identity, 86% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...ugpC BruAb21119 BRA1183 BOV_A1086 BCAN_B1214 OSP Oligosaccharide or polyol import IM BMEII0113, ugpA BruAb21118 BRA1181 BOV_A1085 BCAN_B1213 OSP Oligosaccharide or polyol import IM BMEII0114, ugpE BruAb21117 BRA1182 BOV_A1084 BCAN_B1212 OSP Oligosaccharide or polyol import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM...”

Pf6N2E2_1962 ABC transporter for D-sorbitol, permease component 1 from Pseudomonas fluorescens FW300-N2E2
29% identity, 71% coverage

• mutant phenotype: # Reannotated based on fitness data for other genes in the operon. We have no fitness data for this gene.

ERH_0414 carbohydrate ABC transporter permease from Erysipelothrix rhusiopathiae str. Fujisawa
26% identity, 84% coverage

• Proteomic and Transcriptomic Analyses of Swine Pathogen Erysipelothrix rhusiopathiae Reveal Virulence Repertoire
  Li, PloS one 2016
  • “...down ERH_1399 gi|336065655 ABC transporter permease 6.1 2 1.522 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific up ERH_0414 gi|336065992 citrate-sodium symporter 9.7 4 2.961 ABC-type sugar transport systems, permease components gi|336065983 GntR family transcriptional regulator 37.6 8 1.991 Na+/citrate symporter gi|336066469 hypothetical protein 16.9 2 1.753 Transcriptional regulators...”
• The genome of Erysipelothrix rhusiopathiae, the causative agent of swine erysipelas, reveals new insights into the evolution of firmicutes and the organism's intracellular adaptations
  Ogawa, Journal of bacteriology 2011
  • “...ERH_0199, ERH_0226, ERH_0227, ERH_0228, ERH_0413, ERH_0414, ERH_0417, ERH_1083, ERH_1084, ERH_1085, ERH_1244, ERH_1245, ERH_1246, ERH_1523 ERH_0895, ERH_0896,...”

SUB0163 binding-protein-dependent transport system membrane protein from Streptococcus uberis 0140J
23% identity, 83% coverage

• Evidence for niche adaptation in the genome of the bovine pathogen Streptococcus uberis
  Ward, BMC genomics 2009
  • “...]. Downstream of this CDS there are two other CDSs that make a putative operon: SUB0163, binding-protein-dependent transport system membrane protein; and SUB0164, a fusion protein pseudogene. This latter CDS consists of an N-terminus similar to ABC transporter permease proteins and a C-terminus similar to fibronectin...”

A7MGF8 sn-glycerol-3-phosphate transport system permease protein UgpA from Cronobacter sakazakii (strain ATCC BAA-894)
25% identity, 81% coverage

• Subtractive genomics study for the identification of therapeutic targets against Cronobacter sakazakii: A threat to infants
  Ahammad, Heliyon 2024
  • “...Terbinafine drug target 8 MDK1145284 A7MLX6 Protein translocase subunit SecD 50.0 Novel target 9 AKE94145.1 A7MGF8 glycerol-3-phosphate transporter permease 50.0 Novel target 10 AKE96777.1 A7MEY8 glutamine transport system permease protein GlnP 50.0 Novel target 3.7 Druggability of essential protein The DrugBank was used to analyze the...”

TC 3.A.1.1.38 / Q9WYQ0 ABC-type transporter, integral membrane subunit, component of Inositol phosphate porter (Rodionova et al. 2013). Binds inositol phosphate with low Kd and inositol with a lower affinity from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
TM0419 sugar ABC transporter, permease protein from Thermotoga maritima MSB8
28% identity, 79% coverage

• substrates: Inositol phosphate
• Several archaeal homologs of putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugars
  Nanavati, Applied and environmental microbiology 2006
  • “...Abbreviation of substrate dppAb dppB dppC dppD dppF TM0418 TM0419 TM0420 TM0421 SBP MSP MSP ABP 2 inoE inoF inoG inoK myo-Inositol transport TM1419, ino1...”
• Transcriptional analysis of biofilm formation processes in the anaerobic, hyperthermophilic bacterium Thermotoga maritima
  Pysz, Applied and environmental microbiology 2004
  • “...2.8 2.8 2.8 2.7 2.7 10.2 12.2 7.9 9.3 9.2 COG1175 TM0419 2.7 11.0 COG2182 TM0418 2.7 6.9 COG0715 TM0484 2.6 5.9 (65) COG1225, 59% identity, 157 aa with T....”
  • “...TM0397 TM0398 Sugar and iron transportb TM0417 TM0418 TM0419 TM0420 TM0421 a TM0754 TM0755 Continued on following page Downloaded from http://aem.asm.org/ on...”

BAD_RS07410 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
25% identity, 77% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...permease 160.73 12.98 BAD_RS05940 3.51 MFS transporter 6.71 0.59 BAD_RS01050 3.47 Shikimate kinase 173.6 15.68 BAD_RS07410 3.27 ABC transporter permease 159.79 16.53 BAD_RS07415 3.23 ABC transporter, solutebinding protein 486.74 51.88 BAD_RS08735 3.18 RNA polymerase sigma factor 18.24 2.01 BAD_RS00260 3.01 hsp20/alpha crystallin family protein 13,180.79 1,634.87...”
  • “...Linear FMPK value XOS Xylose BAD_RS07405 3.02 amyC Multiple sugarbinding transport system permease 105.08 12.98 BAD_RS07410 3.27 amyD ABC transporter permease 159.79 15.53 BAD_RS07415 2.80 mdxE ABC transporter, solutebinding protein 360.4 51.88 BAD_RS02255 3.00 yurO Sugar ABC transporter substratebinding protein 7,940.17 989.28 BAD_RS01495 2.69 TP_0034 ABC...”

cg1568 sn-glycerol-3-phosphate transport system permease protein from Corynebacterium glutamicum ATCC 13032
29% identity, 57% coverage

• Single-Domain Peptidyl-Prolyl cis/trans Isomerase FkpA from Corynebacterium glutamicum Improves the Biomass Yield at Increased Growth Temperatures
  Kallscheuer, Applied and environmental microbiology 2015
  • “...cg3202 cg2114 cg2613 cg0967 cg3255 cg2113 cg2500 cg1003 cg1568 cg1164 cg2833 cg0973 cg2182 cg1853 cg2181 cg1606 cg3186 cg1053 cg0848 cg1108 cg0172 cg0197 cg1169...”
• Regulation of the pstSCAB operon in Corynebacterium glutamicum by the regulator of acetate metabolism RamB
  Sorger-Herrmann, BMC microbiology 2015
  • “...permease 5.2 cg2868 nucH , putative nuclease 5.4 cg0812 accD1 , acetyl-CoA carboxylase subunit 11.3 cg1568 ugpA , glycerol 3-phosphate ABC transporter, permease 31.2 a Gene identifiers and annotations are given according to BX927147 b The mRNA levels were derived from two independent cultivations Discussion Here...”

RL4217 putative mannitol transmembrane permease component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
30% identity, 72% coverage

• The Use of Transposon Insertion Sequencing to Interrogate the Core Functional Genome of the Legume Symbiont Rhizobium leguminosarum
  Perry, Frontiers in microbiology 2016
  • “...transporter CUT1 mannitol transporter (S. Mel SBP homolog smc01496 induced by dulcitol, sorbitol, mannitol) 1.0 RL4217 mtlF Mannitol transmembrane permease component of ABC transporter VGI 0.53 2.78 GD 0.94 36.06 NE 1.5.3 Putative permease component of ABC transporter CUT1 mannitol transporter (S. Mel SBP homolog smc01496...”

BBMN68_218 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
26% identity, 86% coverage

• Transcriptomic analysis of Bifidobacterium longum subsp. longum BBMN68 in response to oxidative shock
  Zuo, Scientific reports 2018
  • “...system periplasmic component 2.03 1.98 BBMN68_217 MalF-type ABC sugar transport systems permease component 2.66 1.62 BBMN68_218 MalG-type ABC sugar transport system permease component 1.74 1.49 BBMN68_219 Transmembrane transport protein 2.06 2.07 BBMN68_1264 Transmembrane transporter activity; MFS transporter (putative metabolite:H + symporter) 1.63 1.52 BBMN68_157 Peptide transport...”
• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...transport systems BBMN68_217 126.78 68.48 1.85 G COG1653 K02027, multiple sugar transport system substrate-binding protein BBMN68_218 141.02 73.47 1.92 G COG1175 K02025, multiple sugar transport system permease protein BBMN68_219 147.02 72.27 2.03 * G COG0395 K02026, multiple sugar transport system permease protein BBMN68_1724 54.21 114.46 2.11...”

BOV_A0647 putative sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
BRA0692 sugar ABC transporter, permease protein, putative from Brucella suis 1330
BCAN_B0690 Probable starch degradation products transport system permease protein amyD from Brucella canis ATCC 23365
27% identity, 89% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568, ugpC BRA0658, ugpC BOV_A0620 BCAN_B0658 OSP SN-glycerol-3-phosphate import IM...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import ABC BMEII0621, ugpC BruAb20568,...”

TC 3.A.1.1.11 / Q93KC0 TogM, component of Saturated and unsaturated oligogalacturonide transporter, TogMNAB (transports di- to tetrasaccharide pectin degradation products which consist of D-galacuronate, sometimes with 4-deoxy-L-threo-5-hexosulose uronate at the reducing end of the oligosaccharide) (Hugouvieux-Cotte-Pattat et al. 2001). Regulated by pectin utilization regulator KdgR from Erwinia chrysanthemi (see paper)
29% identity, 78% coverage

• substrates: Oligogalacturonides

TC 3.A.1.1.22 / Q9X0T0 MalF1; aka Maltose ABC transporter, permease protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins from Thermotoga maritima (see paper)
TM1203 maltose ABC transporter, permease protein from Thermotoga maritima MSB8
28% identity, 41% coverage

• substrates: Maltose, Maltotetraose, Maltotriose, Trehalose
• Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
  Noll, BMC evolutionary biology 2008
  • “...TM1195 TM0810 TM1193 TM1200 TM1200 TM1200 TM1200 TM1201 TM1201 TM1201 TM1201 TM1202 TM1202 TM1202 TM1202 TM1203 TM1203 TM1203 TM1203 TM1204 TM1204 TM1204 TM1204 TM1578 TM1205 TM1217 TM1205 TM0372 X TM1206 TM1218 TM1206 X TM1581 TM1207 TM1219 TM1207 TM0945 TM0009 TM1875 TM1208 TM1220 TM1208 TM1851 TM1581 TM1209...”
  • “...TM1833 TM1828 TM1417 TM1103 TM1835 TM1834 TM1834 TM0690 TM1836 TM1835 TM1835 TM1837 TM1836 TM1836 TM1838 TM1203 TM1203 TM1839 TM1839 TM1839 TM1840 TM1840 TM1840 TM1841 TM1841(split?) TM1841 TM1842 X TM1842 TM1843 X TM1843 TM1844 TM1844 TM1844 TM1845 TM1845 TM1845 Bold, transporter ORFs; Italics, has at least one...”
• Several archaeal homologs of putative oligopeptide-binding proteins encoded by Thermotoga maritima bind sugars
  Nanavati, Applied and environmental microbiology 2006
  • “...Annotated by TIGR (34) rbsC1 rbsA1 rbsB1 rbsD TM1202 TM1203 TM1204 MSP MSP SBP 1 malG1 malF1 malE1 Maltose transportc Annotated by TIGR (34) malG1 malF1 malE1...”
• Substrate specificities and expression patterns reflect the evolutionary divergence of maltose ABC transporters in Thermotoga maritima
  Nanavati, Journal of bacteriology 2005
  • “...(91% similar), the inner membrane protein homologs MalF1 (TM1203) and MalF2 (TM1837) are 59% identical (74% similar), and MalG1 (TM1202) and MalG2 (TM1836) are...”
• Whole-genome expression profiling of Thermotoga maritima in response to growth on sugars in a chemostat
  Nguyen, Journal of bacteriology 2004
  • “...TM1195, TM1196 TM1197 TM1198 TM1199 TM1200 TM1201 TM1202, TM1203, TM1204, TM1216 TM1837, TM1839, TM1840, Maltose vs glucose VOL. 186, 2004 4827 In aerobes and...”
• Maltose and maltodextrin transport in the thermoacidophilic gram-positive bacterium Alicyclobacillus acidocaldarius is mediated by a high-affinity transport system that includes a maltose binding protein tolerant to low pH
  Hülsmann, Journal of bacteriology 2000
  • “...putative membrane proteins of T. maritima (MalF, 41% with TM1203; MalG, 39% with TM1202). Compared to the E. coli MalF protein and consistent with membrane...”

BL0143 permease of ABC transporter possibly for oligosaccharides from Bifidobacterium longum NCC2705
29% identity, 84% coverage

• The Pleiotropic Effects of Carbohydrate-Mediated Growth Rate Modifications in Bifidobacterium longum NCC 2705
  Duboux, Microorganisms 2023
  • “...malR2 0.349 0.664 Transcr. regulator of maltose/maltodextrin utilization, LacI family BL0529 aglA 0.925 0.063 Alpha-glucosidase BL0143 malF 0.713 0.222 Maltose/maltodextrin ABC transporter BL0144 malG 0.699 0.263 Maltose/maltodextrin ABC transporter...”
• Maltose uptake by the novel ABC transport system MusEFGK2I causes increased expression of ptsG in Corynebacterium glutamicum
  Henrich, Journal of bacteriology 2013
  • “...MusI. In B. longum, the ORF bl0145 is directly following bl0143 and bl0144, which encode TMDs of the maltose ABC importer (77). In S. agalactiae 2603, the ORF...”

YPTB0502 ABC type sugar transport system, permease protein from Yersinia pseudotuberculosis IP 32953
26% identity, 82% coverage

• IscR is essential for yersinia pseudotuberculosis type III secretion and virulence
  Miller, PLoS pathogens 2014
  • “...subunit) eif 2.2 YPTB1266 putative outer membrane-associated protease pla2 2.2 Transport and Binding Proteins (8) YPTB0502 ABC type sugar transport system, permease 2.0 YPTB0868 putative amino acid ABC transporter, permease 2.5 YPTB1724 SSS family proline symporter putP 2.4 YPTB1956 calcium/proton antiporter chaA 2.7 YPTB2011 SulP family...”

SPD_1584 ABC transporter, permease protein from Streptococcus pneumoniae D39
27% identity, 71% coverage

• Deletion of the Zinc Transporter Lipoprotein AdcAII Causes Hyperencapsulation of Streptococcus pneumoniae Associated with Distinct Alleles of the Type I Restriction-Modification System
  Durmort, mBio 2020
  • “...3.25 4.03 1.09 SPD_1513 Hypothetical protein 1.77 2.68 1.40 SPD_1568 GTP cyclohydrolase 1.80 1.55 1.53 SPD_1584 ABC transporter permease 2.30 2.16 2.08 SPD_1650 fatC Iron uptake ABC transporter permease 2.84 2.23 1.30 SPD_1793 Universal stress protein family 1.54 1.74 2.00 SPD_1865 adh Zinc-containing alcohol dehydrogenase 1.59...”

spr1619 ABC transporter membrane-spanning permease - sugar transporter from Streptococcus pneumoniae R6
27% identity, 71% coverage

• Determination of accessory gene patterns predicts the same relatedness among strains of Streptococcus pneumoniae as sequencing of housekeeping genes does and represents a novel approach in molecular epidemiology
  Dagerhamn, Journal of clinical microbiology 2008
  • “...SP_0308 R6 locus Description spr0106 spr1403 spr1619 Transporter truncation Hypothetical protein ABC transporter, membrane-spanning permease, sugar transporter...”

BMEII0113 SN-GLYCEROL-3-PHOSPHATE TRANSPORT SYSTEM PERMEASE PROTEIN UGPA from Brucella melitensis 16M
29% identity, 74% coverage

• Coincidence cloning recovery of Brucella melitensis RNA from goat tissues: advancing the in vivo analysis of pathogen gene expression in brucellosis
  Boggiatto, BMC molecular biology 2018
  • “...N Repressed No change BMEII0111 ICC protein family 2227 136 3.2 N Activated No change BMEII0113 sn-Glycerol-3-phosphate transport system UgpA 3026 94 3.2 N Repressed No change BMEII0114 sn-Glycerol-3-phosphate transport system UgpE 2611 254 2.9 Y Repressed No change BMEII0167 FlhA2 flagellar biosynthesis protein 2902 71...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...polyol import ABC BMEII0112, ugpC BruAb21119 BRA1183 BOV_A1086 BCAN_B1214 OSP Oligosaccharide or polyol import IM BMEII0113, ugpA BruAb21118 BRA1181 BOV_A1085 BCAN_B1213 OSP Oligosaccharide or polyol import IM BMEII0114, ugpE BruAb21117 BRA1182 BOV_A1084 BCAN_B1212 OSP Oligosaccharide or polyol import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide...”

TC 3.A.1.1.20 / Q7WWQ9 Transmembrane permease MsmF, component of The fructooligosaccharide porter, MsmEFGK from Lactobacillus acidophilus (see 2 papers)
msmF / GI|33149339 transmembrane permease MsmF from Lactobacillus acidophilus (see paper)
27% identity, 76% coverage

• substrates: Fructooligosaccharides

SMc04258 ABC transporter for D-Cellobiose and D-Salicin, permease component 2 from Sinorhizobium meliloti 1021
SMc04258 PUTATIVE TRANSPORT SYSTEM PERMEASE ABC TRANSPORTER PROTEIN from Sinorhizobium meliloti 1021
28% identity, 69% coverage

• mutant phenotype: Specific phenotypes on D-Cellobiose; D-Salicin.
• Temporal expression program of quorum sensing-based transcription regulation in Sinorhizobium meliloti
  Charoenpanich, Journal of bacteriology 2013
  • “...sites upstream of cspA3, nesR, SMb21135, SMc01524, SMc04246, and SMc04258 are among the weakest. For the SMc04258 and nesR promoters, a weak shift is observable...”
  • “...(exoP2), SMc01711, SMc03149, SMc04032 (nesR), SMc04232, and SMc04258. For regions containing an ExpR binding site but lacking detectable promoter activity, it...”

TTH_RS04965 carbohydrate ABC transporter permease from Thermus thermophilus HB8
31% identity, 81% coverage

• Comparison of carbohydrate ABC importers from Mycobacterium tuberculosis
  De, BMC genomics 2021
  • “...and white: environmental species, represented by M. smegmatis. The amino acid sequences of TTH_RS04960 and TTH_RS04965 from Thermus thermophilus , encoding putative carbohydrate TMDs, were used as outgroup. B Structural models of SugB, Rv2039c, UspB, UgpE and SugA, Rv2040c, UspA, and UgpA highlighting the regions that...”

SCO0532 sugar transporter membrane protein from Streptomyces coelicolor A3(2)
24% identity, 84% coverage

• The dasABC gene cluster, adjacent to dasR, encodes a novel ABC transporter for the uptake of N,N'-diacetylchitobiose in Streptomyces coelicolor A3(2)
  Saito, Applied and environmental microbiology 2007
  • “...Amino acid sequencea Position of the signature sequence SCO0532 SCO0533 SCO2945 SCO2944 SCO5233 (DasB) SCO5234 (DasC) 302 285 316 281 328 276...”

alr2532 sugar ABC transport system, permease protein from Nostoc sp. PCC 7120
28% identity, 83% coverage

• Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
  Stebegg, Journal of bacteriology 2012
  • “...all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and alr5368) are currently annotated...”

YPTB1914 ABC sugar (sorbitol/trehalose/maltose) transporter, permease subunit from Yersinia pseudotuberculosis IP 32953
25% identity, 78% coverage

• Genome-wide assessment of antimicrobial tolerance in Yersinia pseudotuberculosis under ciprofloxacin stress
  Willcocks, Microbial genomics 2019
  • “...guanylyltransferase YPTB1012 wbyL Probable glycosyltransferase YPTB1453 ompA Outer membrane protein YPTB1622 pagP Lipid A palmitoyltransferase YPTB1914 YPTB1914 ABC sugar (sorbitol/trehalose/maltose) transporter, permease subunit YPTB2014 YPTB2014 Putative ABC transporter YPTB2327 pmrJ Probable 4-deoxy-4-formamido- l -arabinose-phosphoundecaprenol deformylase YPTB3041 ygeD Lysophospholipid transporter YPTB3407 rfaE Bifunctional protein - ADP- l...”

SPy0254 sugar transport system (permease) from Streptococcus pyogenes M1 GAS
23% identity, 85% coverage

• New Pathogenesis Mechanisms and Translational Leads Identified by Multidimensional Analysis of Necrotizing Myositis in Primates
  Kachroo, mBio 2020
  • “...spd3 Streptodornase Spy1179 5.3 19.4 Spy1415 sdaD2 Phage-encoded streptodornase Spy1430 2.9 4.6 Spy1684 ska Streptokinase Spy0254 NS 6.3 Spy1715 scpA C5A peptidase precursor Spy1697 NS 3.8 Spy1718 sic Streptococcal inhibitor of complement Spy1699 7.6 18.5 Spy1723 isp e Immunogenic secreted protein Spy1703 8.4 3.5 Spy1734 spi...”

ERH_1245 carbohydrate ABC transporter permease from Erysipelothrix rhusiopathiae str. Fujisawa
28% identity, 74% coverage

• Proteomic and Transcriptomic Analyses of Swine Pathogen Erysipelothrix rhusiopathiae Reveal Virulence Repertoire
  Li, PloS one 2016
  • “...Uncharacterized conserved protein up ERH_1687 gi|322463680 ABC transporter, permease protein 2.3 1 17.319 Unknown down ERH_1245 gi|336066678 glycosyltransferase family protein 32.8 11 1.543 ABC-type sugar transport systems, permease components down ERH_1442 gi|336065843 hypothetical protein (Glycosyltransferases) 15.4 2 1.706 Glycosyltransferases involved in cell wall biogenesis gi|336066252 dephospho-CoA...”
• The genome of Erysipelothrix rhusiopathiae, the causative agent of swine erysipelas, reveals new insights into the evolution of firmicutes and the organism's intracellular adaptations
  Ogawa, Journal of bacteriology 2011
  • “...ERH_0417, ERH_1083, ERH_1084, ERH_1085, ERH_1244, ERH_1245, ERH_1246, ERH_1523 ERH_0895, ERH_0896, ERH_1350, ERH_1351, ERH_1352, ERH_1517. ERH_1518, ERH_1519,...”

Y11_07561 carbohydrate ABC transporter permease from Yersinia enterocolitica subsp. palearctica Y11
29% identity, 78% coverage

• RNA-Sequencing Reveals the Progression of Phage-Host Interactions between φR1-37 and Yersinia enterocolitica
  Leskinen, Viruses 2016
  • “...Y11_14731 Mg(2+) transport ATPase protein C 3.63 Y11_29801 Phosphate transport system permease protein PstC 3.59 Y11_07561 Putative ABC sugar transporter 2.70 Y11_26421 Uncharacterized ABC transporter, permease component YrbE 1.99 Y11_43381 Phosphate transport system permease protein PstC 1.70 Y11_29811 Phosphate transport system permease protein PstA 1.68 Y11_00591...”

Bbr_1657 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
24% identity, 87% coverage

• Genome-Wide Search for Genes Required for Bifidobacterial Growth under Iron-Limitation
  Lanigan, Frontiers in microbiology 2017
  • “...+++ ++ No Bbr_1656 Sugar ABC transporter, permease protein +++ ++ ++ ++ ++ No Bbr_1657 Binding-protein-dependent transport system +++ ++ ++ ++ ++ No Bbr_1669 Hypothetical membrane spanning protein ++ + ++ No Bbr_1816 oppC , permease protein iron siderophore uptake +++ +++ ++ +++...”
• A two-component regulatory system controls autoregulated serpin expression in Bifidobacterium breve UCC2003
  Alvarez-Martin, Applied and environmental microbiology 2012
  • “...Increased expression Bbr_1318 Bbr_1319 Bbr_1656 Bbr_1657 Bbr_1658 Bbr_1655 Bbr_0249 Bbr_0107 Bbr_1464 Bbr_0106 Bbr_1320 Bbr_0108 Bbr_1293 Bbr_1434...”
  • “...Bbr_1656; sugar ABC transporter, permease protein Bbr_1657; sugar-binding protein of ABC transporter system 2045106:2046023, reverse; MW, 33,668 Bbr_1658;...”

lpg1731 sn-glycerol-3-phosphate transmembrane ABC transporter from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
26% identity, 82% coverage

• Characterization of Legionella pneumophila pmiA, a gene essential for infectivity of protozoa and macrophages
  Miyake, Infection and immunity 2005
  • “...there are five ORFs up- and downstream of pmiA (lpg1731, lpg1730, lpg1729, lpg1727, and lpg1726), whose direction of transcription was the same as that of pmiA....”

C289_0779 carbohydrate ABC transporter permease from Anoxybacillus ayderensis
25% identity, 83% coverage

• A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
  Kahar, International journal of molecular sciences 2013
  • “...C289_1909, and C289_2139). Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the National Center for Biotechnology Information (NCBI) Bioproject...”

BMEII0591 SUGAR TRANSPORT SYSTEM PERMEASE PROTEIN from Brucella melitensis 16M
27% identity, 93% coverage

• Transcriptomic Analysis of the Brucella melitensis Rev.1 Vaccine Strain in an Acidic Environment: Insights Into Virulence Attenuation
  Salmon-Divon, Frontiers in microbiology 2019
  • “...Magnesium-translocating P-type ATPase Upregulation BMEII0077 Isochorismate synthase Upregulation BMEII0361 Sugar ABC transporter ATP-binding protein Upregulation BMEII0591 Sugar ABC transporter permease Upregulation BMEII0761 Thiol reductant ABC exporter subunit CydC Downregulation BMEII0762 Thiol reductant ABC exporter subunit CydD Downregulation BMEII0923 ABC transporter substrate-binding protein Upregulation BMEII0931 Class Ib...”
  • “...from the RNA-seq experiment, we conducted a real-time qPCR analysis of five selected genes (BMEII0027, BMEII0591, BMEI1980, BMEII1116, and BMEI1040), from both strains (16M and Rev.1), grown under either low- or normal-pH conditions. The mRNA levels of all genes obtained by the RT-qPCR were in high...”
• Main functions and taxonomic distribution of virulence genes in Brucella melitensis 16 M
  Brambila-Tapia, PloS one 2014
  • “...BMEI2031 ptsH Phosphocarrier protein HPr G 273 [8] BMEII0485 galcD D-galactarate dehydratase G 185 [7] BMEII0591 BMEII0591 Sugar transport system permease G 119 [7] BMEII0624 ugpA SN-glycerol-3-phosphate transport system permease G 136 [7] BMEII0899 BMEII0899 Phosphomannomutase G 32 [8] BMEII0935 BMEII0935 Nickel resistance protein G 184...”
• Erythritol triggers expression of virulence traits in Brucella melitensis
  Petersen, Microbes and infection 2013
  • “...Ribose 5-phosphate isomerase 2.51 0.95 BMEII0425 Triosephosphate isomerase 1.97 0.61 BMEII0590 Sugar-binding protein 20.38 1.00 BMEII0591 Sugar transport system permease protein 6.93 1.00 BMEII0592 Sugar transport system permease protein 7.56 1.00 BMEII0593 Glucose ABC transporter ATPase 4.11 1.00 Other BMEI0095 Succinoglycan biosynthesis regulator 2.39 0.95 BMEI0102...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...or polyol import BP BMEII0590 BruAb20537 BRA0693 BOV_A0648 BCAN_B0691 OSP Oligosaccharide or polyol import IM BMEII0591 BruAb20538 BRA0691 BOV_A0647 BCAN_B0690 OSP Oligosaccharide or polyol import IM BMEII0592 BruAb20539 BRA0692 BOV_A0646 BCAN_B0689 OSP Oligosaccharide or polyol import ABC BMEII0593 BruAb20540 BRA0690 BOV_A0645 BCAN_B0688 79 OSP SN-glycerol-3-phosphate import...”
• Attenuated signature-tagged mutagenesis mutants of Brucella melitensis identified during the acute phase of infection in mice
  Lestrate, Infection and immunity 2003
  • “...protein Hypothetical protein BMEI0359 BMEI1069 BMEII0591 BMEII0624 BMEI0433 BMEI0624 BMEI0705 BMEI1301 BMEII0485 BMEII0823 BMEI0357 BMEI1336 BMEII1066...”

SP_1682 sugar ABC transporter, permease protein from Streptococcus pneumoniae TIGR4
24% identity, 83% coverage

• Biofilm formation in Streptococcus pneumoniae
  Domenech, Microbial biotechnology 2012
  • “...( fibA /SP_0615, murE /SP_1531, murB /SP_1390), the ABC and PTS transporters ( aliB /SP_1527, SP_1682, SP_0137), the proteolytic and ATPbinding subunits of the Clp proteases family ( clpP /SP_0746, clpX /SP_1569, clpC /SP_1294), the components of the shikimate pathway for synthesis of isochorismate ( aroK...”
• Insights into the evolution of sialic acid catabolism among bacteria
  Almagro-Moreno, BMC evolutionary biology 2009
  • “.... Challis substr. CH1 SAT 2 SGO_0122 1.00E-130 Streptococcus pneumoniae TIGR4 a SAT 2/3 SP_1688 SP_1682 3.00E-131 Streptococcus pneumoniae TIGR4 b Sym SP_1328 8.00E-59 Streptococcus pyogenes M1 GAS SAT 3 Spy_254 seed Streptococcus sanguinis SK36 SAT 2 SSA_0076 seed Vibrio cholerae N16961 TRAP VC1777 seed Vibrio...”

SAG0035 sugar ABC transporter, permease protein from Streptococcus agalactiae 2603V/R
24% identity, 82% coverage

• Maltose uptake by the novel ABC transport system MusEFGK2I causes increased expression of ptsG in Corynebacterium glutamicum
  Henrich, Journal of bacteriology 2013
  • “...encoding a further hypothetical protein, from the ORFs sag0034, sag0035, and sag0036, which encode the SBP and the TMDs of the NanT ABC importer for sialic acid...”
• Insights into the evolution of sialic acid catabolism among bacteria
  Almagro-Moreno, BMC evolutionary biology 2009
  • “...Sym SH0283 0 Staphylococcus saprophyticus ATCC 15305 Sym SSP0376 seed Streptococcus agalactiae 2603V/R SAT 3 SAG0035 4.00E-121 Streptococcus gordonii str . Challis substr. CH1 SAT 2 SGO_0122 1.00E-130 Streptococcus pneumoniae TIGR4 a SAT 2/3 SP_1688 SP_1682 3.00E-131 Streptococcus pneumoniae TIGR4 b Sym SP_1328 8.00E-59 Streptococcus pyogenes...”

TC 3.A.1.1.50 / Q5SLB6 Sugar ABC transporter, permease protein, component of Probable glycerophosphocholine (GPC) uptake porter (Chandravanshi et al. 2016). The system may include a receptor and three membrane proteins (of 378 aas and 6 TMSs, 299 aas and 7 TMSs, and 113 aas and 3 TMSs (?). The ATPase has not been identified from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
29% identity, 79% coverage

• substrates: glycerophosphocholine

SPD_1494 sugar ABC transporter, permease protein from Streptococcus pneumoniae D39
24% identity, 82% coverage

• N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
  Afzal, Frontiers in cellular and infection microbiology 2016
  • “...system, mannose-specific IIC component, ManM 3.2 spd_0262 PTS system, mannose/fructose/sorbose family protein, IID component 3.0 spd_1494 Sugar ABC transporter, permease protein 2.7 spd_1493 Sugar ABC transporter, permease protein 2.4 spd_1866 N-acetylglucosamine-6-phosphate deacetylase, NagA 2.4 spd_1846 PTS system, IIB component 2.3 spd_1246 glucosamine-6-phosphate isomerase, NagB 2.3 spd_0264...”
• N-acetylgalatosamine-Mediated Regulation of the aga Operon by AgaR in Streptococcus pneumoniae
  Afzal, Frontiers in cellular and infection microbiology 2016
  • “...Hypothetical protein 7.4 spd_1492 Hypothetical protein 3.9 spd_1493 Sugar ABC transporter, permease protein, NanW 4.8 spd_1494 Sugar ABC transporter, permease protein, NanV 2.5 spd_1495 Sugar ABC transporter, sugar-binding protein, NanU 6.4 spd_1496 PTS system, IIBC components, NanP 3.2 spd_1497 N-acetylmannosamine-6-phosphate 2-epimerase 2, NanE 3.1 spd_1504 Sialidase...”
• Sialic acid-mediated gene expression in Streptococcus pneumoniae and role of NanR as a transcriptional activator of the nan gene cluster
  Afzal, Applied and environmental microbiology 2015
  • “...spd_1488 spd_1489 spd_1490 spd_1491 spd_1492 spd_1493 spd_1494 spd_1495 spd_1496 spd_1497 spd_1504 spd_1505 spd_1800 spd_2012 spd_2013 Downregulated genes...”
  • “...spd_1491 spd_1492 spd_1493 5.0 4.6 spd_1495 5.9 spd_1494 spd_1496 spd_1497 a D39 annotation or TIGR4 annotation (27). PTS, phosphotransferase system. Fold...”
• Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
  Paixão, Frontiers in microbiology 2015
  • “...1.48 SPD_1409 Sugar ABC transporter, ATP-binding protein 0.52 SPD_1493 Sugar ABC transporter, permease protein 0.61 SPD_1494 Sugar ABC transporter, permease protein 0.54 SPD_1495 Sugar ABC transporter, sugar-binding protein 0.56 SPD_1496 PTS system, IIBC components 0.48 0.72 SPD_1832 PTS system, IIB component 0.54 SPD_1833 PTS system, IIA...”
• Host glycan sugar-specific pathways in Streptococcus pneumoniae: galactose as a key sugar in colonisation and infection [corrected]
  Paixão, PloS one 2015
  • “...17.6 SPD_0559 PTS system transporter subunit IIA 15.1 SPD_0560 PTS system transporter subunit IIB 12.1 SPD_1494 Sugar ABC transporter permease 10.3 SPD_0070 agaS Sugar isomerase 9.8 SPD_0063 strH Beta-N-acetylhexosaminidase 8.7 SPD_1663 treC Alpha,alpha-phosphotrehalase 8.0 SPD_0066 PTS system transporter subunit IIB 7.8 SPD_0287 Hyaluronate lyase 7.7 SPD_1495...”

Tsac_1344 carbohydrate ABC transporter permease from Thermoanaerobacterium saccharolyticum JW/SL-YS485
30% identity, 72% coverage

• Profile of secreted hydrolases, associated proteins, and SlpA in Thermoanaerobacterium saccharolyticum during the degradation of hemicellulose
  Currie, Applied and environmental microbiology 2014
  • “...(Tsac_1445 through Tsac_1464 for xylan/xylose and Tsac_1344 through Tsac_1349 for starch). A phosphotransferase system subunit, Tsac_0032, also appeared...”
  • “...clusters (Tsac_1445 through Tsac_1464 for xylan/xylose and Tsac_1344 aem.asm.org 5007 Downloaded from http://aem.asm.org/ on February 11, 2017 by University of...”

Ava_0461 Binding-protein-dependent transport systems inner membrane component from Anabaena variabilis ATCC 29413
28% identity, 83% coverage

• Cell-specific gene expression in Anabaena variabilis grown phototrophically, mixotrophically, and heterotrophically
  Park, BMC genomics 2013
  • “...90 (Ana_C20533) are adjacent to genes Npun_R2793 and Ana_C20534, both of which are orthologs of Ava_0461, annotated as membrane protein 1 in a CUT1 transporter (Additional file 7 ). Our results show that Ava_0461 is also strongly up-regulated in heterocysts, at least in phototrophic (F, V,...”

TRQ7_RS03395 carbohydrate ABC transporter permease from Thermotoga sp. RQ7
27% identity, 87% coverage

• Adapted laboratory evolution of Thermotoga sp. strain RQ7 under carbon starvation
  Gautam, BMC research notes 2022
  • “...Silent: H107 ABC transporters 409,563 TRQ7_RS02130 ABC transporter substrate-binding protein Transition: AG Missense: Q545R 668132 TRQ7_RS03395 Sugar ABC transporter permease Transition: CT Missense: A283V 1046451 TRQ7_RS05215 Sugar ABC transporter ATP-binding protein Transition: CT Missense: A406V 1,049,370 TRQ7_RS05225 Sugar ABC transporter substrate-binding protein Transition: CT Missense: P115S...”

BL1331 probable sugar permease of ABC transporter system from Bifidobacterium longum NCC2705
28% identity, 70% coverage

• Genomic and metabolic studies of the impact of probiotics on a model gut symbiont and host
  Sonnenburg, PLoS biology 2006
  • “...are positioned in the gene cluster referred to above that contains two linked permease genes (BL1331 and BL1332; down-regulated 7.4- and 10.1-fold, respectively) and two other glycoside hydrolase activities (BL1333 [substrate specificity unknown]; BL1335 [endo--N-acetylglucosaminidase]; down-regulated 8.8- and 14.1-fold, respectively; Figure 1 B and 1 D)....”

SACTE_0370 carbohydrate ABC transporter permease from Streptomyces sp. SirexAA-E
32% identity, 67% coverage

• Aerobic deconstruction of cellulosic biomass by an insect-associated Streptomyces
  Takasuka, Scientific reports 2013
  • “...During growth on xylan, two clusters of genes were up-regulated. One extended from SACTE_0357 to SACTE_0370, encoding proteins from the GH11, GH13, GH42, GH43, GH78, GH87, and CE4 families, a LacI-like transcriptional regulator, a secreted peptidase, and two sets of inner membrane transporters and associated solute...”

BF29_RS14615 carbohydrate ABC transporter permease from Heyndrickxia coagulans DSM 1 = ATCC 7050
28% identity, 59% coverage

• Time-resolved transcriptomic and proteomic profiling of <i>Heyndrickxia coagulans</i> during NaOH-buffered L-lactic acid production
  Huang, Frontiers in microbiology 2023
  • “...increases including glycoside-pentoside-hexuronide (GPH): cation symporter (BF29_RS06670), MFS transporter (BF29_RS16105), and sugar ABC transporter permease (BF29_RS14615). Moreover, we noted a substantial increase observed in the expression level of the AraC family transcription factor (BF29_RS14625). 3.3 Comparative proteomic analysis The numbers of DEPs observed at a 5h...”
  • “...acquisition in H. coagulans DSM1-mediated L-LA production. ThuEFG constitutes a trehalose/maltose transport system; with ThuF (BF29_RS14615) and ThuG (BF29_RS14610) serve as permease proteins, and ThuE (BF29_RS14620) acts as the substrate-binding protein ( Jensen et al., 2002 ). Trehalose is widely recognized as a universal stress molecule...”

SPO0239 sn-glycerol-3-phosphate ABC transporter permease UgpA from Ruegeria pomeroyi DSS-3
26% identity, 86% coverage

• Bacterial transcriptional response to labile exometabolites from photosynthetic picoeukaryote Micromonas commoda
  Ferrer-González, ISME communications 2023
  • “...36.3 SN-glycerol-3-phosphate ABC transporter, ATP-binding protein ugpC SPO0238 AAV93563.1 25.4 SN-glycerol-3-phosphate ABC transporter, permease ugpE SPO0239 AAV93564.1 30.3 SN-glycerol-3-phosphate ABC transporter, permease ugpA SPO0240 AAV93565.1 23.7 SN-glycerol-3-phosphate ABC transporter, substrate-binding ugpB SPO0674* AAV93982.1 2.2 taurine ABC transporter, substrate-binding protein tauA SPO0675 AAV93983.1 3.9 taurine ABC transporter,...”
• Growth-stage-related shifts in diatom endometabolome composition set the stage for bacterial heterotrophy
  Olofsson, ISME communications 2022
  • “...0084 DHPS degradation SPO0158 Spermidine transporter SPO3467 Lactic acid transporter SPO1017-1021 Glycolate SPOA0143 Glycerol-3-phosphate transporter SPO0239, 0240 Glycerol transporter SPO0608-0612 Alanine symporter SPO2370 Trimethylamine transporter SPO1551, 1552, 1562 Amino acid transporter SPO1516 Sugar transporter SPO0608-0612 Acetate SPO2963 Polaribacter dokdonensis Hypothetical protein PUL2 MED152_00445 MFS transporter (fucose)...”
• Diel investments in metabolite production and consumption in a model microbial system
  Uchimiya, The ISME journal 2022
  • “...[ 75 ] Glycerol derivative SN-glycerol-3-phosphate SPO0238 ugpE ABC transporter, permease 4.3 [ 25 ] SPO0239 ugpA ABC transporter, permease 3.3 SPO0237 upgC ABC transporter, ATP-binding 3.5 SPO0240 ugpB ABC transporter, periplasmic substrate-binding protein 1.3 (n.s.) Nuceloside Xanthine SPO0654 xdhA Xanthine dehydrogenase, A subunit 33.4 [...”

XNRR2_0970 carbohydrate ABC transporter permease from Streptomyces albidoflavus
27% identity, 80% coverage

• Superior production of heavy pamamycin derivatives using a bkdR deletion mutant of Streptomyces albus J1074/R2
  Gläser, Microbial cell factories 2021
  • “...of the phosphotransferase system (PTS), and a sugar transporter with presumed function as mannitol permease (XNRR2_0970) (Additional file 1 : Table S3). Additionally, two glycolytic genes, i. e. NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (XNRR2_0959) and pyruvate kinase (XNRR2_4449) were down-regulated (Additional file 1 : Table S3). Slight expression...”
  • “...sugar uptake was diminished. The PTS genes (XNRR2_0028, XNRR2_0029), and the mannitol permease encoding gene (XNRR2_0970) were not downregulated in bkdR , different to the wild type. In addition, other PTS components (XNRR2_5450, XNRR2_5451) were slightly upregulated (Additional file 1 : Table S3). Genes associated to...”

mlr7226 sugar ABC transporter, permease protein from Mesorhizobium loti MAFF303099
26% identity, 84% coverage

• Expression islands clustered on the symbiosis island of the Mesorhizobium loti genome
  Uchiumi, Journal of bacteriology 2004
  • “...mlr5876 mlr5943 mlr5932 mll2921 mlr9251 mll7254 mlr7226 Nitrogenase Mo-Fe protein alpha chain; NifD Nitrilotriacetate monooxygenase component A Phosphinothricin...”

C289_0466 carbohydrate ABC transporter permease from Anoxybacillus ayderensis
23% identity, 64% coverage

• A high molecular-mass Anoxybacillus sp. SK3-4 amylopullulanase: characterization and its relationship in carbohydrate utilization
  Kahar, International journal of molecular sciences 2013
  • “...pullulanase (C289_2260), glycosidase (C289_2139), and oligo-1,6-glucosidase (C289_0857, C289_1909, and C289_2139). Several putative sugar transporters (C289_0465, C289_0466, C289_0467, C289_0603, C289_0763, C289_0764, C289_0765, C289_0778, C289_0779, C289_0780, C289_1015, C289_1174, C289_1392, C289_1394, C289_1910, C289_1911, and C289_1912) were also found in the Blast2GO annotation. The draft genome was submitted to the...”

RL4244 putative transmembrane component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
30% identity, 64% coverage

• Transcriptomic analysis of Rhizobium leguminosarum biovar viciae in symbiosis with host plants Pisum sativum and Vicia cracca
  Karunakaran, Journal of bacteriology 2009
  • “...RL2561 RL3016b RL3130b RL3274 RL3366b RL3495 RL3533 RL3682b RL4089b RL4244 RL4279 RL4530 Fold induction c 4012 KARUNAKARAN ET AL. one Nod and six Fix strains...”

AT5A_22281 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
31% identity, 68% coverage

• Introducing the ArsR-Regulated Arsenic Stimulon
  Rawle, Frontiers in microbiology 2021
  • “...transporter ATP-binding protein 2.2 2.5 17.2 33.6 2.1 2.0 AT5A_19781 Ribose ABC transporter transmembrane protein AT5A_22281 Sugar ABC transporter permease 2.4 AT5A_22286 Sugar ABC transporter substrate-binding protein 2.4 AT5A_24025 Sugar ABC transporter substrate-binding protein 2.3 2.6 2.2 AT5A_24035 Sugar ABC transporter nucleotide ATPase 2.0 2.6 2.2...”

GK0705 maltose/maltodextrin transport system (permease) from Geobacillus kaustophilus HTA426
25% identity, 66% coverage

• Polysaccharide-degrading thermophiles generated by heterologous gene expression in Geobacillus kaustophilus HTA426
  Suzuki, Applied and environmental microbiology 2013
  • “...(GK0704 to GK0708) and the Pgk704 region. The GK0704, GK0705, and GK0706 genes encode components of a sugar ABC transporter. The GK0707 and GK0708 genes encode...”

Bcep1808_2708 binding-protein-dependent transport systems inner membrane component from Burkholderia vietnamiensis G4
30% identity, 74% coverage

• Mapping the Efficacy and Mode of Action of Ethylzingerone [4-(3-Ethoxy-4-Hydroxyphenyl) Butan-2-One] as an Active Agent against Burkholderia Bacteria
  Rushton, Applied and environmental microbiology 2020
  • “...connection, genes encoding a sorbitol-binding extracellular binding protein (Bcep1808_2709) and the operon from Bcep1808_2705 to Bcep1808_2708, which encodes an ABC transporter system, were significantly upregulated, 3.32- to 4.06-fold, in response to HEPB (Table S5). Twenty-five of the genes upregulated by 2-fold were located on plasmid pBVIE02....”

MalF / b4033 maltose ABC transporter membrane subunit MalF (EC 7.5.2.1) from Escherichia coli K-12 substr. MG1655 (see 14 papers)
MalF / P02916 maltose ABC transporter membrane subunit MalF (EC 7.5.2.1) from Escherichia coli (strain K12) (see 13 papers)
MALF_ECOLI / P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
P02916 ABC-type maltose transporter (subunit 1/3) (EC 7.5.2.1) from Escherichia coli (see paper)
TC 3.A.1.1.1 / P02916 MalF aka B4033, component of Maltooligosaccharide porter. The 3-D structure has been reported by Oldham et al. (2007). An altering access mechanism has been suggested for the maltose transporter resulting from rigid-body rotations (Khare et al., 2009). Bordignon et al. (2010) and Schneider et al. (2012) have reviewed the extensive knowledge available on MalEFGK2, its mode of action and its regulatory interactions from Escherichia coli (see 14 papers)
NP_418457 maltose ABC transporter membrane subunit MalF from Escherichia coli str. K-12 substr. MG1655
b4033 maltose transporter subunit from Escherichia coli str. K-12 substr. MG1655
EcolC_3996 fructose-bisphosphate aldolase from Escherichia coli C str. ATCC 8739
25% identity, 47% coverage

• function: Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Probably responsible for the translocation of the substrate across the membrane.
  subunit: The complex is composed of two ATP-binding proteins (MalK), two transmembrane proteins (MalG and MalF) and a solute-binding protein (MalE). Protein stability and stable complex formation require YidC.
• substrates: Maltooligosaccharides, Maltose
  tcdb comment: The transporter sequesters the MalT transcriptional activator at the cytoplasmic surface of the membrane in the absence of the transport substrate (Richet et al. 2012). The crystal structures of the transporter complex MBP-MalFGK2 bound with large malto-oligosaccharide in two different conformational states have also been determined. In the pretranslocation structure,Oldham et al. 2013 found that the transmembrane subunit MalG forms two hydrogen bonds with malto-oligosaccharide at the reducing end. In the outward-facing conformation, the transmrembrane subunit MalF binds three glucosyl units from the nonreducing end. These structural features explain why large modified malto-oligosaccharides are not transported by MalFGK2 despite their high binding affinity to MBP. In the transport cycle, substrate is channeled from MBP into the transmembrane pathway with a polarity such that both MBP and MalFGK2 contribute to the overall substrate selectivity of the system (Oldham et al. 2013). Stabilization of the semi-open MalK2 conformation by maltose-bound MBP is key to the coupling of maltose transport to ATP hydrolysis in vivo, because it facilitates the progression of the MalK dimer from the open to the semi-open conformation, from which it can proceed to hydrolyze ATP (Alvarez et al. 2015). Both the binding of MalE to the periplasmic side of the transmembrane complex and binding of ATP to MalK2 are necessary to facilitate the conformational change from the inward-facing state to the occluded state, in which MalK2 is completely dimerized (Hsu et al. 2017). An integrated transport mechanism of the maltose ABC importer has been proposed (Mächtel et al. 2019)
• Biodistribution of ⁸⁹Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
  Li, Poultry science 2023
  • “...Cell inner membrane 439 P0A6J5 DADA Amino acid transport and metabolism Cell inner membrane 440 P02916 MALF Carbohydrate transport and metabolism Cell inner membrane 441 P07117 PUTP Function unknown Cell inner membrane 442 P32703 YJCE Inorganic ion transport and metabolism Cell inner membrane 443 P60785 LEPA...”
• The MsmX ATPase plays a crucial role in pectin mobilization by Bacillus subtilis
  Ferreira, PloS one 2017
  • “...AraP (P94529), AraQ (P94530), MdxF (O06990), MdxG (O06991), GanP (O32261), GanQ (O07011), OpuAB (P46921), MalF (P02916), and MalG (P68183). 10.1371/journal.pone.0189483.t008 Table 8 Effect of mutations in AraP and AraQ in the uptake of -1,5-arabinotriose. Doubling time (min) of different strains in liquid minimal medium (CSK) using...”
• Evolutionary relationships of ATP-Binding Cassette (ABC) uptake porters.
  Zheng, BMC microbiology 2013
  • “...step [ 19 , 22 , 23 ]. The bacterial maltose transport system proteins, MalF (P02916) and MalG (P68183) are two distinct membrane proteins that together comprise the channel of an ABC superfamily member. High resolution structural information is available for this system (TC# 3.A.1.1.1). Consequently,...”
• Genes encoding two different beta-glucosidases of Thermoanaerobacter brockii are clustered in a common operon
  Breves, Applied and environmental microbiology 1997
  • “...proteins of metabolite transport systems: MalF (accession no. P02916), MalG (P07622), PotC (P23859) and CysW (P16702), all of E. coli, MsmF (Q00750) and MsmG...”
• Formation of a Chloride-conducting State in the Maltose ATP-binding Cassette (ABC) Transporter.
  Carlson, The Journal of biological chemistry 2016
  • GeneRIF: Data indicate that MalFGK2 transporter is comprised of two membrane proteins, MalF and MalG, and the nucleotide-binding domain, which controls the conformation of MalFG, is composed of the homodimeric MalK subunit.
• Allosteric transitions of the maltose transporter studied by an elastic network model.
  Li, Biopolymers 2014 (PubMed)
  • GeneRIF: Data suggest that the binding and conformational change of maltose transporter (MalFGK2) may provide some insights into the understanding of the mechanism of ABC transporters.
• The ABC transporter MalFGK(2) sequesters the MalT transcription factor at the membrane in the absence of cognate substrate.
  Richet, Molecular microbiology 2012
  • GeneRIF: The molecular entity that interacts with MalT is not free MalK, but the maltose transporter, MalFGK(2) , which sequesters MalT to the membrane.
• Crystal structure of the maltose transporter in a pretranslocation intermediate state.
  Oldham, Science (New York, N.Y.) 2011 (PubMed)
  • GeneRIF: using x-ray crystallography, study captured the maltose transporter in an intermediate step between the inward- and outward-facing states
• Studies of the maltose transport system reveal a mechanism for coupling ATP hydrolysis to substrate translocation without direct recognition of substrate.
  Gould, The Journal of biological chemistry 2010
  • GeneRIF: analysis of the MalFGK2 mechanism for coupling ATP hydrolysis to substrate translocation without direct recognition of substrate
• Biogenesis of MalF and the MalFGK(2) maltose transport complex in Escherichia coli requires YidC.
  Wagner, The Journal of biological chemistry 2008 (PubMed)
  • GeneRIF: YidC supports the folding of MalF into a stable conformation before it is incorporated into the maltose transport complex
• ATP-driven MalK dimer closure and reopening and conformational changes of the "EAA" motifs are crucial for function of the maltose ATP-binding cassette transporter (MalFGK2).
  Daus, The Journal of biological chemistry 2007 (PubMed)
  • GeneRIF: ATP-driven MalK dimer closure and reopening are crucial steps in the translocation cycle of the intact maltose transporter MalFGK2
• Maltose binding protein (MalE) interacts with periplasmic loops P2 and P1 respectively of the MalFG subunits of the maltose ATP binding cassette transporter (MalFGK(2)) from Escherichia coli/Salmonella during the transport cycle.
  Daus, Molecular microbiology 2007 (PubMed)
  • GeneRIF: substrate availability is communicated from MalE to the MalK dimer via extracytoplasmic loops of MalFG
• More
• Effect of Global Regulators RpoS and Cyclic-AMP/CRP on the Catabolome and Transcriptome of Escherichia coli K12 during Carbon- and Energy-Limited Growth
  Franchini, PloS one 2015
  • “...i b4032 part of maltose permease, inner membrane 5.9 malF f , g , i b4033 part of maltose permease, periplasmic 6.9 malE c , f , g , i b4034 periplasmic maltose-binding protein 7.5 malK c , f , g , i b4035 ATP-binding component...”
• Global transcriptomic analysis of an engineered Escherichia coli strain lacking the phosphoenolpyruvate: carbohydrate phosphotransferase system during shikimic acid production in rich culture medium
  Cortés-Tolalpa, Microbial cell factories 2014
  • “...protein Transport 6.0726 malE b4034 Maltose ABC transporter - periplasmic binding protein Transport 174.0512 malF b4033 Maltose ABC transporter - membrane subunit Transport 19.1719 malK b4035 Maltose ABC transporter - ATP binding subunit Transport 14.8026 nmpC b0553 OMP protein; locus of qsr prophage Transport 11.7561 proX...”
• Escherichia coli toxin/antitoxin pair MqsR/MqsA regulate toxin CspD
  Kim, Environmental microbiology 2010
  • “...2.6 Maltodextrin phosphorylase malG b4032 1.6 1.5 2.0 Maltose transport complex, inner membrane-spanning subunit malF b4033 1.3 1.0 2.0 Maltose transport complex, inner membrane-spanning subunit malE b4034 1.5 1.1 3.5 Maltose-binding protein, periplasmic, substrate recognition for active transport of and chemotaxis toward maltose and maltodextrin malK...”
• Analysis of promoter targets for Escherichia coli transcription elongation factor GreA in vivo and in vitro
  Stepanova, Journal of bacteriology 2007
  • “...Isocitrate lyase (glyoxylate cycle) malG malF malE malK lamB malM b4032 b4033 b4034 b4035 b4036 b4037 2.1 3.2 1.9 4.2 3.1 4.5 2.8 3.7 5.8 7.5 7.1 6.5 Part of...”
• Genome-wide analyses of Escherichia coli gene expression responsive to the BaeSR two-component regulatory system
  Nishino, Journal of bacteriology 2005
  • “...b2989 b1886 b1923 b3128 b1885 b3126 b1884 b3690 b2473 b4105 b4033 b0958 aroF b2601 flgL malG fliD glpF fliT phnJ ycaC cheA b1083 b4032 b1924 b3927 b1926 b4098...”
• DNA microarray analyses of the long-term adaptive response of Escherichia coli to acetate and propionate
  Polen, Applied and environmental microbiology 2003
  • “...1.59 1.57* 1.50* 3.31* 2.67* 2.39 1.35* 1.46* 1.45 b4032 b4033 b4034 malG malF malE 1 1 1 Part of maltose permease, inner membrane Part of maltose permease,...”
• Physiological studies of Escherichia coli strain MG1655: growth defects and apparent cross-regulation of gene expression
  Soupene, Journal of bacteriology 2003
  • “...b4036 b4037 malK lamB malM 4.1 4.6 1.4 0.8 0.6 1.0 b4034 b4033 b4032 malE malF malG 5.2 1.6 1.5 0.7 0.7 1.0 b3417 b3416 malP malQ 3.9 2.9 0.3 0.6 b0679 nagE 0.9...”
• Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
  Smulski, Journal of bacteriology 2001
  • “...b0274 b0051 b2568 b0072 b0071 b3455 b3460 b3458 b4024 b4033 b1620 b1817 b1530 b2328 b3829 b4242 Fold induction 0.37 0.31 0.41 0.13 0.47 0.27 0.49 0.36 0.10...”
• A novel point mutation in RpoB improves osmotolerance and succinic acid production in Escherichia coli
  Xiao, BMC biotechnology 2017
  • “...their expression maintained stable under osmotic stress. For example, transcript levels of malE (EcolC_3995), malF (EcolC_3996), malG (EcolC_3997) malK (EcolC_3994), and lamB (EcolC_3993), which encode individual subunits of the maltose ABC (ATP-binding cassette) transporter, decreased 10- to 14- fold in Suc-T110 compared to the corresponding levels...”

E2348C_4348 maltose ABC transporter permease MalF from Escherichia coli O127:H6 str. E2348/69
25% identity, 47% coverage

• Microarray analysis of the Ler regulon in enteropathogenic and enterohaemorrhagic Escherichia coli strains
  Bingle, PloS one 2014
  • “...LEE-encoded effector EspG LEE E2348C_3971 50 rorf1 hypothetical protein LEE E2348C_4274 2 - predicted transporter E2348C_4348 2 malF maltose transporter subunit E2348C_4349 2 malE maltose transporter subunit E2348C_4350 3 malK maltose transporter subunit E2348C_4351 3 lamB maltose outer membrane porin (maltoporin) E2348C_4442 3 eptA predicted metal...”

Z5631 part of maltose permease, periplasmic from Escherichia coli O157:H7 EDL933
25% identity, 47% coverage

• Transcriptomic analysis reveals specific metabolic pathways of enterohemorrhagic Escherichia coli O157:H7 in bovine digestive contents
  Segura, BMC genomics 2018
  • “...NDE Z5632 malE Maltose/maltodextrin transport system (substrate-binding protein) NDE 3.22 4.60E-05 NDE 2.41 3.70E-03 NDE Z5631 malF Maltose/maltodextrin transport system (permease protein) NDE 2.71 9.82E-06 NDE NDE NDE Z5630 malG Maltose/maltodextrin transport system (permease protein) NDE 2.79 3.81E-05 NDE NDE NDE Z5633 malK Multiple sugar transport...”

P18812 Maltose/maltodextrin transport system permease protein MalF from Klebsiella aerogenes
25% identity, 47% coverage

• A genomic sample sequence of the entomopathogenic bacterium Photorhabdus luminescens W14: potential implications for virulence
  Ffrench-Constant, Applied and environmental microbiology 2000
  • “...aerogenes H. influenzae E. coli AE001166 P00550 U65015 P31448 P04983 P04984 P18812 P45247 P77565 1 (0) 1 (0) 1 (0) 3 (0) 1 (0) 2 (0) 1 (0) 1 (0) 1 (0)...”

TC 3.A.1.1.42 / TC 3.A.1.1.43 / Q9FBS6 Putative sugar-transporter integral membrane protein, component of α-glucoside uptake permease, Agl3E/Agl3F/Agl3G. Plays a role in normal morphogenesis and antibiotic production. Strongly induced by trehalose and melibiose, and weakly induced by lactose and glycerol but not glucose (Hillerich and Westpheling 2006).The operon is controlled by a GntR homologue, Agl3R, and downstream of the gntR from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
SCO7166 sugar-transporter integral membrane protein from Streptomyces coelicolor A3(2)
26% identity, 83% coverage

• substrates: Melibiose, Trehalose, alpha-glucosides
  tcdb comment: The ATPase subunit, Agl3K, may be the MsiK (Sco4240; see 3.A.1.1.33) protein (Saito et al. 2008).. gene is a gene encoding an extracellular carbohydrase
• Identification of three new genes involved in morphogenesis and antibiotic production in Streptomyces coelicolor
  Sprusansky, Journal of bacteriology 2003
  • “...of the protein responsible for membrane attachment (12). SCO7166 (encoding 310 amino acids) and SCO7165 (encoding 303 amino acids) encode putative integral...”
  • “...other members of this class of protein permeases, the SCO7166 and SCO7165 products contain a highly conserved signature region located near the C terminus, as...”

SPD_1676 sugar ABC transporter, permease protein from Streptococcus pneumoniae D39
28% identity, 82% coverage

• A Tn-seq Screen of Streptococcus pneumoniae Uncovers DNA Repair as the Major Pathway for Desiccation Tolerance and Transmission
  Matthews, Infection and immunity 2021 (secret)
• N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
  Afzal, Frontiers in cellular and infection microbiology 2016
  • “...Galactose-6-phosphate isomerase, LacA 9.9 spd_0280 Transcriptional regulator, CelR 7.7 spd_1677 Sugar ABC transporter, RafE 7.4 spd_1676 Sugar ABC transporter, RafF 6.6 spd_1634 Galactokinase, GalK 6.5 spd_1633 Galactose-1-phosphate uridylyltransferase, GalT 6.3 spd_1675 Sugar ABC transporter, RafG 5.6 spd_1047 PTS system, lactose-specific IIBC components, LacE 5.4 spd_0283 PTS...”

ACPL_5585 carbohydrate ABC transporter permease from Actinoplanes sp. SE50/110
28% identity, 83% coverage

• Reconstruction and in silico analysis of an Actinoplanes sp. SE50/110 genome-scale metabolic model for acarbose production
  Wang, Frontiers in microbiology 2015
  • “...Actinoplanes sp. SE50/110 . The genes mal EFG in the pathway were ACPL_6402, ACPL_3200, ACPL_4618, ACPL_5585, ACPL_6401, ACPL_6726, ACPL_3782, ACPL_5386, and ACPL_6400. Figure 6 Chemical structure for acarbose . The essential genes for acarbose production were studied in acarbose synthesis medium. One hundred and thirty three...”

RC1_3730 maltose transport system permease protein malF, putative from Rhodospirillum centenum SW
25% identity, 75% coverage

• Mapping the CgrA regulon of Rhodospirillum centenum reveals a hierarchal network controlling Gram-negative cyst development
  Dong, BMC genomics 2015
  • “...in expression during cyst development. This includes; a variety of sugar transporters coded by RC1_2705, RC1_3730, RC1_3731, RC1_3732, and RC1_3734 ; two TonB homologs ( RC1_0278 and RC1_3723) and several TonB dependent transporters ( RC1_0403 , RC1_0945 ); an outer membrane efflux protein ( RC1_3821); a...”

AQS8620_00608 carbohydrate ABC transporter permease from Aquimixticola soesokkakensis
30% identity, 77% coverage

• Genome-Wide Analysis of Sugar Transporters Identifies the gtsA Gene for Glucose Transportation in Pseudomonas stutzeri A1501
  Liu, Microorganisms 2020
  • “...by BMULJ02554 - 02558 (5561% identity) and Aquimixticola soesokkakensis lactose transporter subunit LacEF encoded by AQS8620_00608 - 00609 (5560% identity). The last ABC transport system encoded by PST2437 - 2440 was similar to the Pseudomonas putida glucose transport system GtsABCD 2 [ 21 ], but no...”

UgpA / b3452 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (EC 7.6.2.10) from Escherichia coli K-12 substr. MG1655 (see 3 papers)
UgpA / P10905 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (EC 7.6.2.10) from Escherichia coli (strain K12) (see 20 papers)
UGPA_ECOLI / P10905 sn-glycerol-3-phosphate transport system permease protein UgpA from Escherichia coli (strain K12) (see 5 papers)
P10905 ABC-type glycerol 3-phosphate transporter (EC 7.6.2.10) from Escherichia coli (see paper)
TC 3.A.1.1.3 / P10905 UgpA aka B3452, component of Glycerol-phosphate porter. Transports both glycerol-3-P and glycerol-3-P diesters including glycerophosphocholine but not glycerol-2-P from Escherichia coli (see 5 papers)
NP_417909 sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA from Escherichia coli str. K-12 substr. MG1655
26% identity, 81% coverage

• function: Part of the ABC transporter complex UgpBAEC involved in sn- glycerol-3-phosphate (G3P) import (PubMed:23013274, PubMed:2842304). Probably responsible for the translocation of the substrate across the membrane (Probable). Can also transport glycerophosphoryl diesters, which are hydrolyzed to G3P and alcohol during transport (PubMed:2842304). The G3P moiety can be detected in the cytoplasm whereas the corresponding alcohol is usually found in the culture medium (PubMed:2842304). It was proposed by Yang et al that the complex could also transport glycerol-2-phosphate (G2P) in vivo, but it was shown later by Wuttge et al that UgpB does not bind G2P, questioning this transport activity (PubMed:19429609, PubMed:23013274). G2P might be converted in the periplasm to G3P before its transport (PubMed:23013274).
  subunit: The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute-binding protein (UgpB).
  disruption phenotype: Mutant lacking this gene fails to grow on both glycerol-3-phosphate and glycerol-2-phosphate.
• substrates: Glycerol-phosphate
  tcdb comment: UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012). UgpB (the receptor) binds glycerol 3-P with high affinity, but not glycerol 2-P (Wuttge et al. 2012)
• Functional Prediction of Biological Profile During Eutrophication in Marine Environment
  Sbaoui, Bioinformatics and biology insights 2022
  • “...regulator of tor operon TpiA P0A858 Triosephosphate isomerase Tsr P02942 Protein methyl-accepting chemotaxis proteinserine-sensing UgpA P10905 Sn-glycerol-3-phosphate transport system permease protein UmuD P0AG11 Component of DNA polymerase V, signal peptidase with UmuC Ung P12295 Uracil-DNA-glycosylase UraA P0AGM7 Uracil: H+ symporter UspD P0AAB8 Universal stress protein D...”
• Uptake of glycerol-2-phosphate via the ugp-encoded transporter in Escherichia coli K-12.
  Yang, Journal of bacteriology 2009
  • GeneRIF: Mutations in the ugpBAECQ operon (Ugp)eliminated the ability of phoA-deleted E. coli to utilize glycerol-2-phosphate (G2P)suggesting that G2P is a previously unrecognized substrate for the binding protein-dependent Ugp transporter.

TC 3.A.1.1.23 / Q9X9R6 CBP protein aka CebF, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] from Streptomyces reticuli (see paper)
26% identity, 76% coverage

• substrates: Cellobiose, Celltriose

BWI76_RS01825 maltose ABC transporter, permease component 1 (MalF) from Klebsiella michiganensis M5al
25% identity, 47% coverage

• mutant phenotype: Specifically important for utilizing D-Maltose monohydrate.

Z4820 sn-glycerol 3-phosphate transport system, integral membrane protein from Escherichia coli O157:H7 EDL933
26% identity, 81% coverage

• RcsB contributes to the distinct stress fitness among Escherichia coli O157:H7 curli variants of the 1993 hamburger-associated outbreak strains
  Carter, Applied and environmental microbiology 2012
  • “...ugpA ugpB Z0826 Z2192 Z2463 Z4819 Z4820 Z4822 Phosphotransferase system N-acetylglucosamine-specific transporter subunit IIABC ABC transporter ATP-binding...”

SM_b21104 ABC transporter for L-Fucose, permease component 1 from Sinorhizobium meliloti 1021
25% identity, 86% coverage

• mutant phenotype: Specific phenotypes on L-Fucose.

MSMEG_3267 transporter from Mycobacterium smegmatis str. MC2 155
28% identity, 69% coverage

• A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
  McKenzie, Journal of bacteriology 2012
  • “...periplasmic protein Unknown MSMEG_3264 MSMEG_3265 MSMEG_3266 MSMEG_3267 MSMEG_3268 MSMEG_3269 MSMEG_3270 MSMEG_3271 abcR sugK abcE abcF abcG abcK1 abcK2...”

BruAb2_0483 hypothetical sugar ABC transporter, permease protein from Brucella abortus biovar 1 str. 9-941
25% identity, 84% coverage

• Molecular targets for rapid identification of Brucella spp
  Ratushna, BMC microbiology 2006
  • “..... 618876) BruAb2_0590 598292 .. 599416 1203/1125 beta-ketoadipyl CoA thiolase 2 BRA0749 731323 .. 732192 BruAb2_0483 (484959 .. 485828) 870 sugar ABC transporter, permease protein, putative 2 BRA0907 888804 .. 890204 BruAb2_0326 (326911 .. 328311) 1401 conserved hypothetical protein 2 BRA1096 1082617 .. 1083330 BruAb2_1035 1037839...”

LSEI_2764 ABC-type sugar transport system, permease component from Lactobacillus casei ATCC 334
27% identity, 85% coverage

• Physiological and transcriptional response of Lactobacillus casei ATCC 334 to acid stress
  Broadbent, Journal of bacteriology 2010
  • “...and gene IDc Carbohydrate transport, metabolism: LSEI_2764 Amino acid transport, metabolism LSEI_2061 LSEI_2062 LSEI_2063 LSEI_2064 LSEI_0175 LSEI_1890...”
  • “...upregulation of the gene that encodes UgpA (LSEI_2764), the permease for an sn-glycerol-3-phosphate transport system, was detected in AA20 versus control...”

SPD_RS07940 carbohydrate ABC transporter permease from Streptococcus pneumoniae D39
24% identity, 80% coverage

• SPD_0410 negatively regulates capsule polysaccharide synthesis and virulence in <i>Streptococcus pneumoniae</i> D39
  Tao, Frontiers in microbiology 2024
  • “...SPD_RS05200 spd_0966 Sugar ABC transporter permease 1.05367 2.61E-07 SPD_RS07935 satC Carbohydrate ABC transporter 1.25945 2.60E-06 SPD_RS07940 satB Sugar ABC transporter permease 1.20096 0.000206 Phosphotransferase system SPD_RS00335 gadV PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB 1.76673 9.74E-06 SPD_RS00340 gadW PTSmannose/fructose/sorbose/N- PTS system mannose/fructose/sorbose family transporter subunit IID 1.87046 3.00E-06...”

SCO7012 binding protein dependent transport protein from Streptomyces coelicolor A3(2)
26% identity, 73% coverage

• Genome-wide analysis of the role of GlnR in Streptomyces venezuelae provides new insights into global nitrogen regulation in actinomycetes
  Pullan, BMC genomics 2011
  • “...Sven_6299/6300 n/a/SCO6803 Epimerase/acetyl transferase 1.9/ -6.1 T T C AC GTGCCC G AA AC Sven_7354 SCO7012 Putative binding protein dependent transport protein permease -3.7 n/a Sven_7089 n/a Assimilatory nitrate reductase -1.8 GT G AC ACAGGT GT A AC Peaks were called as present when two or...”

BL1639 permease of ABC transporter for sugars from Bifidobacterium longum NCC2705
27% identity, 65% coverage

• Linking human milk oligosaccharide metabolism and early life gut microbiota: bifidobacteria and beyond
  Lordan, Microbiology and molecular biology reviews : MMBR 2024 (secret)
• Mixed-species genomic microarray analysis of fecal samples reveals differential transcriptional responses of bifidobacteria in breast- and formula-fed infants
  Klaassens, Applied and environmental microbiology 2009
  • “...BL0715 BL0716 BL0978 BL1104 BL1308 BL1518 BL1638 BL1639 BL1641 BL1643 and BL1644 BL1674 Function(s) or identity(ies) of gene product(s) Pullulanase Probable...”
• Differential transcriptional response of Bifidobacterium longum to human milk, formula milk, and galactooligosaccharide
  González, Applied and environmental microbiology 2008
  • “...10, 2017 by University of California, Berkeley BL1639 BL1642 BL1673-BL1674 BL0978 EF2229 BL1344 BL0919-BL0920 BL1343 BL1673 BL0454-BL0455 Solute binding protein...”
  • “...included a putative desulfatase (BL1642) and sugar permease subunit (BL1639) (Table 1). The latter forms part of a novel putative operon for metabolism of mucin...”

LMOf2365_0190 sugar ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
lmo0179 similar to sugar ABC transporters, permease proteins from Listeria monocytogenes EGD-e
27% identity, 67% coverage

• Contributions of a LysR Transcriptional Regulator to Listeria monocytogenes Virulence and Identification of Its Regulons
  Abdelhamed, Journal of bacteriology 2020 (secret)
• Listeria monocytogenes 6-Phosphogluconolactonase mutants induce increased activation of a host cytosolic surveillance pathway
  Crimmins, Infection and immunity 2009
  • “...lmo2185 lmo2685 lmo0361 lmo0362 lmo1912 lmo1911 lmo2161 lmo0179 lmo0027 lmo1407 lmo1849 lmo1847 lmo1848 lmo0997 lmo2785 lmo2648 lmo2651 lmo2650 lmo2647 lmo0558...”

Npun_R2793 binding-protein-dependent transport systems inner membrane component from Nostoc punctiforme
28% identity, 61% coverage

• Cell-specific gene expression in Anabaena variabilis grown phototrophically, mixotrophically, and heterotrophically
  Park, BMC genomics 2013
  • “...orthologs of Ava_2748 in N. punctiforme (Npun_R2792) and Anabaena 90 (Ana_C20533) are adjacent to genes Npun_R2793 and Ana_C20534, both of which are orthologs of Ava_0461, annotated as membrane protein 1 in a CUT1 transporter (Additional file 7 ). Our results show that Ava_0461 is also strongly...”

Atu3351 ABC transporter, membrane spanning protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
26% identity, 70% coverage

• Comparative Transcriptome Analysis of Agrobacterium tumefaciens Reveals the Molecular Basis for the Recalcitrant Genetic Transformation of Camellia sinensis L
  Jin, Biomolecules 2022
  • “...( atu0391 , atu4559 , atu4450 ), oligogalacturonide ( atu3130 , atu3132 ), glucose ( atu3351 , atu3352 ), rhamnose ( atu34873490 ), sn-glycerol 3-phosphate ( ugpC = atu3099 / atu3188 ), branched-chain amino acid ( livH = atu4518 , livG = atu4516 , livM =...”

TC 3.A.1.1.48 / D6ZW63 MalF-type ABC sugar transport systems permease component, component of The lacto-N-biose I (LNB; Gal β-1,3-GlcNAc)/galacto-N-biose (GNB; Gal β-1,3-GalNAc) transporter from Bifidobacterium longum subsp. longum (strain JDM301)
27% identity, 66% coverage

• substrates: Lacto-N-biose
  tcdb comment: The solute-binding protein crystallizes only in the presence of LNB or GNB, and it was therefore named GNB/LNB-binding protein (GL-BP) (Wada et al. 2007; Suzuki et al. 2008; Asakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1Suzuki et al. 2008; Asakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1-3Galbeta1-4Glc) were determined. The MalF and MalG membrahe proteinAsakuma et al. 2011). Isothermal titration calorimetry measurements revealed that GL-BP specifically binds LNB and GNB with K(d) values of 0.087 and 0.010 μM, respectively, and the binding process is enthalpy-driven. The crystal structures of GL-BP complexed with LNB, GNB, and lacto-N-tetraose (Galbeta1-3GlcNAcbeta1-3Galbeta1-4Glc) were determined. The MalF and MalG membrahe proteins are encoded adjacent to the gene for GL-BP, but the ATPase was not identified

BBMN68_1169 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
23% identity, 86% coverage

• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...description BBMN68_1168 145.91 61.94 2.36 * G COG0395 K02026, multiple sugar transport system permease protein BBMN68_1169 98.62 30.32 3.25 * G COG1175 K02025, multiple sugar transport system permease protein BBMN68_1170 2153.69 298.91 7.21 * G COG1653 K02027, multiple sugar transport system substrate-binding protein BBMN68_927 50.5 9.47...”

OEOE_RS07035 carbohydrate ABC transporter permease from Oenococcus oeni PSU-1
25% identity, 72% coverage

• Transcriptomic and Proteomic Analysis of Oenococcus oeni Adaptation to Wine Stress Conditions
  Margalef-Català, Frontiers in microbiology 2016
  • “...ABC transporter ATP-binding protein OEOE_RS07030 1.42 1.92 2.10 2.34 2.51 2.54 Glycerol-3-phosphate ABC transporter permease OEOE_RS07035 0.90 1.36 1.53 1.65 1.72 1.76 Glycerol-3-phosphate ABC transporter permease OEOE_RS07040 1.03 1.54 1.64 1.81 2.01 1.93 Glycerol-3-phosphate ABC transporter substrate-binding protein OEOE_RS07045 1.16 1.47 1.86 2.13 2.20 2.22 UDP-phosphate...”

PGA1_c13200 ABC transporter for D-Sorbitol, permease component 2 from Phaeobacter inhibens DSM 17395
26% identity, 85% coverage

• mutant phenotype: Specific phenotypes on D-Sorbitol; D-Sorbitol.

4ki0F / P02916 Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
25% identity, 48% coverage

• Ligand: alpha-d-glucopyranose (4ki0F)

BL105A_0202, BLLJ_0209 carbohydrate ABC transporter permease from Bifidobacterium longum
23% identity, 86% coverage

• Application of Recombinase-Based In Vivo Expression Technology to Bifidobacterium longum subsp. longum for Identification of Genes Induced in the Gastrointestinal Tract of Mice
  Koguchi, Microorganisms 2020
  • “...Tad-pili 4th 5 BL105A_0136 Recombination protein RecR 1st L 6 BL105A_0138 Hypothetical protein 4th 7 BL105A_0202 ABC transporter permease component 4th G 8 BL105A_0204 Glycoside hydrolase family 127 - l -arabinofuranosidase 4th S 9 BL105A_0248 Hypothetical protein 3rd 10 BL105A_0262 Hypothetical protein 4th 11 BL105A_0267 Hypothetical...”
• Crystal structure of β-L-arabinobiosidase belonging to glycoside hydrolase family 121
  Saito, PloS one 2020
  • “...importer system that consists of a substrate-binding protein (SBP, BLLJ_0208) and two transmembrane domain proteins (BLLJ_0209 and BLLJ_0210). Hydroxyproline (Hyp) residues in HRGPs, such as extensin and solanaceous lectins, are usually O -glycosylated with 3 or 4 L-Ara f residues that are linked with three -bonds...”
• Characterization of a novel β-L-arabinofuranosidase in Bifidobacterium longum: functional elucidation of a DUF1680 protein family member
  Fujita, The Journal of biological chemistry 2014
  • “...protein (BLLJ_0208) and two transmembrane subunits (BLLJ_0209 and BLLJ_0210). BLLJ_0208 exhibits 28% identity with the GNB/LNB-binding protein, and...”
• Characterization of a novel β-L-Arabinofuranosidase in Bifidobacterium longum: functional elucidation of A DUF1680 family member
  Fujita, The Journal of biological chemistry 2011
  • “...solute-binding protein (BLLJ_0208) and 2 transmembrane subunits (BLLJ_0209 and BLLJ_0210). BLLJ_0208 exhibits 28% identity with the GNB/LNB-binding protein, and...”

HMPREF0421_20098 carbohydrate ABC transporter permease from Gardnerella vaginalis ATCC 14019
29% identity, 62% coverage

• Transcriptomic and Proteomic Analysis of Gardnerella vaginalis Responding to Acidic pH and Hydrogen Peroxide Stress
  Zhang, Microorganisms 2023
  • “...ABC transporters transported monosaccharides or oligosaccharides, providing oligosaccharides units for cell growth or biofilm formation (HMPREF0421_20098) [ 32 ]. Therefore, we can speculate that, while the formed biofilm increased the G. vaginalis tolerance to lactate and hydrogen peroxide [ 33 ], the lactobacilli were able to...”
  • “...acetyltransferase HMPREF0421_20235 0.76 0.009039 Sugar ABC transporter membrane protein HMPREF0421_20979 0.76 0.001612 TM2 domain-containing protein HMPREF0421_20098 0.78 0.001898 Sugar ABC transporter membrane protein HMPREF0421_20232 0.81 0.003311 Maltose-binding protein HMPREF0421_20422 0.81 0.025688 Exopolyphosphatase HMPREF0421_20575 0.82 0.000581 Phosphate acetyltransferase HMPREF0421_21052 0.83 0.022516 RelE-family TA system toxin...”

TC 3.A.1.1.28 / Q00750 MsmF aka SMU.879, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides from Streptococcus mutans (see 2 papers)
SMU_RS04085 carbohydrate ABC transporter permease from Streptococcus mutans UA159
26% identity, 75% coverage

• substrates: Raffinose, Stachyose
• Identification of the antibacterial action mechanism of diterpenoids through transcriptome profiling
  Moon, Frontiers in microbiology 2022
  • “...phosphorylase gtfA 0.98 1.69 1.71 SMU_RS04105 Alpha-glucosidase dexB 1.28 1.23 1.25 SMU_RS04075 Alpha-galactosidase aga 1.21 SMU_RS04085 Sugar ABC transporter permease msmF 1.76 0.33 0.45 SMU_RS04090 Carbohydrate ABC transporter permease msmG 1.20 0.26 0.14 SMU_RS04100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC msmK 1.95 0.66 0.59 SMU_RS07115 Sugar...”

BCAN_B0756 binding-protein-dependent transport systems inner membrane component from Brucella canis ATCC 23365
BRA0749 sugar ABC transporter, permease protein, putative from Brucella suis 1330
24% identity, 84% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP BMEII0590...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...import BP BMEII0115 BruAb21116 BRA1180 BCAN_B1211 77 OSP Oligosaccharide or polyol import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544...”
• Molecular targets for rapid identification of Brucella spp
  Ratushna, BMC microbiology 2006
  • “...protein 2 BRA0636 (617674 .. 618876) BruAb2_0590 598292 .. 599416 1203/1125 beta-ketoadipyl CoA thiolase 2 BRA0749 731323 .. 732192 BruAb2_0483 (484959 .. 485828) 870 sugar ABC transporter, permease protein, putative 2 BRA0907 888804 .. 890204 BruAb2_0326 (326911 .. 328311) 1401 conserved hypothetical protein 2 BRA1096 1082617...”
• The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
  Paulsen, Proceedings of the National Academy of Sciences of the United States of America 2002
  • “...BR0404 BR0391 BR0355 BR0389, BR0390 BR0221 BRA0631-BRA0635 BRA0749, BRA0750 BRA0907 BRA1080 BRA1096 Unique B. melitensis regions 107 764 276 238 845...”

MSMEG_5060 ABC transporter, permease protein SugA from Mycobacterium smegmatis str. MC2 155
MSMEG_5060 carbohydrate ABC transporter permease from Mycolicibacterium smegmatis MC2 155
27% identity, 83% coverage

• Elucidating the role of c-di-AMP in Mycobacterium smegmatis: Phenotypic characterization and functional analysis
  Chaudhary, Heliyon 2023
  • “...ABC transporter, permease protein 1.35 0.040 9 MSMEG_4657 ABC transporter membrane protein 1.11 0.057 10 MSMEG_5060 ABC transporter, permease protein SugA 1.51 0.0361 11 MSMEG_0642 Hypothetical ABC transporter permease protein YliD 1.32 0.044 12 MSMEG_0549 ABC transporter, permease protein 1.35 0.040 13 MSMEG_6307 Glutamine-binding periplasmic protein/glutamine...”
• Structural basis of trehalose recycling by the ABC transporter LpqY-SugABC
  Liu, Science advances 2020
  • “...DNA and overexpressed in M. smegmatis mc 2 155 . MSMEG_5058 , MSMEG_5059 , and MSMEG_5060 were amplified by polymerase chain reaction (PCR) and inserted into a pM261 vector, with a C-terminal 6 His-tag attached to SugC. The recombinant plasmid was transformed into M. smegmatis mc...”
  • “...mutated to glutamine. A coexpression vector was constructed by amplification of MSMEG_5058 (E164Q), MSMEG_5059 , MSMEG_5060 , and MSMEG_5061 from M. smegmatis strain mc 2 155 genomic DNA by PCR and insertion into a pM261 expression vector with a C-terminal 6 His-tag. LpqY-SugABC was expressed and...”
• A VapBC toxin-antitoxin module is a posttranscriptional regulator of metabolic flux in mycobacteria
  McKenzie, Journal of bacteriology 2012
  • “...MSMEG_4664 MSMEG_4665 MSMEG_4666 MSMEG_5057 MSMEG_5058 MSMEG_5059 MSMEG_5060 MSMEG_5061 MSMEG_5062 iolB iolD iolE sugK sugG sugF sugE Succinate MSMEG_5302...”

NP_463093 maltose transport protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
25% identity, 47% coverage

• Mapping putative contact sites between subunits in a bacterial ATP-binding cassette (ABC) transporter by synthetic peptide libraries.
  Blüschke, Journal of molecular biology 2007 (PubMed)
  • GeneRIF: Results identify specific molecular contacts made between MalK and MalFG that extend beyond the well-characterized EAA motif.
• Topography of the surface of the signal-transducing protein EIIA(Glc) that interacts with the MalK subunits of the maltose ATP-binding cassette transporter (MalFGK2) of Salmonella typhimurium.
  Blüschke, The Journal of biological chemistry 2006 (PubMed)
  • GeneRIF: the surface of the signal-transducing protein EIIA(Glc) interacts with the MalK subunits of the maltose ATP-binding cassette transporter (MalFGK2) of Salmonella typhimurium

R8G07_08365 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum
27% identity, 66% coverage

• Bifidobacterium longum subsp. longum BG-L47 boosts growth and activity of Limosilactobacillus reuteri DSM 17938 and its extracellular membrane vesicles
  Ermann, Applied and environmental microbiology 2024
  • “...in LNT, lacto-N-biose (LNB), and galacto-N-biose degradation. In BG-L47, the transporter is encoded by R8G07_08360, R8G07_08365, and R8G07_08370, and by an ortholog of the operon in BB536 (HCBKAFLH_01753, HCBKAFLH_01754, HCBKAFLH_01755). However, the inability of BB536 to grow on LNT indicates that the ortholog is not expressed...”

BOV_A0699 putative sugar ABC transporter, permease protein from Brucella ovis ATCC 25840
24% identity, 84% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...import IM BMEII0541 BruAb20483 BRA0749 BOV_A0700 BCAN_B0757 OSP Oligosaccharide or polyol import IM BruAb20482 BRA0750 BOV_A0699 BCAN_B0756 OSP Oligosaccharide or polyol import BP BMEII0542 BruAb20484 BRA0748 BOV_A0698 BCAN_B0755 OSP Oligosaccharide or polyol import ABC BMEII0544 BruAb20487 BRA0745 BOV_A0696 BCAN_B0753 78 OSP Oligosaccharide or polyol import BP...”

BKKJ1_2078 carbohydrate ABC transporter permease from Bifidobacterium catenulatum subsp. kashiwanohense
26% identity, 78% coverage

• Metabolism of the predominant human milk oligosaccharide fucosyllactose by an infant gut commensal
  James, Scientific reports 2019
  • “...fumS ABC transporter solute binding protein 19.68 30.20 BKKJ1_2077 fumT1 ABC transporter permease 20.79 22.82 BKKJ1_2078 fumT2 ABC transporter permease 21.89 30.41 BKKJ1_2079 fumR LacI family transcriptional regulator The level of expression is shown as a fold-value of increase in expression on each carbohydrate, as compared...”
  • “...and fumT2 (corresponding to locus tags BKKJ1_2076-2078, including the presumed promoter-containing region located upstream of BKKJ1_2078; this fragment was designated fumST1T2 ) were generated by PCR amplification from B. kashiwanohense APCKJ1 using Q5 High-Fidelity Polymerase (New England BioLabs, Herefordshire, UK) and primer pairs 2069pNZ44F and 2069pNZ44R,...”

Tsac_1349 carbohydrate ABC transporter permease from Thermoanaerobacterium saccharolyticum JW/SL-YS485
27% identity, 62% coverage

• Profile of secreted hydrolases, associated proteins, and SlpA in Thermoanaerobacterium saccharolyticum during the degradation of hemicellulose
  Currie, Applied and environmental microbiology 2014
  • “...through Tsac_1464 for xylan/xylose and Tsac_1344 through Tsac_1349 for starch). A phosphotransferase system subunit, Tsac_0032, also appeared to be exclusive to...”
  • “...expressed, as detected by LC-MS/MS. Currie et al. through Tsac_1349 for starch). A PTS system subunit, Tsac_0032, also appeared to be exclusive to growth on...”

GM298_18020 sn-glycerol-3-phosphate ABC transporter permease UgpA from Enterobacter sp. HSTU-ASh6
25% identity, 81% coverage

• Unveiling chlorpyrifos mineralizing and tomato plant-growth activities of Enterobacter sp. strain HSTU-ASh6 using biochemical tests, field experiments, genomics, and in silico analyses
  Haque, Frontiers in microbiology 2022
  • “...ATP-binding protein PstB pho U GM298_11475 25513.26238 Phosphate signaling complex protein PhoU 3.5.2.6 ugp A GM298_18020 82211.83098 sn-glycerol-3-phosphate ABC transporter permease UgpA ugp B GM298_18025 83268.84584 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB ugp E GM298_18015 81369.82214 sn-glycerol-3-phosphate ABC transporter permeaseugpE pho A GM298_10665 117286.118701 Alkaline phosphatase...”

LMH90_004140 sn-glycerol-3-phosphate ABC transporter permease UgpA from Enterobacter hormaechei
25% identity, 81% coverage

• Genome Assembly of a Putative Plant Growth-Stimulating Bacterial Sweet Pepper Fruit Isolate, Enterobacter hormaechei SRU4.4
  Mamphogoro, Microbiology resource announcements 2023
  • “...Phosphate ABC transporter substrate-binding protein PstS ugpE LMH90_004135 sn -Glycerol-3-phosphate ABC transporter permease UgpE ugpA LMH90_004140 sn -Glycerol-3-phosphate ABC transporter permease UgpA agp LMH90_005795 Bifunctional glucose-1-phosphatase/inositol phosphatase phoH LMH90_005910 Phosphate starvation-inducible protein PhoH Iron(II) transport feoA LMH90_003975 Ferrous iron transporter A feoB LMH90_003980 Fe 2+ transporter...”

Csac_0427 binding-protein-dependent transport systems inner membrane component from Caldicellulosiruptor saccharolyticus DSM 8903
23% identity, 84% coverage

• Hydrogenomics of the extremely thermophilic bacterium Caldicellulosiruptor saccharolyticus
  van, Applied and environmental microbiology 2008
  • “...using the maltodextrin ABC transport system proteins (Csac_0427 to Csac_0428/Csac_0431). An intracellular -amylase (Csac_ 0426) and a 1,4--glucan phosphorylase...”
  • “...described carbohydrate-specific maltodextrin ABC transport system (Csac_0427, Csac_0428, and Csac_0431) and the maltose ABC transport system (Csac_2491 to...”

BBMN68_1423 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
25% identity, 87% coverage

• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...protein BBMN68_1422 307.21 83.16 3.69 * G COG1653 K10117, multiple sugar transport system substrate-binding protein BBMN68_1423 340.04 96.16 3.54 * G COG1175 K10118, multiple sugar transport system permease protein BBMN68_1424 284.17 79.61 3.57 * G COG0395 K10119, multiple sugar transport system permease protein BBMN68_1726 1387.95 83.55...”

BB562_10815 carbohydrate ABC transporter permease from Lactiplantibacillus pentosus
25% identity, 85% coverage

• Transcriptomic Profile and Probiotic Properties of Lactiplantibacillus pentosus Pre-adapted to Edible Oils
  Alonso, Frontiers in microbiology 2021
  • “...coding for an iron ABC transporter ATP-binding protein (BB562_08670), glycerol-3-phosphate ABC transporter permease (BB562_10810 and BB562_10815), glycerol-3-phosphate ABC transporter ATP-binding protein (BB562_10820), phosphate ABC transporter substrate-binding protein (BB562_13370 = 13420), phosphonate ABC transporter ATP-binding protein (BB562_13485), phosphonate ABC transporter permease protein PhnE (BB562_13490 gene was 4.29-fold...”
  • “...and Supplementary Figure 3 ). In this case, we observed the absence of down-regulated gene BB562_10815 encoding glycerol-3-phosphate ABC transporter permease (ABC transporters), down-regulation of two additional genes coding for ribosome proteins (BB562_12015 and BB562_11990; Supplementary Table 2 and Supplementary Figure 3 ), and encoding serine...”

KP1_0274 maltose transport system permease component from Klebsiella pneumoniae NTUH-K2044
25% identity, 47% coverage

• Reduced virulence in tigecycline-resistant Klebsiella pneumoniae caused by overexpression of ompR and down-regulation of ompK35
  Park, Journal of biomedical science 2023
  • “...218.789 46.273 0.680 86.970 KP1_4241 Hypothetical protein 43.821 33.200 1481.113 56.380 16.806 1138.272 Down-regulated genes KP1_0274 Maltose ABC transporter permease MalF 25.282 474.168 18.524 6.668 25.631 4.157 KP1_0275 Maltose/maltodextrin ABC transporter substrate-binding protein MalE 17.645 1277.184 73.022 15.171 88.873 6.814 KP1_0276 maltose/maltodextrin ABC transporter ATP-binding protein...”

RL0092 putative transmembrane component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
27% identity, 83% coverage

• Identification and characterization of the TetR family transcriptional regulator NffT in Rhizobium johnstonii
  Li, Applied and environmental microbiology 2024 (secret)

smoG / Q7CS30 ABC-type 3-(6-sulfo-α-D-quinovosyl)-sn-glycerol transporter permease subunit from Agrobacterium fabrum (strain C58 / ATCC 33970) (see paper)
Atu3283 ABC transporter, membrane spanning protein (sugar) from Agrobacterium tumefaciens str. C58 (Cereon)
30% identity, 74% coverage

• Oxidative desulfurization pathway for complete catabolism of sulfoquinovose by bacteria
  Sharma, Proceedings of the National Academy of Sciences of the United States of America 2022
  • “...of genes ( Atu3277 - Atu3285 ) for cells grown on SQ. Proteins encoded by Atu3283 and Atu3284 were not observed; however, they are predicted to be integral membrane proteins that can be difficult to detect using conventional proteomic workflows ( 14 ). Thus, the gene...”
  • “...Protein that Binds SQGro. Within the gene cluster identified through proteomics, Atu3281 ( smoE ), Atu3283 ( smoG ), and Atu3284 ( smoH ) were annotated as an ABC transporter system, with Atu3282 ( smoF ) encoding an associated periplasmic solute-binding protein. The substrate preferences of...”

HSERO_RS17005 ABC transporter for D-sorbitol/xylitol, permease component 1 from Herbaspirillum seropedicae SmR1
28% identity, 68% coverage

• mutant phenotype: Specifically important for utilization of D-sorbitol and xylitol.

Gocc_2321 carbohydrate ABC transporter permease from Gaiella occulta
28% identity, 79% coverage

• High-quality draft genome sequence of Gaiella occulta isolated from a 150 meter deep mineral water borehole and comparison with the genome sequences of other deep-branching lineages of the phylum Actinobacteria
  Severino, MicrobiologyOpen 2019
  • “...in G. occulta genome. Four unspecific sugar transport systems (Gocc_0123 to Gocc_0125, Gocc_0222 to Gocc_0224, Gocc_2321 to Gocc_2323 and Gocc_3042 to Gocc_3044), that may be involved in the transport of glucose, fructose, mannose, and myo inositol, were also identified. No PTStype transporters were identified in G....”

Bbr_1589 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
26% identity, 66% coverage

• Selective human milk oligosaccharide utilization by members of the <i>Bifidobacterium pseudocatenulatum</i> taxon
  Sanchez-Gallardo, Applied and environmental microbiology 2024
  • “...sugars galP1 Bbr_1588 MM0196_1728 87.37 Permease protein of the ABC transporter system for sugars galP2 Bbr_1589 MM0196_1729 87.46 Solute-binding protein of the ABC transporter system for sugars galS Bbr_1590 MM0196_1730 70.18 Heterologous expression, purification, and biochemical characterization of the gene products of lntA ps (MM0196_0505), nahA...”
• Bifidobacterium breve UCC2003 Employs Multiple Transcriptional Regulators To Control Metabolism of Particular Human Milk Oligosaccharides
  James, Applied and environmental microbiology 2018
  • “...Bbr_1558 Bbr_1559 Bbr_1560 Bbr_1585 Bbr_1586 Bbr_1587 Bbr_1588 Bbr_1589 Bbr_1590 James et al. Applied and Environmental Microbiology regulators responsible for...”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...(Bbr_1585; galE ), a phosphotransferase family protein (Bbr_1586; nahK ), two permease proteins (Bbr_1588 and Bbr_1589; galP1 and galP2 , respectively), and a solute-binding protein (Bbr_1590; galS ) ( Fig. 2 ), which are all predicted to function in the metabolism of GNB/LNB. Heterologous expression, purification...”
  • “...3.86 6.52 Bbr_1588 galP1 Permease protein of ABC transporter system for sugars 3.38 4.20 6.38 Bbr_1589 galP2 Permease protein of ABC transporter system for sugars 2.78 5.47 4.05 Bbr_1590 galS Solute-binding protein of ABC transporter system for sugars 4.41 4.45 16.49 The level of expression is...”
• Glycosulfatase-Encoding Gene Cluster in Bifidobacterium breve UCC2003
  Egan, Applied and environmental microbiology 2016
  • “...Bbr_1249 Bbr_1585 (galE) Bbr_1586 (nahK) Bbr_1587 (lnbP) Bbr_1588 Bbr_1589 Bbr_1590 a 12.63 6.17 9.85 8.58 96.75 35.36 31.25 4.175 10.84 11.88 3.07 3.09 4.96...”
• Cross-feeding by Bifidobacterium breve UCC2003 during co-cultivation with Bifidobacterium bifidum PRL2010 in a mucin-based medium
  Egan, BMC microbiology 2014
  • “...encode a predicted ABC transport system, including two predicted permease proteins (represented by Bbr_1588 and Bbr_1589), and a solute binding protein (Bbr_1590), which shares 98% identity with the GNB/LNB-specific binding protein of B. longum JCM1217 [ 60 ]. Bbr_1884 (designated galT2 ), encoding a predicted Gal-1-phosphate...”
  • “...3.67 Bbr_1587_ lnbP Lacto- N -biose phosphorylase 3.19 Bbr_1588 ABC transport system, permease protein 3.34 Bbr_1589 ABC transport system, permease protein 2.88 Bbr_1590 ABC transport system, solute binding protein 8.95 Bbr_1740_ dapA4 Dihydrodipicolinate synthase 9.91 Bbr_1741 Conserved hypothetical protein 8.83 Bbr_1742_ fucP L-fucose permease 7.81 Bbr_1833_...”
• Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
  Turroni, Applied and environmental microbiology 2012
  • “...BL_0534 Bbr_1594 Bbr_1551 Bbr_0528 Bbr_0531 Bbr_1590 Bbr_1589 Bbr_1588 Bbr_1111 Bbr_1880 Bbr_0101 Bbr_1892 Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177...”

Bbr_0418 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
25% identity, 86% coverage

• Comparative genomics and genotype-phenotype associations in Bifidobacterium breve
  Bottacini, Scientific reports 2018
  • “...Solute-binding protein of ABC transporter system for sugars PF01547 OConnell Motherway et al . 25 Bbr_0418 Permease protein of ABC transporter system for sugars PF00528 OConnell Motherway et al . 25 Bbr_0419 Permease protein of ABC transporter system for sugars PF00528 OConnell Motherway et al ....”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...LNnT LNB Lactosamine-HCl Lactose Bbr_0417 galC Solute-binding protein of ABC transporter system for sugars 10.93 Bbr_0418 galD Permease protein of ABC transporter system for sugars 3.23 5.18 6.98 Bbr_0419 galE Permease protein of ABC transporter system for sugars 3.10 7.88 3.18 9.80 3.07 Bbr_0420 galG GH42...”

LSEI_0990 ABC-type sugar transport system, permease component from Lactobacillus casei ATCC 334
25% identity, 71% coverage

• New Genes Involved in Mild Stress Response Identified by Transposon Mutagenesis in Lactobacillus paracasei
  Palud, Frontiers in microbiology 2018
  • “...0.50 * 1.58 0.44 LSEI_0938 Phosphate ABC transporter 3.35 0.69 * 1.01 0.25 1.34 0.39 LSEI_0990 Sugar ABC transporter 1.05 0.25 2.64 0.63 * 1.44 0.48 LSEI_1007 Spermidine/putrescine ABC transporter 2.33 0.54 * 4.05 1.13 * 1.35 0.52 LSEI_1041 DNA binding response regulator 1.35 0.29 1.41...”
  • “...LSEI_0794 100 93 68 82 LSEI_0806 100 95 75 80 LSEI_0938 100 81 75 76 LSEI_0990 100 87 77 75 LSEI_1289 100 95 78 76 LSEI_1007 100 95 81 82 (P) LSEI_1041 100 83 63 68 LSEI_1293 100 88 84 90 LSEI_1360 100 93 84 88...”

SCO0951 transport system permease protein from Streptomyces coelicolor A3(2)
29% identity, 73% coverage

• Deciphering the regulon of Streptomyces coelicolor AbrC3, a positive response regulator of antibiotic production
  Rico, Applied and environmental microbiology 2014
  • “...Time (h)c Predicted binding site sequenced SCO0167 SCO0951 SCO1391 SCO3020 SCO3263 SCO3334 SCO3590 SCO3992 SCO4075 SCO4123 SCO4596 SCO4630 SCO5085 SCO5236...”

TTC1287 No description from Thermus thermophilus HB27
25% identity, 55% coverage

• The high-affinity maltose/trehalose ABC transporter in the extremely thermophilic bacterium Thermus thermophilus HB27 also recognizes sucrose and palatinose
  Silva, Journal of bacteriology 2005
  • “...291 280 398 442 439 TTC1627 TTC1628 TTC1629 TTC1288 TTC1287 TTC1286 50/36 60/41 47/34 40/26 48/28 49/31 38/22 56/27 36/27 47/31 55/36 57/41 MalEs show signal...”

Desfe_0355 carbohydrate ABC transporter permease from Desulfurococcus amylolyticus DSM 16532
29% identity, 41% coverage

• Metabolic reconstruction and experimental verification of glucose utilization in Desulfurococcus amylolyticus DSM 16532
  Reischl, Folia microbiologica 2018
  • “...sugar transport system ATP-binding protein (Desfe_1188), which could channel the sugar via ABC transporter permease (Desfe_0355 and Desfe_0366) and the ABC transporter substrate-binding protein (Desfe_0354). Fermentative growth D. amylolyticus possesses all necessary genes for gluconeogenesis and glycolysis (Fig. 1 ). The glucose, fructose, and mannose degradation...”

TTHA1651 maltose ABC transporter, permease protein from Thermus thermophilus HB8
25% identity, 55% coverage

• Determination and Dissection of DNA-Binding Specificity for the Thermus thermophilus HB8 Transcriptional Regulator TTHB099
  Moncja, International journal of molecular sciences 2020
  • “...1.27 10 3 1 TTHA1652 maltose ABC transporter substrate-binding protein +1.787 1.72 10 3 2 TTHA1651 maltose ABC transporter permease +2.154 1.17 10 3 3 TTHA1650 maltose ABC transporter permease +2.108 1.29 10 3 1 TTHB186 putative transcriptional regulator +3.377 2.59 10 3 2 TTHB187 hypothetical...”

Balac_1598 MalF-type ABC sugar transport systems permease component from Bifidobacterium animalis subsp. lactis Bl-04
27% identity, 88% coverage

• An ATP Binding Cassette Transporter Mediates the Uptake of α-(1,6)-Linked Dietary Oligosaccharides in Bifidobacterium and Correlates with Competitive Growth on These Substrates
  Ejby, The Journal of biological chemistry 2016
  • “...the cytoplasm by the ABC transport system (Balac_1598, Balac_1597, and Balac_1610). The -galactosidase (Balac_1601) and the -(1,6)-glucosidase are responsible...”
• Genetic and physiological responses of Bifidobacterium animalis subsp. lactis to hydrogen peroxide stress
  Oberg, Journal of bacteriology 2013
  • “...Balac_1502 Balac_1503 Balat_0464 Balac_1081 Balac_1597 Balac_1598 Balac_1599 Balac_1601 Balac_1567 Balac_1568 Balac_1569 Balac_1570 Balac_1572 Balac_1573...”
• Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
  Andersen, BMC genomics 2013
  • “...F 4.5 14.0 Balac_1597 ABC transporter, permease component Galactoside, Glucoside B,D,E Raffinose F 14.1 13.9 Balac_1598 ABC transporter, permease component Galactoside, Glucoside B,D,E Isomaltose F 20.1 18.6 Balac_1599 ABC transporter, oligosaccharide-binding protein Galactoside, Glucoside B,D,E Isomaltose F 17.8 16.7 Balac_1601 -galactosidase, GH36 Galactoside, Glucoside B,D,E Raffinose...”

ECs1890 putative binding-protein dependent transport protein from Escherichia coli O157:H7 str. Sakai
28% identity, 73% coverage

• Evolution of genomic content in the stepwise emergence of Escherichia coli O157:H7
  Wick, Journal of bacteriology 2005
  • “...a putative carbohydrate transport and metabolism gene cluster (ecs1890 to -95), which was divergent in O55 strain 5905. Downloaded from http://jb.asm.org/ on...”

Blon_2176 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
26% identity, 66% coverage

• Bifidobacterium infantis treatment promotes weight gain in Bangladeshi infants with severe acute malnutrition
  Barratt, Science translational medicine 2022
  • “...Escherichia, Shigella, Klebsiella and Streptococcus species ( fig. S1A , B , table S1D ). Blon_2176 , part of the H5 gene cluster, encodes the permease component of the ABC transporter for a prominent lacto-N-biose type I tetrasaccharide in breast milk. A qPCR assay using primers...”
  • “...samples from children with SAM compared to healthy Bangladeshi children that had detectable amounts of Blon_2176 (38% versus 66%, respectively; P <0.05, two proportion Z test; table S1A ). Colonization of Bangladeshi infants with SAM by milk-adapted B. infantis EVC001 Given the deficiency of B. infantis...”
• Human Milk Oligosaccharide Utilization in Intestinal Bifidobacteria Is Governed by Global Transcriptional Regulator NagR
  Arzamasov, mSystems 2022
  • “...-acetylhexosamine phosphorylase EC 2.4.1.211 63 Blon_2175 gltC LNT/LNB/GNB ABC transporter permease protein 2 TC 3.A.1.1.48 Blon_2176 gltB LNT/LNB/GNB ABC transporter permease protein 1 TC 3.A.1.1.48 Blon_2177 gltA LNT/LNB/GNB ABC transporter substrate-binding protein TC 3.A.1.1.48 39 Blon_2331 lacS2 Lactose MFS permease-2 TC 2.A.2 Blon_2332 lacS Lactose MFS...”
• Comparative Genome Analysis of Bifidobacterium longum subsp. infantis Strains Reveals Variation in Human Milk Oligosaccharide Utilization Genes among Commercial Probiotics
  Duar, Nutrients 2020
  • “...Group 1 and Group 2 occurred in the H5 cluster. Specifically, in the genes Blon_2175, Blon_2176 to Blon_2177 encoding an ABC-type transporter predicted to uptake lacto- N -biose ( Figure 1 b). Further examination, by aligning this genomic region in representative strains from Group 1 (ATCC...”
  • “...Group 2 (NLS and BB-02(DSM 33361)) ( Figure 2 a), revealed that the genes Blon_2175, Blon_2176 and Blon_2177 are in fact absent from the Group 2 strains ( Figure 2 a). This same region in the EVC001 and ATCC 15697 strains presented a high degree of...”
• Inefficient Metabolism of the Human Milk Oligosaccharides Lacto-N-tetraose and Lacto-N-neotetraose Shifts Bifidobacterium longum subsp. infantis Physiology
  Özcan, Frontiers in nutrition 2018
  • “...moieties ( 16 ). Three F1SBPs (Blon_0883, Blon_2344 and Blon_2347) and four ABC permeases (Blon_2175, Blon_2176, Blon_2345 and Blon_2346) were induced more than 2-fold during the growth on LNT or LNnT as the sole carbon source relative to lactose ( p < 0.05). Only Blon_2347 expression...”
  • “.... Genes involved in galactose metabolism (Blon_2171, Blon_2172, and Blon_2174) and adjacent ABC transporters (Blon_2175, Blon_2176, and Blon_2177) are strongly upregulated by both LNT and LNnT compared to lactose ( p < 0.05) (Figure 5 ). Moreover, LNnT prompted stronger induction of these genes relative to...”
• Exposure of Bifidobacterium longum subsp. infantis to Milk Oligosaccharides Increases Adhesion to Epithelial Cells and Induces a Substantial Transcriptional Response
  Kavanaugh, PloS one 2013
  • “...1.40 0.0200 1.55 0.0060 1.75 0.0020 Blon_2175 Solute transport 1.35 0.0300 1.56 0.0030 1.43 0.0100 Blon_2176 Solute transport 1.46 0.0060 1.63 0.0010 1.51 0.0020 Blon_2341 Hypothetical protein 1.29 0.0190 1.33 0.0100 1.73 0.0020 Blon_2379 Transport system inner membrane protein 1.55 0.0070 1.41 0.0200 1.85 0.0020 Blon_2380...”
• Analysis of predicted carbohydrate transport systems encoded by Bifidobacterium bifidum PRL2010
  Turroni, Applied and environmental microbiology 2012
  • “...Bbr_1892 Blon_2183 Blon_2331 Blon_0342 Blon_2015 Blon_2177 Blon_2176 Blon_2175 Blon_1050 Blon_2471 Blon_0129 B. longum subsp. infantis ATCC 15697 BLD_1757...”
• Broad conservation of milk utilization genes in Bifidobacterium longum subsp. infantis as revealed by comparative genomic hybridization
  LoCascio, Applied and environmental microbiology 2010
  • “...occurred specifically in three family 1 SBPs (Blon_2175, Blon_2176, and Blon_2177), while the rest of the cluster, including the LNB phosphorylase (LnpA;...”

BJA_RS20560 carbohydrate ABC transporter permease from Bradyrhizobium diazoefficiens USDA 110
23% identity, 78% coverage

• Isolation and Characterization of High-Temperature-Tolerant Mutants of Bradyrhizobium diazoefficiens USDA110 by Carbon-Ion Beam Irradiation
  Satoh, Microorganisms 2024
  • “...protein His177Arg 2,201,526 GC > AT BJA_RS10010 GFA family protein Ala332Thr 4,577,785 AT > CG BJA_RS20560 Sugar ABC transporter permease Met63Leu 8,585,966 GC > AT BJA_RS39745 MarR family transcriptional regulator Thr132Ile microorganisms-12-01819-t002_Table 2 Table 2 Symbiotic function of the M14 strain in inoculated soybean. Strain No....”

TC 3.A.1.1.5 / O30832 SmoF, component of Hexitol (glucitol; mannitol) porter from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)
29% identity, 67% coverage

• substrates: Hexitols

BBMN68_933 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum BBMN68
27% identity, 74% coverage

• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...BBMN68_195 GTGCCGCTCGTTGGCCGTAT TGGCCTCGTCGTCCAGCAGA 235 1.97 BBMN68_1099 GCACATTGCAACGCGACCCC ATGGCCAGCACGGCCACATC 160 1.93 BBMN68_1100 CAAGCAGGCCATCCCCACCG GGCCTTGGCCACTTCCTCGG 166 1.95 BBMN68_933 ACTACGTGCGCCTGTTGGGC GCGCCGTACACGAAACCCCA 226 2.01 BBMN68_1816 GCCGTGCCACCGACATCGAA CGATGCGGGCACGATCGACA 222 1.92 Determination of ATPase activity To investigate the role of ATPase in ATR in BBMN68, the activity of ATPase in the control...”
  • “...protein BBMN68_931 1301.73 108.13 12.04 * G COG0395 K02026, multiple sugar transport system permease protein BBMN68_933 1443.31 95.75 15.07 * G COG1175 K02025, multiple sugar transport system permease protein BBMN68_1670 15246.02 1373.46 11.10 * G COG1653 K02027, multiple sugar transport system substrate-binding protein BBMN68_1671 904.42 246.04...”

YcjO / b1311 putative ABC transporter membrane subunit YcjO from Escherichia coli K-12 substr. MG1655 (see 2 papers)
TC 3.A.1.1.46 / P0AFR7 Inner membrane ABC transporter permease protein YcjO, component of Probable glucoside uptake porter, YcjNOPV from Escherichia coli (strain K12)
b1311 predicted sugar transporter subunit: membrane component of ABC superfamily from Escherichia coli str. K-12 substr. MG1655
S1400 putative binding-protein dependent transport protein from Shigella flexneri 2a str. 2457T
27% identity, 73% coverage

• substrates: Glucosides
  tcdb comment: Encoded in an operon or gene cluster with a glucosyl hydrolase and two oxidoreductases (Moussatova et al. 2008)
• Co-translational protein aggregation and ribosome stalling as a broad-spectrum antibacterial mechanism
  Khodaparast, Nature communications 2025 (no snippet)
• 18th Congress of the European Hematology Association, Stockholm, Sweden, June 13–16, 2013
  , Haematologica 2013
• luxS-dependent gene regulation in Escherichia coli K-12 revealed by genomic expression profiling
  Wang, Journal of bacteriology 2005
  • “...b3906 b2060 b0790 b1720 b1010 b2797 b2993 b0042 b1001 b2549 b1311 b3141 b1012 b1571 lsrG lsrD lsrA lsrB metE lsrF lsrK yneE yfaE tam yjhR lsrR lsrC gpmB argX...”
• Probiotics and Postbiotics as Substitutes of Antibiotics in Farm Animals: A Review
  Zamojska, Animals : an open access journal from MDPI 2021
  • “...Carter A. Adams M. La Ragione R.M. Woodward M.J. Colonisation of poultry by Salmonella Enteritidis S1400 is reduced by combined administration of Lactobacillus salivarius 59 and Enterococcus faecium PXN-33 Vet. Microbiol. 2017 199 100 107 10.1016/j.vetmic.2016.12.029 28110775 31. Wang J. Wan C. Shuju Z. Yang Z....”
  • “...salivarius 59 and Enterococcus faecium PXN33/probiotic per os in feed Decreased colonization by Salmonella Enteritidis S1400 [ 30 ] E. faecium /probiotic per os in feed Increased egg weight, serum FSH * levels, decreased Bacteroidetes [ 31 ] Bacillus subtilis C-3102/probiotic per os in feed Reduction...”
• Phosphorylation-Mediated Molecular Pathway Changes in Human Pituitary Neuroendocrine Tumors Identified by Quantitative Phosphoproteomics
  Li, Cells 2021
  • “...(ID: P35658), Thr1399 (ratio of T/N = 3.36, p = 3.84 10 6 ), and S1400 (ratio of T/N = 3.15, p = 4.81 10 5 ) in NPC-RanBP2 (ID: P49792), S28 (ratio of T/N = 1.41, p = 7.09 10 3 ) in survival motor...”
• Benefits and Inputs From Lactic Acid Bacteria and Their Bacteriocins as Alternatives to Antibiotic Growth Promoters During Food-Animal Production
  Vieco-Saiz, Frontiers in microbiology 2019
  • “...10 7 CFU/mL of Lb. salivarius 59 and Ent. faecium PXN33 by reducing Salmonella Enteritidis S1400 colonization in chicks. Penha Filho et al. (2015) reported the effect of 1 10 5 CFU of a Lb. -based probiotic suspension on reducing Salmonella colonization when this strain was...”
  • “...Ragione R. M. Woodward M. J. ( 2017 ). Colonisation of poultry by Salmonella Enteritidis S1400 is reduced by combined administration of Lactobacillus salivarius 59 and Enterococcus faecium PXN-33. Vet. Microbiol. 199 100 107 . 10.1016/j.vetmic.2016.12.029 28110775 Cavera V. L. Arthur T. D. Kashtanov D. Chikindas...”
• The Biological Fight Against Pathogenic Bacteria and Protozoa
  Villa, New Weapons to Control Bacterial Growth 2016
  • “...E. coli O157:H7, C. difficile DSM1296, C. perfringens DSM11780, S typhimurium 3530, and Salmonella enteritidis S1400 (Thapa et al. 2012 ). Fig.1 Chemical structure of LFF571. LFF571, a semisynthetic thiopeptide (see Selva et al. 1991 ) Gastroesophageal reflux disease is a common condition that, according to...”
• Genomic and proteomic characterization of the broad-host-range Salmonella phage PVP-SE1: creation of a new phage genus
  Santos, Journal of virology 2011
  • “...The phage host, Salmonella enterica serovar Enteritidis strain S1400, belongs to the University of Bristol's private collection (64). The rough and deep rough...”
  • “...agar plates using a standard procedure (60), with strain S1400 as a host. Phage particles were subsequently collected by adding 5 ml of SM buffer (100 mM...”

ML1087 probable ABC-transport protein, inner membrane component from Mycobacterium leprae TN
25% identity, 85% coverage

• Mycobacterium leprae Transcriptome During In Vivo Growth and Ex Vivo Stationary Phases
  Ojo, Frontiers in cellular and infection microbiology 2021
  • “...expression when compared to MFP5 ( Figure3E ). Many of the sugar transporters like sugA (ML1087), sugB (ML1088) and sugC (ML1089) were down regulated in ML96 along with uspE (ML1769), uspC (ML1770) and mmpL10 (ML1231). ML0283, a possible cation-efflux transporter was significantly upregulated at 96 hr...”

Q49976 Malf from Mycobacterium leprae
25% identity, 85% coverage

• Microarray analysis of iron deficiency chlorosis in near-isogenic soybean lines.
  O'Rourke, BMC genomics 2007
  • “...0.0078 GmTC214121 Q9FE67 Ethylene Responsive Transcription Factor/Ubiquitin 2Fe, 8PS, 33ST/2Fe 1.00E-24/2.00E-64 Gm-c1028-6890 5.219 0.0163 GmTC214518 Q49976 Ubiquitin 2Fe 2.00E-63 Gm-c1028-8604 2.821 0.0935 GmTC228370 Q9AXD7 Response Regulator Protein (ARR) 1Fe, 1PS, 7ST 1.00E-49 Gm-c1028-8161 2.827 0.0246 GmTC205220 Q69IX0 RER1A 1Fe, 1PS 1.00E-67 Gm-c1028-6556 2.891 0.0340 GmTC228039 Q75HJ3...”

Bbr_0527 carbohydrate ABC transporter permease from Bifidobacterium breve UCC2003
26% identity, 80% coverage

• Selective human milk oligosaccharide utilization by members of the <i>Bifidobacterium pseudocatenulatum</i> taxon
  Sanchez-Gallardo, Applied and environmental microbiology 2024
  • “...LacI family lntR Bbr_0526 MM0196_1515 29.06 Permease protein of ABC transporter system for sugars lntP1 Bbr_0527 MM0196_1518 88.27 Permease protein of ABC transporter system for sugars lntP2 Bbr_0528 MM0196_1517 86.15 GH42 Beta-galactosidase lntA Bbr_0529 MM0196_0505 76.38 Solute-binding protein of ABC transporter system for sugars lntS Bbr_0530...”
• Metabolism of the predominant human milk oligosaccharide fucosyllactose by an infant gut commensal
  James, Scientific reports 2019
  • “...supplemented with ribose. Gene ID Gene name Function 2-FL Lactose Bbr_0526 lntR LacI transcriptional regulator Bbr_0527 lntP1 ABC transporter permease 2.61 3.81 Bbr_0528 lntP2 ABC transporter permease 3.35 2.12 Bbr_0529 lntA GH42 Beta-galactosidase 2.48 2.21 Bbr_0530 lntS ABC transporter solute binding protein Bbr_1551 lacS Galactoside symporter...”
• Bifidobacterium breve UCC2003 Employs Multiple Transcriptional Regulators To Control Metabolism of Particular Human Milk Oligosaccharides
  James, Applied and environmental microbiology 2018
  • “...6, 2018 by guest Locus tag Bbr_0526 Bbr_0527 Bbr_0528 Bbr_0529 Bbr_0530 Bbr_1247 Bbr_1248 Bbr_1249 Bbr_1250 Bbr_1251 Bbr_1252 Bbr_1554 Bbr_1555 Bbr_1556...”
  • “...GCAGACGATACTGCACGCG GTCAAGCATCTCTACCAC Amplification of Bbr_0527 promoter fragments with IRD700-labeled oligonucleotides 527IRDfa 527IRDra 527IRDfb...”
• Bifidobacterium breve UCC2003 metabolises the human milk oligosaccharides lacto-N-tetraose and lacto-N-neo-tetraose through overlapping, yet distinct pathways
  James, Scientific reports 2016
  • “...Bbr_1551-1553 (outlined in Fig. 2 ) in LNT and LNB metabolism in B. breve UCC2003. Bbr_0527 and Bbr_0528 (designated here as lntP1 and lntP2 , respectively) are both predicted to encode permease components of an ABC transporter system. Also located in this cluster ( Fig. 2...”
  • “...Galactose-1-phosphate uridylyltransferase 5.08 Bbr_0492 galK Galactokinase 3.57 Bbr_0526 lntR Transcriptional regulator, LacI family 3.95 10.16 Bbr_0527 lntP1 Permease protein of ABC transporter system for sugars 6.81 10.05 8.57 3.48 Bbr_0528 lntP2 Permease protein of ABC transporter system for sugars 3.23 10.64 3.03 11.15 3.35 Bbr_0529 lntA...”
• Transcriptional and functional characterization of genetic elements involved in galacto-oligosaccharide utilization by Bifidobacterium breve UCC2003
  O'Connell, Microbial biotechnology 2013
  • “..., cloning vector Law et al . (1995 ) pORI19-tet-gosD Internal 325 bp fragment of bbr_0527 and tetW cloned in pORI19 This study pORI19-tet-gosG Internal 395 bp fragment of bbr_0529 and tetW cloned in pORI19 This study pORI19-tet-lacS Internal 479 bp fragment of bbr_1551 and tetW...”

Cthe_2126 binding-protein-dependent transport systems inner membrane component from Clostridium thermocellum ATCC 27405
Cthe_2126 carbohydrate ABC transporter permease from Acetivibrio thermocellus ATCC 27405
24% identity, 68% coverage

• Utilization of Monosaccharides by Hungateiclostridium thermocellum ATCC 27405 through Adaptive Evolution
  Ha-Tran, Microorganisms 2021
  • “...the CbpC operon, namely the binding protein-dependent transport system msdC1 (Cthe_2125) and permease component msdC2 (Cthe_2126), were highly expressed in GAs1 and, to a lesser extent, in FAs1. Four genes of the CbpD operon (Cthe_24462449), such as ribose ABC transporter cbpD , ATP-binding protein nbdD ,...”

VPA1400 maltose ABC transporter, permease protein from Vibrio parahaemolyticus RIMD 2210633
23% identity, 45% coverage

• Insights into Vibrio parahaemolyticus CHN25 response to artificial gastric fluid stress by transcriptomic analysis
  Sun, International journal of molecular sciences 2014
  • “...-ribose transporter subunit RbsB Maltose transport VPA1399 ( malG ) Chn25A_1076 2.0352 Maltose transporter permease VPA1400 ( malF ) Chn25A_1077 2.8009 Maltose transporter membrane protein VPA1401( malE ) Chn25A_1078 3.0226 Maltose ABC transporter periplasmic protein VPA1402 Chn25A_1079 2.561 Maltose/maltodextrin transporter ATP-binding protein VPA1644 ( lamB )...”

IYO_006370 carbohydrate ABC transporter permease from Pseudomonas syringae pv. actinidiae ICMP 18884
PSPTO_1293 glucose ABC transporter, permease protein, putative from Pseudomonas syringae pv. tomato str. DC3000
25% identity, 73% coverage

• Transposon insertion libraries for the characterization of mutants from the kiwifruit pathogen Pseudomonas syringae pv. actinidiae
  Mesarich, PloS one 2017
  • “...plating was carried out in triplicate. The nine remaining genes ( IYO_001755 , IYO_006345 , IYO_006370 , IYO_007710 , IYO_008365 , IYO_012780 , IYO_025885 , IYO_026305 and IYO_027710 ) were disrupted only once in the set of putative complete or partial auxotrophic mutants analyzed ( S2...”
• Data-Independent Acquisition Proteomics Unravels the Effects of Iron Ions on Coronatine Synthesis in Pseudomonas syringae pv. tomato DC3000
  He, Frontiers in microbiology 2020
  • “...for amino acid uptake (PSPTO_4887, PSPTO_4173, PSPTO_4919, PSPTO_1258, PSPTO_1256, and PSPTO_1255), glucose ABC transporter (PSPTO_1294, PSPTO_1293, and gltK), ribose ABC transporters (rbsA-1), iron ABC transporters (PSPTO_5562 and PSPTO_5561), peptide transporters (PSPTO_4562, PSPTO_4559, dppC, PSPTO_4558, and PSPTO_4564), a mannitol ABC transporter (PSPTO_2705), dipeptide ABC transporters (PSPTO_4562, PSPTO_4559,...”

Spro_4473 binding-protein-dependent transport systems inner membrane component from Serratia proteamaculans 568
22% identity, 45% coverage

• Members of native coral microbiota inhibit glycosidases and thwart colonization of coral mucus by an opportunistic pathogen
  Krediet, The ISME journal 2013
  • “...were identified as homologous to the malF gene (Spro_4473; base pairs 283-715) of Serratia proteamaculans. However, attempts to complement the transposon mutant...”

Dshi_0548 ABC transporter for Xylitol, permease component 1 from Dinoroseobacter shibae DFL-12
27% identity, 76% coverage

• mutant phenotype: Specific phenotypes on Xylitol; Xylitol. Phenotype is very specific

Blon_2379 binding-protein-dependent transport systems inner membrane component from Bifidobacterium longum subsp. infantis ATCC 15697
29% identity, 65% coverage

• Exposure of Bifidobacterium longum subsp. infantis to Milk Oligosaccharides Increases Adhesion to Epithelial Cells and Induces a Substantial Transcriptional Response
  Kavanaugh, PloS one 2013
  • “...1.46 0.0060 1.63 0.0010 1.51 0.0020 Blon_2341 Hypothetical protein 1.29 0.0190 1.33 0.0100 1.73 0.0020 Blon_2379 Transport system inner membrane protein 1.55 0.0070 1.41 0.0200 1.85 0.0020 Blon_2380 Sugar transport system solute binding protein 1.51 0.0030 1.38 0.0100 1.53 0.0007 3SL 3sialyllactose; 6SL 6sialyllactose; 3+6SL combined...”

BAB2_0584 Binding-protein-dependent transport systems inner membrane component:Blood group Rhesus C/E and D polypeptide from Brucella melitensis biovar Abortus 2308
24% identity, 84% coverage

• Endoribonuclease YbeY Is Linked to Proper Cellular Morphology and Virulence in Brucella abortus
  Budnick, Journal of bacteriology 2018
  • “...protein), bab2_0583 (encoding an ABC transporter permease), bab2_0584 (encoding an ABC transporter permease), bab2_0585 (encoding UgpB, an ABC transporter...”
  • “...BAB2_0300 BAB2_0519 BAB2_0547 BAB2_0548 BAB2_0583 BAB2_0584 BAB2_0585 BAB2_0593 BAB2_0700 BAB2_0822 BAB2_0827 BAB2_0828 BAB2_0829 BAB2_0830 BAB2_1109...”

7cagA / A0R2C2 Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 78% coverage

• Ligand: alpha-d-glucopyranose (7cagA)

Ac3H11_2064 glucose ABC transporter, permease component 1 from Acidovorax sp. GW101-3H11
29% identity, 62% coverage

• mutant phenotype: Specifically important for utilizing glucose. Also mildly important for mannose utilization and likely transports it as well.

alr0738 permease protein of sugar ABC transporter from Nostoc sp. PCC 7120
29% identity, 62% coverage

• Chemoheterotrophic growth of the Cyanobacterium Anabaena sp. strain PCC 7120 dependent on a functional cytochrome c oxidase
  Stebegg, Journal of bacteriology 2012
  • “...genes (all0261, all1027, all1823, all1916, all4824, all5282, alr0738, alr0789, alr2532, alr2722, alr3705, alr4277, alr4781, alr5362, alr5367, and alr5368) are...”

BP2830 putative ABC transport protein, inner mebrane component from Bordetella pertussis Tohama I
24% identity, 78% coverage

• Modulation of Pertussis and Adenylate Cyclase Toxins by Sigma Factor RpoE in Bordetella pertussis
  Barbier, Infection and immunity 2017
  • “...Membrane-associated gene products BP2497 BP0840 BP0664 BP1709 BP1708 BP2830 BP2652 Iron acquisition alcA alcB alcC alcD alcE bfrF T1SSa adenylate cyclase toxin...”

LMOf2365_2829 ABC transporter, permease protein from Listeria monocytogenes str. 4b F2365
26% identity, 76% coverage

• Contributions of a LysR Transcriptional Regulator to Listeria monocytogenes Virulence and Identification of Its Regulons
  Abdelhamed, Journal of bacteriology 2020 (secret)

AT5A_19371 carbohydrate ABC transporter permease from Agrobacterium tumefaciens 5A
24% identity, 79% coverage

• Introducing the ArsR-Regulated Arsenic Stimulon
  Rawle, Frontiers in microbiology 2021
  • “...AT5A_19366 Sugar ABC transporter periplasmic sugar-binding protein 7.2 7.8 5.5 5.7 26.5 7.0 5.9 5.1 AT5A_19371 Sugar ABC transporter permease 5.7 6.3 6.1 4.3 25.4 5.4 4.7 4.0 AT5A_19376 Multiple sugar transport system permease protein 4.2 4.6 9.1 3.1 30.9 3.7 3.5 3.0 AT5A_19386 Sugar ABC...”
  • “...direction upon As(III) exposure. An example of this pattern is the sugar transporter system (AT5A_19366, AT5A_19371, AT5A_19376, AT5A_19386) in the arsR1 mutant ( Supplementary Table 3 ). The third pattern involved no deviation from wild type in the absence of As(III), followed by a significant change...”

VCA0944 maltose ABC transporter, permease protein from Vibrio cholerae O1 biovar eltor str. N16961
22% identity, 45% coverage

• Disrupting Central Carbon Metabolism Increases β-Lactam Antibiotic Susceptibility in Vibrio cholerae
  Keller, Journal of bacteriology 2023 (secret)
• Transcriptional Silencing by TsrA in the Evolution of Pathogenic Vibrio cholerae Biotypes
  Caro, mBio 2020
  • “...mutants. These encode a hypothetical protein (VC0395_RS21005) in O395-N1, the maltose transporter membrane protein MalF (VCA0944) in C6706, and an AraC-family regulator (N900_RS05235) and an X-Pro aminopeptidase (N900_RS00355) in Haiti H1. In contrast to previous findings, our data showed no effect of tsrA on hapA expression...”
• Transcriptional profiling of Vibrio cholerae O1 following exposure to human anti- lipopolysaccharide monoclonal antibodies
  Baranova, Pathogens and disease 2020
  • “...VC0911 VCA0247 VC1649 VC0910 VCA0860 VCA0945 VCA0908 VCA0944 VC0606 VCA0136 VCA0137 VC0089 VC1778 VC0795 VC0797 VC0796 VCA0684 VCA0685 VCA0687 VC0713 VCA0686...”
• Transcriptomics reveals a cross-modulatory effect between riboflavin and iron and outlines responses to riboflavin biosynthesis and uptake in Vibrio cholerae
  Sepúlveda-Cisternas, Scientific reports 2018
  • “...transporter%2C periplasmic hemin-binding protein HutB 2.383 VCA0914 hutB2 hemin ABC transporter%2C permease protein%2C putative 1.808 VCA0944 malF maltose ABC transporter permease protein 1.853 VCA0945 malE maltose ABC transporter periplasmic maltose-binding protein 1.986 VCA0954 cheV chemotaxis protein CheV putative 1.029 VCA0965 GGDEF family protein 1.396 VCA0966 hypothetical...”
• The LysR-type virulence activator AphB regulates the expression of genes in Vibrio cholerae in response to low pH and anaerobiosis
  Kovacikova, Journal of bacteriology 2010
  • “...2.60 2.64 3.89 2.60 VCA0186 VCA0188 VCA0274 VCA0526 VCA0834 VCA0944 1.7E15 9.0E05 8.7E07 4.6E06 4.3E06 1.9E04 7.56 2.93 6.41 5.86 3.41 3.58 VCA1027 8.104 2.89...”
  • “...genes involved in maltose uptake and utilization (VCA0013, VCA0944, and VCA1027), an ABC transporter gene (VCA1099), and six genes annotated as hypotheticals...”
• The transcriptional regulator VqmA increases expression of the quorum-sensing activator HapR in Vibrio cholerae
  Liu, Journal of bacteriology 2006
  • “...ABC transporter permease protein VC0018 VC0170 VC0171 VC0389 VC2013 VCA0137 VCA0943 VCA0944 4.3 2.7 2.7 2.8 3.6 63.9 2.7 3.7 0.3 0.0 0.0 0.2 0.1 0.0 0.5 0.8 P H...”
• Characterization of Vibrio cholerae RyhB: the RyhB regulon and role of ryhB in biofilm formation
  Mey, Infection and immunity 2005
  • “...Maltose ABC transporterc,d ................................................................................................VCA0944 (4.4), VCA0945 (2.5) Maltose...”

sugA / P9WG03 ABC-type trehalose transporter integral membrane protein from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
SUGA_MYCTU / P9WG03 Trehalose transport system permease protein SugA from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
TC 3.A.1.1.31 / O50452 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER SUGA, component of The trehalose-recycling ABC transporter, LpqY-SugA-SugB-SugC (essential for virulence) from Mycobacterium tuberculosis (see 2 papers)
NP_215752 sugar ABC transporter permease SugA from Mycobacterium tuberculosis H37Rv
Rv1236 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER SUGA from Mycobacterium tuberculosis H37Rv
Mb1268 PROBABLE SUGAR-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER SUGA from Mycobacterium bovis AF2122/97
25% identity, 82% coverage

• function: Part of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Probably responsible for the translocation of the substrate across the membrane.
  subunit: The complex is composed of two ATP-binding proteins (SugC), two transmembrane proteins (Suga and SugB) and a solute-binding protein (LpqY).
• substrates: Trehalose
• Trehalose-recycling ABC transporter LpqY-SugA-SugB-SugC is essential for virulence of Mycobacterium tuberculosis.
  Kalscheuer, Proceedings of the National Academy of Sciences of the United States of America 2010
  • GeneRIF: Data show that the LpqY-SugA-SugB-SugC ATP-binding cassette transporter is a recycling system mediating the retrograde transport of released trehalose.
• Genome-wide screen identifies host loci that modulate Mycobacterium tuberculosis fitness in immunodivergent mice
  Meade, G3 (Bethesda, Md.) 2023
  • “...37.760 3.34 24.764 128.756 2.82E02 hp042 Rv1913 Rv1913 7 39.822 3.63 30.689 145.321 2.96E03 hp043 Rv1236 sugA 7 40.289 3.13 24.822 140.297 5.28E03 hp044 Rv1528c papA4 7 40.289 4.97 40.226 46.357 2.11E02 hp045 Rv1542c glbN 7 40.289 3.71 3.078 145.321 5.77E02 hp046 Rv1992c ctpG 7 40.289...”
• Genomic analysis of Mycobacterium brumae sustains its nonpathogenic and immunogenic phenotype
  Renau-Mínguez, Frontiers in microbiology 2022
  • “...Two-Component System (TCS) 76.2 100 Rv1002c Rv1002c 1,118,428 1,119,939 Reverse Other virulence factors 72.4 100 Rv1236 sugA 1,378,927 1,379,850 Forward Protein ABC transporter 73.1 93.8 Rv1237 sugB 1,379,855 1,380,679 Forward Protein ABC transporter 81.1 98.9 Rv1238 sugC 1,380,684 1,381,865 Forward Protein ABC transporter 78.7 100 Rv1293...”
• Shotgun proteomic profiling of dormant, 'non-culturable' Mycobacterium tuberculosis
  Nikitushkin, PloS one 2022
  • “...consistency in behaviour of proteins of the ABC trehalose transporter complex LpqYSugASugBSugC ( Rv1235 , Rv1236 , Rv1237 , Rv1238 ): out of four annotated in the Mtb genome only Rv1235 and Rv1238 were detected in the current study, albeit with a different sign of FC...”
• Heat-killed Mycolicibacterium aurum Aogashima: An environmental nonpathogenic actinobacteria under development as a safe novel food ingredient
  Nouioui, Food science & nutrition 2021
  • “...orf01262 Rv3824c 51.0 <95 2E170 lpq Y orf03429 Rv1235 28.3 <60% 2E53 sug A orf03428 Rv1236 53.0 <60% 3E91 sug B orf03427 Rv1237 57.1 <60% 3E109 sug C orf03426 Rv1238 53.9 <60% 8E142 Copper uptake Copper exporter ctp V orf03576 Rv0969 54.3 <60% 0 fad D33...”
• ATP-binding cassette (ABC) import systems of Mycobacterium tuberculosis: target for drug and vaccine development
  Soni, Emerging microbes & infections 2020
  • “...of sn-glycerol-3-phosphate and maltose [ 39 ] Trehalose importer (LpqY-SugABC/Rv1235-Rv1238) SBP: LpqY (Rv1235) TMD: SugA (Rv1236) and SugB (Rv1237) NBD: SugC (Rv1238) (two copies) LpqY-SugABC mutant shows reduced virulence in mice [ 43 ] Uptake and recycle disaccharide trehalose [ 43 ] Involved in biofilm formation...”
• A systematic assessment of mature MBP in membrane protein production: overexpression, membrane targeting and purification
  Hu, Protein expression and purification 2011
  • “...Rv3277 4 30.0 o o Rv3101c 4 32.8 + + Rv1304 5 27.5 o o Rv1236 5 33.0 o + Rv1337 6 25.7 o o Rv1457c 6 27.3 o o Rv1237 6 29.1 o o Rv2398c 6 29.3 o o Rv2938 6 29.6 o o Rv2399c...”
• Characterization of a Clp protease gene regulator and the reaeration response in Mycobacterium tuberculosis
  Sherrid, PloS one 2010
  • “...hypothetical protein Rv1234 transmembrane protein Rv3177 Peroxidase Rv1235 sugar-binding lipoprotein lpqY Rv3188 conserved hypothetical protein Rv1236 sugar-transport membrane protein ABC transporter sugA Rv3189 conserved hypothetical protein Rv1259 uracil dna glycosylase Rv3201c ATP-dependent DNA helicase Rv1286 sulfate adenyltransferase/adenylylsulfate kinase Rv3205c conserved hypothetical protein Rv1472 enoyl-CoA hydratase echA12...”
  • “.... Reaeration Response genes involved in metabolic adaptation include a sugar transporter ( Rv1235 and Rv1236 ) predicted to be essential for MTB survival in macrophages and mice [29] [30] , the triacylglycerol lipase lipY ( Rv3097c ), recently shown to cleave triacylglycerides upon reaeration, and...”
• Development and analysis of an in vivo-compatible metabolic network of Mycobacterium tuberculosis
  Fang, BMC systems biology 2010
  • “...phenol phthiocerol dimycocerosate to the biomass objective function [ 62 ] 27 32 33 34 Rv1236 Rv1237 Rv1238 sugA sugB sugC FN Transport Transport of glucose, maltoheptaose, maltose, ribose, trehalose, and xylose into cell (1) Allowed xylose uptake and added xylose to the biomass objective function...”
• More
• Circulating Mycobacterium bovis peptides and host response proteins as biomarkers for unambiguous detection of subclinical infection
  Lamont, Journal of clinical microbiology 2014
  • “...MB2122c MB1672c MB1554c (pks5) MB1895c MB3729c MB1268 MB3017c Transcriptional regulator (LuxR family) Methyltransferase activity Glucose metabolism Aldehyde...”

BOV_A0618 glycerol-3-phosphate ABC transporter, permease protein from Brucella ovis ATCC 25840
BRA0656 glycerol-3-phosphate ABC transporter, permease protein from Brucella suis 1330
23% identity, 84% coverage

• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618 BCAN_B0656 OSP SN-glycerol-3-phosphate import IM BMEII0624, ugpA OSP SN-glycerol-3-phosphate import BP BMEII0625 BruAb20571, ugpB BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521 BOV_A0454 BCAN_B0520...”
• ATP-Binding Cassette Systems of Brucella
  Jenner, Comparative and functional genomics 2009
  • “...ugpE BruAb20569, ugpE BRA0657, ugpE BOV_A0619 BCAN_B0657 OSP SN-glycerol-3-phosphate import IM BMEII0623, ugpE BruAb20570, ugpA BRA0656, ugpA BOV_A0618 BCAN_B0656 OSP SN-glycerol-3-phosphate import IM BMEII0624, ugpA OSP SN-glycerol-3-phosphate import BP BMEII0625 BruAb20571, ugpB BRA0655, ugpA BOV_A0617 BCAN_B0655 80 OSP Oligosaccharide or polyol import ABC BMEII0750 BruAb20702 BRA0521...”

BLGT_09100 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum GT15
26% identity, 85% coverage

• The Gene Expression Profile Differs in Growth Phases of the Bifidobacterium Longum Culture
  Veselovsky, Microorganisms 2022
  • “...and galactose metabolism. Enzymes (BLGT_03060, BLGT_09090, BLGT_03845), Messenger RNA biogenesis and Exosome (BLGT_03845, BLGT_07730), Transporters (BLGT_09100, BLGT_09095). 3.2. KEGG Pathway and Functional Annotation of DEGs The biologically significant DEGs were further analyzed using the Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways. As predicted by KEGG,...”

BF29_RS09830 carbohydrate ABC transporter permease from Heyndrickxia coagulans DSM 1 = ATCC 7050
23% identity, 61% coverage

• Time-resolved transcriptomic and proteomic profiling of <i>Heyndrickxia coagulans</i> during NaOH-buffered L-lactic acid production
  Huang, Frontiers in microbiology 2023
  • “...attributed to the high concentration of sodium lactate in the fermentation broth. MdxE (BF29_RS09825), MdxF (BF29_RS09830), and MdxG (BF29_RS09835) collectively encode a maltodextrin transport system known as MdxEFG, where MdxE functions as the substrate-binding protein and the latter two act as permease proteins ( Schnert et...”

MAH_1236 carbohydrate ABC transporter permease from Mycobacterium avium subsp. hominissuis TH135
27% identity, 77% coverage

• The recombination-cold region as an epidemiological marker of recombinogenic opportunistic pathogen Mycobacterium avium
  Yano, BMC genomics 2019
  • “...these members were present. After manual screening for recombination-free regions, two loci, MAV_1375 (TH135 locus_tag MAH_1236, sugA gene, product name of trehalose ABC transporter) (Fig. 3 C) and MAV_2820 (TH135 locus_tag MAH_2466, product name of short chain dehydrogenase) (Additional file 3 ), were found to contain...”
  • “...P-450 (locus_tags: MAH_0788, MAV_0940) and the sugA gene encoding the trehalose ABC transporter (locus tags: MAH_1236, MAV_1375), could additively inform the core genome lineage (or association of BAPS subpopulations) of MAH isolates as well as M. avium subspecies. Features around the recombination-cold region Rare occurrences of...”

MAV_1375 ABC transporter, permease protein SugA from Mycobacterium avium 104
27% identity, 77% coverage

• The recombination-cold region as an epidemiological marker of recombinogenic opportunistic pathogen Mycobacterium avium
  Yano, BMC genomics 2019
  • “...members of SC2 and SC4, c Maximum likelihood tree based on the alignment of the MAV_1375 ortholog. GTR+G was used as the model, d Selected polymorphic sites in the alignment of the MAV_1375 ortholog We next investigated whether the allele types of the MAH_0788 ortholog could...”
  • “...SNPs unique to these members were present. After manual screening for recombination-free regions, two loci, MAV_1375 (TH135 locus_tag MAH_1236, sugA gene, product name of trehalose ABC transporter) (Fig. 3 C) and MAV_2820 (TH135 locus_tag MAH_2466, product name of short chain dehydrogenase) (Additional file 3 ), were...”

Balac_0486 MalF-type ABC sugar transport systems permease component from Bifidobacterium animalis subsp. lactis Bl-04
25% identity, 80% coverage

• Structural Identity of Galactooligosaccharide Molecules Selectively Utilized by Single Cultures of Probiotic Bacterial Strains
  Böger, Journal of agricultural and food chemistry 2019
  • “...cross BLAST searches using the GosDEC gene from B. lactis 04 (Balac_0485, Acc. nr. WP_004268783.1; Balac_0486, Acc. nr. WP_004269047.1) and GalCDE gene from B. breve UCC2003 (Bbr_0417_galc, Acc. nr. WP_015438440.1; Bbr_0418_galD, Acc. nr. WP_025262769.1; Bbr_0419_galE, Acc. nr. WP_003828491.1) as a reference. Total number of candidate genes...”
• Transcriptional analysis of oligosaccharide utilization by Bifidobacterium lactis Bl-04
  Andersen, BMC genomics 2013
  • “...GOS C 11.4 17.2 Balac_0485 ABC transporter, permease component Galactoside A GOS C 8.4 16.2 Balac_0486 ABC transporter, permease component Galactoside A GOS C 5.7 12.9 Balac_0511 Xylose isomerase xyloside A,C XOS D 13.8 15.1 Balac_0512 - l -arabinofuranosidase, GH43 xyloside A,C XOS D 6.8 13.6...”

BAD_RS08280 carbohydrate ABC transporter permease from Bifidobacterium adolescentis ATCC 15703
26% identity, 77% coverage

• Combining of transcriptome and metabolome analyses for understanding the utilization and metabolic pathways of Xylo-oligosaccharide in Bifidobacterium adolescentis ATCC 15703
  Yang, Food science & nutrition 2019
  • “...ABC transporter, solutebinding protein 1,971.94 686.94 BAD_RS00815 1.48 araQ Sugar ABC transporter permease 911.12 326.41 BAD_RS08280 1.46 msmF Sugar ABC transporter permease 1,353.65 491.14 BAD_RS00810 1.45 yurN Sugar ABC transporter permease 762.04 278.86 BAD_RS03705 1.35 ABC transporter permease 91.4 35.95 BAD_RS00990 1.33 ABC transporter substratebinding protein...”
  • “...bifidobacteria. Compared to xylose treatment, genes including the sugar transporter permease protein (encoded by BAD_RS00815, BAD_RS08280, BAD_RS00810, BAD_RS08205, BAD_RS03705, BAD_RS02260, BAD_RS07410) and transporter ATPbinding protein (encoded by BAD_RS02265, BAD_RS00495, BAD_RS04090, BAD_RS08375) were upregulated (Table 3 ), the same situation occurs in metabolites, including Lthreonine (meta_58), cellobiose...”

BCAL3040 ABC transporter, membrane permease from Burkholderia cenocepacia J2315
27% identity, 63% coverage

• Various Evolutionary Trajectories Lead to Loss of the Tobramycin-Potentiating Activity of the Quorum-Sensing Inhibitor Baicalin Hydrate in Burkholderia cenocepacia Biofilms
  Sass, Antimicrobial agents and chemotherapy 2019
  • “...CDS (2895340 to 2895341 GC to TT, 81 R724C) BCAL3040 ABC-type sugar transport system, permease SNP in CDS (3332415 A to G, F51L) 100 component BCAM0821...”
  • “...encoding the permease of a glucose/mannose ABC transporter (BCAL3040) was observed, likely affecting the uptake of certain carbohydrates. None of the mutations...”
• Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
  O'Grady, Frontiers in cellular and infection microbiology 2011
  • “...BCAL3038 ABC transporter ATP-binding component, carbohydrate ABC transporter 1.6 BCAL3039 ABC transporter, membrane permease 1.5 BCAL3040 ABC transporter, membrane permease 1.7 BCAL3041 MalE, maltose-binding protein 2.1 BCAL3364 Putative gluconokinase 1.7 BCAM0094 Xylulose kinase 1.7 BCAM1330 Cellulose polysaccharide export protein 1.7 BCAM1333 Cellulose exopolysaccharide acyltransferase 1.6 BCAM1390...”
  • “...lipoproteins carrier 1.53 BCAL3038 ABC transporter ATP-binding component 1.61 BCAL3039 ABC transporter, membrane permease 1.54 BCAL3040 ABC transporter, membrane permease 1.71 BCAL3041 Maltose-binding protein 2.09 BCAL3163 Putative nucleotidyltransferase 1.68 BCAL3203 Putative periplasmic TolB protein 1.64 BCAL3204 Putative OmpA family lipoprotein 1.68 BCAL3205 Putative exported protein 1.62...”

Ac3H11_2943 ABC transporter for D-Sorbitol, permease component 2 from Acidovorax sp. GW101-3H11
27% identity, 66% coverage

• mutant phenotype: Specific phenotypes on D-Sorbitol. The homolog in P. simiae WCS417 is probably a mannitol transporter as well.

lmo2838 similar to sugar ABC transporter permease protein from Listeria monocytogenes EGD-e
25% identity, 76% coverage

• Exploring Listeria monocytogenes Transcriptomes in Correlation with Divergence of Lineages and Virulence as Measured in Galleria mellonella
  Lee, Applied and environmental microbiology 2019 (secret)

SAOUHSC_00177 maltose ABC transporter, permease protein, putative from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_0210 maltose ABC transporter, permease protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_0153 hypothetical protein from Staphylococcus aureus subsp. aureus str. Newman
SACOL0194 maltose ABC transporter, permease protein from Staphylococcus aureus subsp. aureus COL
22% identity, 67% coverage

• Comparative Analysis of Virulence and Toxin Expression of Vancomycin-Intermediate and Vancomycin-Sensitive Staphylococcus aureus Strains
  Jin, Frontiers in microbiology 2020
  • “...SAOUHSC_00300 2.4787 1.03 2.09E-39 1.04E-38 Lipase SAOUHSC_02706 2.0555 6.25 2.26E-10 4.59E-10 Immunoglobulin G-binding protein Sbi SAOUHSC_00177 6.0315 ND 0 0 Maltose ABC transporter permease Hypothetical protein SAOUHSC_00179 6.4487 ND 0 0 Hypothetical protein SAOUHSC_00180 6.1303 0.2.98 0 0 Hypothetical protein SAOUHSC_00208 7.054 ND 1.13E-36 4.73E-36 Hypothetical...”
• Genomic and Long-Term Transcriptomic Imprints Related to the Daptomycin Mechanism of Action Occurring in Daptomycin- and Methicillin-Resistant Staphylococcus aureus Under Daptomycin Exposure
  Cafiso, Frontiers in microbiology 2020
  • “...only found in SAOUHSC_01387 inorganic phosphate transmembrane transporter. Results from carbohydrate transporters showed under-expression in SAOUHSC_00177 maltose ABC permease, in the SAOUHSC_02400 putative mannitol-specific PTS component, and in the SAOUHSC_00158 N -acetylmuramic acid transporter belonging to the phosphotransferase system. Cell adhesion Under-expression was shown in the...”
• Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
  Paudel, Applied and environmental microbiology 2021 (secret)
• Inactivation of the Ecs ABC transporter of Staphylococcus aureus attenuates virulence by altering composition and function of bacterial wall
  Jonsson, PloS one 2010
  • “...cation/H + antiporter subunit D 1.9 NWMN_0048 drug transporter 2.0 NWMN_0136 PTS system component 2.7 NWMN_0153 maltose ABC transporter permease protein 2.7 NWMN_0154 maltose ABC transporter permease protein 2.5 NWMN_0199 PTS system IIA component 0.5 NWMN_0211 ABC transporter ATP-binding protein 1.9 NWMN_0343 ABC transporter ATP-binding protein...”
• In vitro and in vivo models of Staphylococcus aureus endophthalmitis implicate specific nutrients in ocular infection
  Sadaka, PloS one 2014
  • “...(1.5) 6.5 (1.6) SACOL0193 Maltose ABC transporter, maltose-bindingprotein, putative 14.4 (1.3) 3.4 (1.2) 4.2 (1.4) SACOL0194 Maltose ABC transporter permease protein 11.1 (1.5) 3.3 (1.4) 3.7 (1.4) SACOL0195 Maltose ABC transporter permease protein 13.9 (1.5) 3.7 (1.4) 3.4 (1.5) SACOL0196 Oxidoreductase, Gfo/Idh/MocA family 12.6 (1.5) 3.3...”
• Staphylococcus aureus gene expression in a rat model of infective endocarditis
  Hanses, Genome medicine 2014
  • “...lantibiotic ABC transporter protein malE SACOL0193 ns ns 3.1 2.5 maltose ABC transporter, maltose-binding malF SACOL0194 7.4 3.9 6.0 3.5 maltose ABC transporter, permease protein malK SACOL0192 14.7 14.7 6.2 6.8 maltose ABC transporter, ATP-binding protein opuD SACOL2176 2.0 2.4 ns ns osmoprotectant transporter, BCCT family...”

SA0208 hypothetical protein from Staphylococcus aureus subsp. aureus N315
22% identity, 67% coverage

• Daptomycin resistance mechanisms in clinically derived Staphylococcus aureus strains assessed by a combined transcriptomics and proteomics approach
  Fischer, The Journal of antimicrobial chemotherapy 2011
  • “...lacA lacB lacD lacE lacF lacG lldP2 manA SA0208 scrA tagG treP treC SAV0734 SAV2417 MW0149 sirC fadB Function arginine deiminase ornithine carbamoyltransferase...”
• Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype
  Seggewiss, Journal of bacteriology 2006
  • “...SA2426 SA0541 SA1140 SA1960 SA0293 SA2156 SA0589 SA2303 SA0208 SA2302 SA0111 SA0848 SA2167 SA0207 SA0849 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00...”
• Characterization of the Staphylococcus aureus heat shock, cold shock, stringent, and SOS responses and their effects on log-phase mRNA turnover
  Anderson, Journal of bacteriology 2006
  • “...N315-SAS018 SA0011 SA0076 SA0129 SA0157 SA0160 SA0161 SA0181 SA0208 SA0299 SA0314 SA0414 SA0415 SA0425 SA0427 SA0436 SA0445 SA0480 SA0625 SA0639 SA0641 SA0692...”

B4602_RS00885 carbohydrate ABC transporter permease from Staphylococcus aureus
22% identity, 67% coverage

• Combined proteomic and transcriptomic analysis of the antimicrobial mechanism of tannic acid against Staphylococcus aureus
  Wang, Frontiers in pharmacology 2023
  • “...transporter, substrate-binding protein 1.81 1.26 B4602_RS03780 ceuA WP_000754443.1 Siderophore ABC transporter, substrate-binding protein 4.51 2.13 B4602_RS00885 ugpA WP_042727601.1 Sugar ABC transporter permease 0.28 0.64 B4602_RS00875 ugpC WP_000818913.1 Sn-glycerol-3-phosphate ABC transporter, ATP-binding protein 0.52 0.42 B4602_RS13905 lolD WP_000923760.1 ABC-type lipoprotein export system, ATP-binding protein 0.84 0.35 B4602_RS00520...”

BFP66_RS07040 carbohydrate ABC transporter permease from Streptococcus suis
24% identity, 82% coverage

• A novel aquaporin Aagp contributes to Streptococcus suis H₂O₂ efflux and virulence
  Zhu, Virulence 2023
  • “...sugar ABC transporters BFP66_RS00850 2.22 sugar ABC transporter permease; BFP66_RS02995 8.65 sugar ABC transporter permease; BFP66_RS07040 15.41 sugar ABC transporter permease; BFP66_RS07045 10.83 sugar ABC transporter substrate-binding protein; BFP66_RS08960 2.20 sugar ABC transporter substrate-binding protein; BFP66_RS00910 7.00 PTS sugar transporter subunit IIC; PTS system BFP66_RS02210 3.46...”

TC 3.A.1.1.30 / Q88P37 GtsB (GLcF), component of Glucose porter, GtsABCD from Pseudomonas putida (strain KT2440) (see paper)
PP_1016 carbohydrate ABC transporter permease from Pseudomonas putida KT2440
PP1016 sugar ABC transporter, permease protein from Pseudomonas putida KT2440
26% identity, 71% coverage

• substrates: glucose
  tcdb comment: The orthologue of GtsA (receptor) in P. aeruginosa (64% identical to the P. putida GtsA has been biochemically characterized (Stinson et al. 1977) and corresponds to the sequence with UniProt acc# Q9HZ48 (Friedhelm Pfeiffer, personal communication)
• Comparative Transcriptome Analysis of Pseudomonas putida KT2440 Revealed Its Response Mechanisms to Elevated Levels of Zinc Stress
  Peng, Frontiers in microbiology 2018
  • “...Medium-chain-fatty acid CoA ligase PP_0944 fumC 1 2.2 0.07 4.50 0.77 Class II fumarate hydratase PP_1016 gtsB 0.11 0.07 0.08 0.00 Mannose/glucose ABC transporter permease PP_1017 gtsC 0.12 0.00 0.11 0.01 Mannose/glucose ABC transporter permease PP_1018 gtsD 0.17 0.01 0.13 0.01 Mannose/glucose ABC transporter ATP binding...”
• UEG Week 2024 Poster Presentations
  , United European gastroenterology journal 2024
• UEG Week 2023 Poster Presentations
  , United European gastroenterology journal 2023
• The ColRS system is essential for the hunger response of glucose-growing Pseudomonas putida
  Putrinš, BMC microbiology 2011
  • “...Probable localization# PP1015 gtsA sugar ABC transporter, periplasmic sugar binding protein 2 (269; 587) P PP1016 gtsB sugar ABC transporter, permease protein 2 (717; 972) CM PP1018 gtsD sugar ABC transporter, ATP-binding protein 2 (414; 1094) CM PP1019 oprB1 porin B1 3 (66; 146; 909) OM...”
  • “...lysis. Knockouts of sugar transport genes located upstream of oprB1 , i.e., gtsA (PP1015), gtsB (PP1016), and gtsD (PP1018) also suppressed the lysis phenotype of the colR mutant. In addition to sugar transport genes, lysis was also suppressed by inactivation of the two-component system CbrA-CbrB, which...”
• Convergent peripheral pathways catalyze initial glucose catabolism in Pseudomonas putida: genomic and flux analysis
  del, Journal of bacteriology 2007
  • “...this, we found that the operon containing ORFs PP1015, PP1016, PP1017, PP1018, and PP1019, which encode a putative ABC glucose uptake system, was also induced...”
  • “...PP3379 PP3382 PP3383 PP3384 PP3416 PP3417 PP3418 PP1015 PP1016 PP1017 PP1018 PP1019 Regulatory genes PP1012 PP1013 PP3380 PP3415 Other functions PP1014 PP2968...”

SSUBM407_1448 multiple sugar-binding transport system permease protein from Streptococcus suis BM407
24% identity, 82% coverage

• Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis
  Holden, PloS one 2009
  • “...16 SSUBM407_1446 sucrose phosphorylase 1534855..1533407 32 SSUBM407_1447 multiple sugar-binding transport system permease protein 1535755..1534925 33 SSUBM407_1448 multiple sugar-binding transport system permease protein 1536641..1535766 23 SSUBM407_1449 multiple sugar-binding protein precursor 1538008..1536773 16 Region 7 SSUBM407_1489 conserved hypothetical protein 1572295..1571534 31 SSUBM407_1490 ABC-type glycine betaine transport system protein...”

NGCF_STRCO / O50500 Diacetylchitobiose uptake system permease protein NgcF from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
SCO6006 probable transmembrane transport protein from Streptomyces coelicolor A3(2)
27% identity, 73% coverage

• function: Part of the ABC transporter complex NgcEFG-MsiK involved in N,N'-diacetylchitobiose ((GlcNAc)2) uptake. Responsible for the translocation of the substrate across the membrane.
  subunit: The complex is composed of two ATP-binding proteins (MsiK), two transmembrane proteins (NgcF and NgcG) and a solute-binding protein (NgcE).
• NgcE^Sco Acts as a Lower-Affinity Binding Protein of an ABC Transporter for the Uptake of N,N'-Diacetylchitobiose in Streptomyces coelicolor A3(2)
  Iinuma, Microbes and environments 2018
  • “...The gene cluster includes two additional ORFs encoding the putative ABC-type integral membrane proteins ( SCO6006 and SCO6007 ) that form a transporter permease ( Fig. S1 ). Regarding most streptomycetes sugar ABC transporters, the gene for the ATPase component was not included in the cluster...”
  • “...orthologous proteins, namely 35% amino acid identity for the SCO6005 protein and NgcE, 44% for SCO6006 and NgcF, and 50% between SCO6007 and NgcG ( Fig. S1 ). In contrast, the other streptomycetes NgcE orthologues share between 80 to 91% amino acid identities throughout the full-length...”
• The dasABC gene cluster, adjacent to dasR, encodes a novel ABC transporter for the uptake of N,N'-diacetylchitobiose in Streptomyces coelicolor A3(2)
  Saito, Applied and environmental microbiology 2007
  • “...mutant but still occurred (Fig. 5B). Putative ORFs (SCO6005, SCO6006, and SCO6007) corresponding to the ngcEFG genes of S. olivaceoviridis are present in the S....”

BBMN68_1671, BL105A_1603, BLGT_RS08485 carbohydrate ABC transporter permease from Bifidobacterium longum subsp. longum GT15
24% identity, 78% coverage

• Gene Networks Underlying the Resistance of Bifidobacterium longum to Inflammatory Factors
  Veselovsky, Frontiers in immunology 2020
  • “...protein B 2,03 BLGT_RS08190 Sugar ABC transporter substrate-binding protein 2,10 BLGT_RS08205 ROK family glucokinase 2,08 BLGT_RS08485 Sugar ABC transporter permease 2,04 BLGT_RS08615 Circularly permuted type 2 ATP-grasp protein 2,78 BLGT_RS08920 tRNA-Met 2,11 BLGT_RS09910 Signal recognition particle sRNA small type 2,16 BLGT_RS09925 Hypothetical protein 2,25 One of...”
  • “...biosynthesis, neomycin, kanamycin and gentamicin biosynthesis. Among the remaining genes, seven genes (BLGT_RS08190, BLGT_RS02975, BLGT_RS01310, BLGT_RS08485, BLGT_RS02915, BLGT_RS03250, BLGT_RS04525) encoded transporters involved in signaling and cellular processes, two genes (BLGT_RS03890, BLGT_RS00625) were involved in genetic information processing and the genes BLGT_RS03150, BLGT_RS08190, BLGT_RS01265, BLGT_RS08920 were involved...”
• Application of Recombinase-Based In Vivo Expression Technology to Bifidobacterium longum subsp. longum for Identification of Genes Induced in the Gastrointestinal Tract of Mice
  Koguchi, Microorganisms 2020
  • “...BL105A_1556 Hypothetical protein 4th N 52 BL105A_1562 tRNA-Phe 3rd 53 BL105A_1583 Hypothetical protein 3rd 54 BL105A_1603 Sugar ABC transporter permease component 2nd G 55 BL105A_1605 Hypothetical protein 1st 56 BL105A_1637 DNA-directed RNA polymerase subunit 1st K 57 BL105A_1680 Amino acid transporter 1st E 58 BL105A_1696 Hypothetical...”
• Mechanism analysis of acid tolerance response of bifidobacterium longum subsp. longum BBMN 68 by gene expression profile using RNA-sequencing
  Jin, PloS one 2012
  • “...protein BBMN68_1670 15246.02 1373.46 11.10 * G COG1653 K02027, multiple sugar transport system substrate-binding protein BBMN68_1671 904.42 246.04 3.68 * G COG1175 K02025, multiple sugar transport system permease protein BBMN68_1672 493.45 228 2.16 * G COG0395 K02026, multiple sugar transport system permease protein BBMN68_1422 307.21 83.16...”

DR0562 maltose ABC transporter, permease protein from Deinococcus radiodurans R1
25% identity, 42% coverage

• A Novel Glycoside Hydrolase DogH Utilizing Soluble Starch to Maltose Improve Osmotic Tolerance in Deinococcus radiodurans
  Gui, International journal of molecular sciences 2023
  • “...transport maltose into the intracellular domain by the maltose transport system osmotic enzyme MalF/MalG ( dr0562 / dr0563 ), thus mediating the TreS pathway. 3.3. Mechanisms of Osmoregulation in D. radiodurans Osmotic stress, caused by abiotic stresses such as desiccation, salt stress, high temperatures and freezing,...”

PfGW456L13_1895 ABC transporter for D-Galactose and D-Glucose, permease component 1 from Pseudomonas fluorescens GW456-L13
25% identity, 83% coverage

• mutant phenotype: Specific phenotypes on D-Galactose; N L-Lysine. glucose is the C source for the N source experiments with a phenotype (i.e. lysine); may also transport fructose.

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.