PaperBLAST
PaperBLAST Hits for reanno::pseudo1_N1B4:Pf1N1B4_772 ABC transporter for L-asparagine and L-glutamate, permease component 1 (Pseudomonas fluorescens FW300-N1B4) (248 a.a., MNYNWDWGVF...)
Show query sequence
>reanno::pseudo1_N1B4:Pf1N1B4_772 ABC transporter for L-asparagine and L-glutamate, permease component 1 (Pseudomonas fluorescens FW300-N1B4)
MNYNWDWGVFFKSTGVGSEIYFDWYLSGLGWTIAIAVAAWIIALLLGSILGVMRTVPNRI
VSGIATCYVELFRNVPLLVQLFIWYFLVPDLLPADIQEWYKQDLNPTTSAFLSVVVCLGL
FTTARVCEQVRTGIQALPRGQEAAARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVF
KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRSVEKKVAVP
GLISVGGK
Running BLASTp...
Found 255 similar proteins in the literature:
Pf1N1B4_772 ABC transporter for L-asparagine and L-glutamate, permease component 1 from Pseudomonas fluorescens FW300-N1B4
100% identity, 100% coverage
- mutant phenotype: # Specifically important in carbon source L-Asparagine. Also important for glutamate utilization. We do not have fitness data for aspartate utilization - it may well transport aspartate as well. Also note that the aspariganase (Pf1N1B4_2023) is predicted to be cytoplasmic and is important for asparagine utilization, so we do not think that asparagine is converted to aspartate before uptake.
Psyr_3909 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine from Pseudomonas syringae pv. syringae B728a
92% identity, 100% coverage
PfGW456L13_4771 ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 1 from Pseudomonas fluorescens GW456-L13
95% identity, 100% coverage
- mutant phenotype: Specific phenotypes on L-Asparagine; L-Asparagine. also has weak phenotypes on other a.a., but not on aspartate; weak phenotype on glutamate; also is detrimental during growth on glutamine (along with a downstream HK-RR), which could imply that it leaks glutamate; ko:K10003 : glutamate/aspartate transport system permease protein
AO353_16285 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 from Pseudomonas fluorescens FW300-N2E3
92% identity, 100% coverage
- mutant phenotype: # Specifically important in carbon source L-Aspartic Acid; pH ; carbon source L-Asparagine; carbon source L-Glutamic acid monopotassium salt monohydrate; carbon source L-Glutamine
VT47_18650 amino acid ABC transporter permease from Pseudomonas syringae pv. syringae
92% identity, 100% coverage
TC 3.A.1.3.22 / Q9I403 Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida from Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
PA1341 probable permease of ABC transporter from Pseudomonas aeruginosa PAO1
PA14_46920 putative permease of ABC transporter from Pseudomonas aeruginosa UCBPP-PA14
88% identity, 100% coverage
- substrates: Glutamic Acid, Glutamine, N-acetylglutamic acid
- Responses of carbapenemase-producing and non-producing carbapenem-resistant Pseudomonas aeruginosa strains to meropenem revealed by quantitative tandem mass spectrometry proteomics
Salvà-Serra, Frontiers in microbiology 2022 - “...(MFS) transporter 3 5 1.38 0.22 1.29 0.12 2.23 0.00 Down 44.40 0.01 Higher WP_003082767.1 PA1341 AatQ AatQ 3 10 1.14 0.01 1.08 0.04 2.55 0.00 Down 1.44 0.00 WP_003086995.1 PA1408 - Hypothetical protein 13 32 1.05 0.50 1.02 0.83 4.55 0.00 Down 1.20 0.08 WP_003087942.1...”
- Utilization of L-glutamate as a preferred or sole nutrient in Pseudomonas aeruginosa PAO1 depends on genes encoding for the enhancer-binding protein AauR, the sigma factor RpoN and the transporter complex AatJQMP
Lundgren, BMC microbiology 2021 - “...sole carbon sources The aauR ( PA1335 ), aatJ ( PA1342 ) and aatQM ( PA1341 PA1340 ) genes were individually deleted from the genome of P. aeruginosa PAO1. The resulting markerless aauR , aatJ , and aatQM mutants, in addition to an rpoN ::-Km mutant...”
- Global reprogramming of virulence and antibiotic resistance in Pseudomonas aeruginosa by a single nucleotide polymorphism in elongation factor, fusA1
Maunders, The Journal of biological chemistry 2020 (secret) - Increased ParB level affects expression of stress response, adaptation and virulence operons and potentiates repression of promoters adjacent to the high affinity binding sites parS3 and parS4 in Pseudomonas aeruginosa
Kawalek, PloS one 2017 - “...glutaminase-asparaginase PA1338 ggt -2,5 6 gamma-glutamyltranspeptidase precursor PA1340 aatM -2,8 6 putative amino acid transporter PA1341 aatQ -3,1 6 putative amino acid transporter Genes involved in PQS synthesis PA0996 pqsA -3,2 5 PqsA, probable coenzyme A ligase PA0997 pqsB -3,5 5 PqsB, probable beta-keto-acyl-acyl-carrier protein synthase...”
- “...genes downregulated in response to BexR overproduction, PA0998 , PA1337 , PA1338 , PA1340 and PA1341 , are also downregulated in the analysed ParB -overproducing cells ( Table 4 ). The expression of bexR gene is known to be bistable, meaning that this gene switches between...”
- High-throughput phenotypic characterization of Pseudomonas aeruginosa membrane transport genes
Johnson, PLoS genetics 2008 - “...amino acid ABC transporter ATP binding protein PA1340 PAK amino acid ABC transporter membrane protein PA1341 PAK amino acid ABC transporter membrane protein PA1418 PAK sodiumsolute symporter PA1485 PA01 amino acid APC family transporter PA1590 PAK branched chain amino acid sodium ion symporter ( BraB )...”
- “...+/ L-Glutamic Acid - N +/ D-Glutamic Acid - N - N-Acetyl-L-Glutamic Acid N +/ PA1341 amino acid ABC transporter membrane protein L-Glutamic Acid -C +/ PA3176 glutamate/sodium ion symporter ( GltS ) N-Acetyl-L-Glutamic Acid - N +/ PA3560 phosphotransferase system transporter fructose-specific IIBC component (...”
- Characterization of nutrient-induced dispersion in Pseudomonas aeruginosa PAO1 biofilm
Sauer, Journal of bacteriology 2004 - “...PA4563 PA2851 PA4268 PA0579 PA2619 PA4432 PA3647 PA1341 PA0282 PA1339 PA0280 PA1340 Regulatory protein TypA Bacterioferritin Argininosuccinate synthase ATP...”
- Pseudomonas aeruginosa Alters Its Transcriptome Related to Carbon Metabolism and Virulence as a Possible Survival Strategy in Blood from Trauma Patients
Elmassry, mSystems 2019 - “...PA14_15030 and PA14_64870 ; four genes encoding the glutamate and aspartate transport system, PA14_46910 , PA14_46920 , PA14_46930 , and PA14_46950 , plus a fifth gene, ansB , which is involved in glutamate and aspartate metabolism; and six genes related to glycine and serine metabolism, gcvH2...”
T1E_4503 amino acid ABC transporter permease from Pseudomonas putida DOT-T1E
92% identity, 100% coverage
A5VZG2 L-glutamate ABC transporter membrane protein / L-aspartate ABC transporter membrane protein from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Pput_1111 polar amino acid ABC transporter, inner membrane subunit from Pseudomonas putida F1
91% identity, 100% coverage
- Resuscitation of Pulsed Electric Field-Treated Staphylococcus aureus and Pseudomonas putida in a Rich Nutrient Medium
Emanuel, Foods (Basel, Switzerland) 2021 - “...composition under stress conditions [ 74 ]. The two proteins, the L-glutamate ATP-binding cassette (ABC) (A5VZG2) and the ABC-type metal-ion transporter (A5W1U8), are related to a large efflux pump superfamily, the ABC transporters. Several studies showed an increase in ABC transporters as a response to osmotic...”
- “...18.25 2.17 22.68 0.16 A5W1V5 Propeptide, PepSY and peptidase M4 Pput_1972 44.145 ND 24.35 1.01 A5VZG2 L-glutamate ABC transporter membrane protein/L-aspartate ABC transporter membrane protein Pput_1111 27.45 17.90 1.57 22.14 1.10 A5W312 Deoxyribonuclease I Pput_2383 35.477 ND 21.05 0.18 A5WA94 Choline/carnitine/betaine transporter Pput_4934 73.501 20.91 0.14...”
- Resuscitation of Pulsed Electric Field-Treated Staphylococcus aureus and Pseudomonas putida in a Rich Nutrient Medium
Emanuel, Foods (Basel, Switzerland) 2021 - “...Pput_1972 44.145 ND 24.35 1.01 A5VZG2 L-glutamate ABC transporter membrane protein/L-aspartate ABC transporter membrane protein Pput_1111 27.45 17.90 1.57 22.14 1.10 A5W312 Deoxyribonuclease I Pput_2383 35.477 ND 21.05 0.18 A5WA94 Choline/carnitine/betaine transporter Pput_4934 73.501 20.91 0.14 24.61 0.52 Note: * Since a t -test must be...”
TC 3.A.1.3.19 / Q88NY3 PP1070, component of Acidic amino acid uptake porter, AatJMQP from Pseudomonas putida (strain KT2440) (see paper)
PP1070 amino acid ABC transporter, permease protein from Pseudomonas putida KT2440
91% identity, 100% coverage
- substrates: Asparagine, Glutamine, aspartate, glutamate
tcdb comment: It is the sole system that transports glutamate and glutamine, but it can also transport aspartate and asparagine (Singh and Röhm 2008) - UEG Week 2024 Poster Presentations
, United European gastroenterology journal 2024 - UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023 - Transcriptome analysis of a phenol-producing Pseudomonas putida S12 construct: genetic and physiological basis for improved production
Wierckx, Journal of bacteriology 2008 - “...amino acid transporter (aroP1) PP0198 PP0615 PP0618 PP0619 PP0927 PP1070 PP3023 PP4495 2.1 0.6 0.4 0.5 10.7 0.5 2.1 10.5 TCA cycle Fumarate hydratase, class I...”
- The AauR-AauS two-component system regulates uptake and metabolism of acidic amino acids in Pseudomonas putida
Sonawane, Applied and environmental microbiology 2006 - “...growth of the KTaauR mutant. Asp transporter encoded by PP1070 to PP1068 (R3). As mentioned above, both proteins are strongly induced by glutamate and repressed...”
YPTB1107 ABC glutamate/aspartate transporter, permease subunit gltJ from Yersinia pseudotuberculosis IP 32953
56% identity, 97% coverage
YPO2614 putative glutamate/aspartate transport system permease from Yersinia pestis CO92
56% identity, 97% coverage
STM0664 ABC superfamily (membrane), glutamate/aspartate transporter from Salmonella typhimurium LT2
SEN0633 glutamate/aspartate transport system permease protein GltJ from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
54% identity, 100% coverage
- AT Homopolymer Strings in Salmonella enterica Subspecies I Contribute to Speciation and Serovar Diversity
Guard, Microorganisms 2021 - “...The regulons with the motif encompassed mostly metabolic functions. Regulons associated with the genes STM2277, STM0664, and STM4585 have some association with antibiotics (references not shown). Another class of gene that could be of interest for targeting of antimicrobials include transporters, and there are 20 listed...”
- Global transcriptomic analysis of ethanol tolerance response in Salmonella Enteritidis
He, Current research in food science 2022 - “...gltI 3.30 Glutamate and aspartate transporter subunit SEN0632 gltK 2.44 Glutamate/aspartate transport system permease GltK SEN0633 gltJ 2.31 Glutamate/aspartate transport system permease GltJ SEN0199 fhuB 3.21 Iron-hydroxamate transporter permease subunit SEN0197 fhuC 2.55 Iron-hydroxamate transporter ATP-binding subunit SEN0198 fhuD 2.88 Iron-hydroxamate transporter substrate-binding subunit SEN2703 sitA...”
ECs0693 glutamate/aspartate transport system permease from Escherichia coli O157:H7 str. Sakai
Z0804 glutamate/aspartate transport system permease from Escherichia coli O157:H7 EDL933
54% identity, 100% coverage
GltJ / b0654 glutamate/aspartate ABC transporter membrane subunit GltJ (EC 7.4.2.1) from Escherichia coli K-12 substr. MG1655 (see 2 papers)
GltJ / P0AER3 glutamate/aspartate ABC transporter membrane subunit GltJ (EC 7.4.2.1) from Escherichia coli (strain K12) (see 2 papers)
GLTJ_ECOLI / P0AER3 Glutamate/aspartate import permease protein GltJ from Escherichia coli (strain K12) (see 2 papers)
TC 3.A.1.3.4 / P0AER3 Glutamate/aspartate transport system permease protein GltJ aka B0654, component of Glutamate/aspartate porter from Escherichia coli (see 4 papers)
b0654 glutamate and aspartate transporter subunit from Escherichia coli str. K-12 substr. MG1655
54% identity, 100% coverage
- function: Part of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. Probably responsible for the translocation of the substrate across the membrane.
function: (Microbial infection) Probably transports the toxic C- terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Toxin transport is strain-specific, mutations in this gene do not confer resistance to several other tested CdiA toxins.
subunit: The complex is composed of two ATP-binding proteins (GltL), two transmembrane proteins (GltJ and GltK) and a solute-binding protein (GltI).
disruption phenotype: Disruption confers resistance to cellular contact-dependent growth inhibition (CDI) CdiA of P.luminescens strain TTO1, but not to several other tested CdiA toxins. - substrates: glutamate
tcdb comment: Similar in sequence to 3.A.1.3.19 which is specific for Glu, Asp, Gln and Asn (Singh and Röhm 2008) - Burkholderia multivorans requires species-specific GltJK for entry of a contact-dependent growth inhibition system protein
Myers-Morales, Molecular microbiology 2021 - “...nucleotides 757 and 281345 replaced with nucleotides 754 and 281345 from E. coli MG1655 gltJ (b0654), respectively. Flanked by 5 HindIII and 3 StuI sites, restriction digestion was used to clone gltJ Chim1 into pUCS12 downstream of P S12 , resulting in plasmid pTMM022. Chimeric gene...”
- Escherichia coli toxin/antitoxin pair MqsR/MqsA regulate toxin CspD
Kim, Environmental microbiology 2010 - “...protein of glutamate/aspartate transport system gltK b0653 5.3 1.1 1.1 Glutamate/aspartate transport system permease gltJ b0654 6.5 1.1 1.0 Glutamate/aspartate transport system permease gltI b0655 4.9 2.0 1.2 Putative periplasmic binding transport protein putA b1014 2.0 6.1 1.2 Proline dehydrogenase, P5C dehydrogenase putP b1015 4.3 6.1...”
- Transient erythromycin resistance phenotype associated with peptidyl-tRNA drop-off on early UGG and GGG codons
Macvanin, Journal of bacteriology 2007 - “...Blattner no. b1600 b1958 b1186 b1193 b2524 b3354 b3824 b0654 b2258 b4539 b1317 b2277 b0638 b3564 b1746 b0387 b2896 b3960 b4221 b3603 b2725 Expression in the...”
- Combined, functional genomic-biochemical approach to intermediary metabolism: interaction of acivicin, a glutamine amidotransferase inhibitor, with Escherichia coli K-12
Smulski, Journal of bacteriology 2001 - “...b2096 b2095 b1761 b3740 b3870 b0680 b3425 b3213 b3214 b0654 b0238 b1635 b2507 b2508 b1615 b2231 b1619 b4348 b4018 b3671 b3774 b3771 b3770 b3767 b3769 b3168...”
BURMUCGD2M_3194 glutamate/aspartate ABC transporter, permease protein GltJ from Burkholderia multivorans CGD2M
55% identity, 100% coverage
SPO2659 amino acid ABC transporter permease from Ruegeria pomeroyi DSS-3
49% identity, 98% coverage
BP0056 glutamate/aspartate transport system permease protein from Bordetella pertussis Tohama I
47% identity, 92% coverage
BB0330 glutamate/aspartate transport system permease protein from Bordetella bronchiseptica RB50
45% identity, 96% coverage
FQU82_01779, HMPREF0010_00886 amino acid ABC transporter permease from Acinetobacter baumannii
44% identity, 76% coverage
- <i>OmpH</i> is Involved in the Decrease of <i>Acinetobacter baumannii</i> Biofilm by the Antimicrobial Peptide Cec4
Qiu, Drug design, development and therapy 2024 - “...glnQ D0C804 1.658356275 0.000395028 gltI D0C807 1.603455392 0.009493657 gltK D0C805 1.45762851 0.000184436 hisM 1.29203391 0.000113647 HMPREF0010_00886 1.189703016 0.001059408 HMPREF0010_01038 1.290063642 0.000108447 HMPREF0010_01713 1.153820896 0.003645927 HMPREF0010_02504 D0CCM4 1.515294175 0.000346461 HMPREF0010_02965 1.034329905 0.001250861 HMPREF0010_03358 1.46539906 0.001734293 HMPREF0010_03359 D0CF29 1.033785341 0.006549767 HMPREF0010_03362 1.095054779 0.000570843 metI 1.44042682 0.003325411 pstB D0CBX9...”
- Transcriptomic analysis reveals the regulatory role of quorum sensing in the Acinetobacter baumannii ATCC 19606 via RNA-seq
Xiong, BMC microbiology 2022 - “...DEGs were found to be enriched in the two-component system, including FQU82_00307 ( pilS ), FQU82_01779, FQU82_02017, FQU82_01778, FQU82_01780, FQU82_01752, FQU82_02461 ( kdpA ), and FQU82_02460 ( kdpB ). The downregulated DEGs in this pathway included FQU82_02258 ( cydA ), FQU82_02259 ( cydB ), FQU82_02260 (...”
A1S_1491 glutamate/aspartate transport protein from Acinetobacter baumannii ATCC 17978
44% identity, 88% coverage
IX87_RS02660 amino acid ABC transporter permease from Acinetobacter baumannii
44% identity, 76% coverage
- Antimicrobial Peptide Cec4 Eradicates the Bacteria of Clinical Carbapenem-Resistant Acinetobacter baumannii Biofilm
Liu, Frontiers in microbiology 2020 - “...Table 1 ). The expression of the amino acid ABC transporter permease, ATP-binding proteins (IX87_RS02655, IX87_RS02660, and artP) in the ABC transport system was down-regulated 1.68-fold, 1.61-fold, and 1.66-fold; the MFS transporter (IX87_RS20020) was down-regulated 2.96-fold, and the EamA family transporter (IX87_RS12100) expression was down-regulated 2.29-fold...”
- “...1.68 4.86 10 3 artP amino acid ABC transporter ATP-binding protein 1.66 2.30 10 2 IX87_RS02660 amino acid ABC transporter permease 1.61 7.77 10 3 IX87_RS12100 EamA family transporter 2.29 6.85 10 4 Bacterial resistance IX87_RS19070 MBL fold metallo-hydrolase 2.97 2.11 10 8 IX87_RS08365 ADC family...”
Dde_1430 Glutamate/aspartate transport system permease from Desulfovibrio desulfuricans G20
39% identity, 91% coverage
DVU2341 amino acid ABC transproter, permease protein, His/Glu/Gln/Arg/opine family from Desulfovibrio vulgaris Hildenborough
39% identity, 93% coverage
- Characterization of NaCl tolerance in Desulfovibrio vulgaris Hildenborough through experimental evolution
Zhou, The ISME journal 2013 - “...synthase, iron- sulfur cluster-binding subunit, putative DVU2341 Amino-acid ABC transproter, permease protein, His/Glu/ Gln/Arg/opine family DVU2342 Amino-acid...”
- Global transcriptional, physiological, and metabolite analyses of the responses of Desulfovibrio vulgaris hildenborough to salt adaptation
He, Applied and environmental microbiology 2010 - “...transport DVU0724 DVU2297 NA proW DVU2298 opuBB DVU2299 proV DVU2341 NA DVU2740 livF DVU2741 livG DVU2742 livM DVU2743 livH DVU2744 NA DVU3297 mtr a Sodium/Ala...”
- “...shock conditions. For example, the expression of DVU0724, DVU2341, and mtr increased during salt adaptation but did not change under salt shock conditions...”
DVU0751 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Desulfovibrio vulgaris Hildenborough
39% identity, 36% coverage
A9497_01795, T303_06660 amino acid ABC transporter permease from Streptococcus thermophilus
33% identity, 93% coverage
- Functional Genomic Analyses of Exopolysaccharide-Producing Streptococcus thermophilus ASCC 1275 in Response to Milk Fermentation Conditions
Wu, Frontiers in microbiology 2019 - “...transport and metabolism T303_00290 0.36 Ketol-acid reductoisomerase Pyruvate metabolism T303_05515 0.35 Glucosamine-fructose-6-phosphate aminotransferase Glutamate metabolism T303_06660 0.39 Glutamine ABC transporter permease Glutamate metabolism T303_09710 0.43 Glutamine synthetase Glutamate metabolism T303_09715 0.30 Repressor of the glutamine synthetase Glutamate metabolism T303_03455 0.48 Homoserine kinase Threonine biosynthesis T303_00325 1.54...”
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...ABC transporter substrate-binding protein Glutamine A9497_01790 A9497_06995 A9497_00730 AKL23_RS04225 AKL23_RS00860 AKL23_RS05335 ABC transporter substrate-binding protein A9497_01795 A9497_01800 A9497_09175 AKL23_RS05340 AKL23_RS05345 AKL23_RS03035 ABC transporter permease A9497_03790 A9497_09180 AKL23_RS03040 AKL23_RS07400 ABC transporter ATP-binding protein Methionine A9497_07635 AKL23_RS01505 ABC transporter ATP-binding protein A9497_07640 AKL23_RS01510 ABC transporter permease Polar amino...”
AKL23_RS05340 amino acid ABC transporter permease from Streptococcus thermophilus
33% identity, 93% coverage
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...protein Glutamine A9497_01790 A9497_06995 A9497_00730 AKL23_RS04225 AKL23_RS00860 AKL23_RS05335 ABC transporter substrate-binding protein A9497_01795 A9497_01800 A9497_09175 AKL23_RS05340 AKL23_RS05345 AKL23_RS03035 ABC transporter permease A9497_03790 A9497_09180 AKL23_RS03040 AKL23_RS07400 ABC transporter ATP-binding protein Methionine A9497_07635 AKL23_RS01505 ABC transporter ATP-binding protein A9497_07640 AKL23_RS01510 ABC transporter permease Polar amino acid A9497_03800 AKL23_RS07410...”
PA4194 probable permease of ABC transporter from Pseudomonas aeruginosa PAO1
37% identity, 82% coverage
HSISS4_00833 amino acid ABC transporter permease from Streptococcus salivarius
33% identity, 93% coverage
- A Genome-Wide CRISPR Interference Screen Reveals an StkP-Mediated Connection between Cell Wall Integrity and Competence in Streptococcus salivarius
Knoops, mSystems 2022 - “...livJ HSISS4_00287 High-affinity leucine-specific transport system 0.03 1.38 HSISS4_00832 Glutamate transport membrane-spanning protein 0.03 1.26 HSISS4_00833 Glutamate transport permease protein 0.05 1.10 Other galR HSISS4_01243 Galactose operon repressor 0.03 0.68 HSISS4_01867 Transcriptional regulator, PadR family 0.08 1.02 nusA HSISS4_00269 Transcription termination protein 0.03 1.66 cshA HSISS4_01831...”
- “...involved in amino acid biosynthesis or uptake for arginine (CarB and ArgJ), glutamine (GlnP), glutamate (HSISS4_00833 and 00832), and leucine (LivJ). Amino acid starvation is known to trigger the stringent response via RelA and the production of (p)ppGpp alarmones ( 66 ), which was shown to...”
LBA0134 glutamine ABC transporter permease protein from Lactobacillus acidophilus NCFM
33% identity, 44% coverage
GSU3405 amino acid ABC transporter, permease protein from Geobacter sulfurreducens PCA
34% identity, 81% coverage
D820_06850 amino acid ABC transporter permease from Streptococcus mutans ATCC 25175
33% identity, 92% coverage
D816_06832, D817_06998, D818_06649, D819_06637 amino acid ABC transporter permease from Streptococcus mutans KK23
32% identity, 92% coverage
- Genetic variability of mutans streptococci revealed by wide whole-genome sequencing
Song, BMC genomics 2013 - “...D820_01321 D821_01193 D822_03404 - [ 8 ] Immunity protein of Mutacin - IV SMU.152 GI|290580110 D816_06832 D817_06998 D818_06649 D819_06637 D820_06850 D821_06847 D822_03264 D823_04636 [ 55 , 56 ] Mutacin - V ( CipB ) SMU.1914c GI|290579763 D816_08583 D817_08773 D818_08363 D819_07834 - - D822_03354 - [ 55...”
- “...D821_01193 D822_03404 - [ 8 ] Immunity protein of Mutacin - IV SMU.152 GI|290580110 D816_06832 D817_06998 D818_06649 D819_06637 D820_06850 D821_06847 D822_03264 D823_04636 [ 55 , 56 ] Mutacin - V ( CipB ) SMU.1914c GI|290579763 D816_08583 D817_08773 D818_08363 D819_07834 - - D822_03354 - [ 55 ,...”
- “...D822_03404 - [ 8 ] Immunity protein of Mutacin - IV SMU.152 GI|290580110 D816_06832 D817_06998 D818_06649 D819_06637 D820_06850 D821_06847 D822_03264 D823_04636 [ 55 , 56 ] Mutacin - V ( CipB ) SMU.1914c GI|290579763 D816_08583 D817_08773 D818_08363 D819_07834 - - D822_03354 - [ 55 , 56...”
- “...- [ 8 ] Immunity protein of Mutacin - IV SMU.152 GI|290580110 D816_06832 D817_06998 D818_06649 D819_06637 D820_06850 D821_06847 D822_03264 D823_04636 [ 55 , 56 ] Mutacin - V ( CipB ) SMU.1914c GI|290579763 D816_08583 D817_08773 D818_08363 D819_07834 - - D822_03354 - [ 55 , 56 ]...”
D821_06847 amino acid ABC transporter permease from Streptococcus mutans NCTC 11060
32% identity, 92% coverage
DVU0967 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Desulfovibrio vulgaris Hildenborough
Q72DG2 Amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
36% identity, 63% coverage
- Energetic consequences of nitrite stress in Desulfovibrio vulgaris Hildenborough, inferred from global transcriptional analysis
He, Applied and environmental microbiology 2006 - “...DVU0107 DVU0388 DVU0624 DVU0625 DVU0751 DVU0752 DVU0966 DVU0967 DVU0968 DVU1026 DVU1237 DVU1238 DVU1766 DVU2113 DVU2242 DVU2543 DVU3392 Expression ratio...”
- Synergy of Sodium Nitroprusside and Nitrate in Inhibiting the Activity of Sulfate Reducing Bacteria in Oil-Containing Bioreactors.
Fida, Frontiers in microbiology 2018 - “...proteins (Q72EB0 and Q727W6), an efflux transporter (Q72G03), outer membrane-associated proteins (Q72CM3, Q72D62, Q72C14, Q726K3, Q72DG2, and Q72G03), and ferrous iron transport proteins (Q728N1 and Q728N2). The increased expression of heat shock proteins is in agreement with previous findings indicating increased expression of these genes after...”
LPL9_RS10370 amino acid ABC transporter permease from Lacticaseibacillus paracasei
33% identity, 85% coverage
YPO4110 ABC transporter permease from Yersinia pestis CO92
37% identity, 80% coverage
B9H01_RS06580, SSUSC84_RS06435 amino acid ABC transporter permease from Streptococcus suis
SSU1194 amino acid ABC transporter, permease protein from Streptococcus suis P1/7
32% identity, 94% coverage
- Transcriptome and metabolome profiling to elucidate the mechanism underlying the poor growth of <i>Streptococcus suis</i> serotype 2 after orphan response regulator CovR deletion
Zong, Frontiers in veterinary science 2023 - “...Among them, B9H01_RS09035 is glutamine ABC transporter substrate-binding protein; B9H01_RS06585 is glutamine ABC transporter permease; B9H01_RS06580 is glutamine ABC transporter permease; B9H01_RS05040 is peptide ABC transporter ATP-binding protein; B9H01_RS05035 is amino acid ABC transporter permease; B9H01_RS09790 is ABC transporter ATP-binding protein; and B9H01_RS01490, B9H01_RS06570, and B9H01_RS09040...”
- “...Gene Forward (5 -3 ) Reverse (5 -3 ) B9H01_RS09035 GGGGCTAACAAACAGACT AAGACACCGATGAGGAGA B9H01_RS06585 CCGAGATTATCCGTGGTG GCCTCAAAGTAGCGTCCC B9H01_RS06580 TGCGTCGGACTCTATCAC TGGAAGAATGGTCGGAAT B9H01_RS05040 CCTTCCGTTCAAATGTCG CGTTGCTTCTGACCACCT B9H01_RS05035 CGTTATCGCTACCACAAA ACAGCACCAGCAGAAAGG B9H01_RS01490 TTGGCAGGACATCTATTA AGGAAACGAAACATTACTC B9H01_RS09790 AAATCGGGCAGGCTTACT CCTTACGCATACGGTTGG B9H01_RS06570 TTTTGGGAATCAATAAGGC CGGATAGCATAGCAGGGT B9H01_RS09040 CTCAATCATCGGTTCATC CACGGTAAGTCGTCAAAT 16S rRNA ACTTGAGTGCAGAAGGGGAGAG GCGTCAGTTACAGACCAGAGAGC Statistical analyses The data in this...”
- Transcriptomic Analysis of Streptococcus suis in Response to Ferrous Iron and Cobalt Toxicity
Jia, Genes 2020 - “...Ferrous Iron Analysis of the transcriptome data revealed that four adjacent genes, i.e., SSUSC84_RS06425, SSUSC84_RS06430, SSUSC84_RS06435, and SSUSC84_RS06440, were among the top 10 up-regulated genes in response to ferrous iron toxicity ( Table S2 ). After treatment with ferrous iron, they were up-regulated approximately 39-, 44-,...”
- “...amino acid ABC transporter ATP-binding protein and glutamine ABC transporter substrate-binding protein, respectively, while the SSUSC84_RS06435 and SSUSC84_RS06440 genes both encode the amino acid ABC transporter permease. The four genes are transcribed in the same direction, with only a few nucleotides separating each other ( Figure...”
- FlpS, the FNR-Like Protein of Streptococcus suis Is an Essential, Oxygen-Sensing Activator of the Arginine Deiminase System
Willenborg, Pathogens (Basel, Switzerland) 2016 - “...SSU0198-SSU0199 , SSU0402-0407 ), sugar conversions ( SSU0999-1001 , SSU1915 ) and ABC transporters ( SSU1194 , SSU1233 , SSU1372 , SSU1574-1575 , SSU1851-1853 ). Genes whose expression was exclusively affected in the FlpS mutant could be assigned to nucleotide metabolism ( SSU0311 , SSU0734 ,...”
CPE2093 probable amino acid ABC transporter from Clostridium perfringens str. 13
35% identity, 43% coverage
SM12261_RS07185 amino acid ABC transporter permease from Streptococcus mitis NCTC 12261
33% identity, 86% coverage
B1745_05190 amino acid ABC transporter permease from Lactobacillus amylolyticus
36% identity, 86% coverage
- Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
Fei, Food science & nutrition 2022 - “...ATPdependent Clp protease ATPbinding protein ClpC 1.63 B1745_04890 transcriptional activator, Rgg/GadR/MutR family domaincontaining protein 1.60 B1745_05190 glnM glutamine ABC transporter permease 1.60 B1745_02545 pepX dipeptidylpeptidase 1.56 B1745_02045 dacD DalanylDalanine carboxypeptidase 1.44 B1745_06875 amino acid permease 1.44 B1745_00945 oppD peptide ABC transporter ATPbinding protein 1.43 B1745_RS07280 lysC...”
- “...transporters to supplement amino acid. A glutamate transporter operon (glnQHMP, glnP , B1745_05185; glnM , B1745_05190; glnH , B1745_05195; glnH , B1745_05195) was highly induced in the logarithmic phase to transport the high concentration of free glutamate from the soymilk into the cell (Table 2 and...”
PA2203 probable amino acid permease from Pseudomonas aeruginosa PAO1
PA14_36220 putative amino acid permease from Pseudomonas aeruginosa UCBPP-PA14
40% identity, 80% coverage
- Searching for Biological Function of the Mysterious PA2504 Protein from Pseudomonas aeruginosa
Drabinska, International journal of molecular sciences 2021 - “...acids were PA2594 and PA5103 and with the import of cysteine and methionine PA2202 , PA2203 , PA2204 , PA3931 , and PA4195 . The second group related to the conversion of sulphate to sulphite and further to sulphide: cysD, cysN , cysH , and cysI...”
- “...IscS subfamily cysteine desulphurase PA2086 PA2086 1.12 Epoxide hydrolase PA2202 PA2202 1.79 Amino acid permease PA2203 PA2203 2.32 Amino acid permease PA2204 PA2204 3.02 ABC transporter PA2328 PA2328 0.86 Hypothetical protein/ nitrate transport protein NrtA precursor PA2329 PA2329 0.72 ABC transporter ATP-binding protein/ nitrate/sulphonate/bicarbonate ABC transporter...”
- The LysR-Type Transcriptional Regulator BsrA (PA2121) Controls Vital Metabolic Pathways in Pseudomonas aeruginosa
Modrzejewska, mSystems 2021 - “...proteins ( PA1657 to PA1671 ) and transporters ( PA4192 to PA4195 , PA2202 , PA2203 , PA5024 ) (see Data Set S2). The altered expression of selected loci in response to BsrA excess was confirmed using RT-qPCR analysis (data not shown). FIG2 Identification of BsrA-dependent...”
- The AraC-Type Transcriptional Regulator GliR (PA3027) Activates Genes of Glycerolipid Metabolism in Pseudomonas aeruginosa
Kotecka, International journal of molecular sciences 2021 - “...15.56 MP; TSM amino acid ABC transporter permease PA3342 08435 15.38 MP DUF2804 domain-containing protein PA2203 14520 14.14 MP; TSM amino acid ABC transporter permease PA5024 27340 13.07 HUU sulfite exporter TauE/SafE family protein PA4191 04005 13.06 PE isopenicillin N synthase family oxygenase PA4193 03995 12.57...”
- Coexistence and within-host evolution of diversified lineages of hypermutable Pseudomonas aeruginosa in long-term cystic fibrosis infections
Feliziani, PLoS genetics 2014 - “...related to transcriptional regulators (PA1490), adaptation-protection (PA1127), membrane proteins, and transport of small molecules (PA1626, PA2203). A small percentage (6%) of the CFD population has a reduced mutation frequency similar to that of normo-mutable strains. This subpopulation, which is grouped in a single cluster (Cluster IV...”
- The hrp genes of Pseudomonas cichorii are essential for pathogenicity on eggplant but not on lettuce
Hojo, Microbiology (Reading, England) 2008 - “...Unknown D1 4721548021 P. aeruginosa strain PAO1 PA2204 Binding protein component of ABC D2 4809048830 PA2203 Amino acid permease D3 4883349519 PA2202 Amino acid permease...”
- High-throughput phenotypic characterization of Pseudomonas aeruginosa membrane transport genes
Johnson, PLoS genetics 2008 - “...PA2079 PA01 amino acid APC family transporter PA2202 PAK amino acid ABC transporter membrane protein PA2203 PAK amino acid ABC transporter membrane protein PA2204 PA01 amino acid ABC transporter periplasmic binding protein PA2252 PA01 alanine/glycine/sodium symporter PA2307 PAK nitrate/sulfonate/taurine ABC transporter membrane protein PA2533 PAK alanine/glycine/sodium...”
- Transcriptional profiling of Pseudomonas aeruginosa and Staphylococcus aureus during in vitro co-culture
Tognon, BMC genomics 2019 - “...urease accessory protein UreE metabolism glnA 2.93 glutamine synthetase N-metabolism mtr 2.74 Tryptophan permease transport PA14_36220 2.61 Amino acid permease transport exsB 2.56 TTSS regulator virulence PA14_08210 2.52 F-pyocin Phage/pyocin gdhA 2.49 glutamate dehydrogenase N-metabolism PA14_06890 2.36 pyruvate kinase pyridoxal phosphate metabolism PA14_06930 2.32 glutamine amidotransferase...”
- “...amino acid (leucine, valine, isoleucine) transporters (PA14_64270, PA14_64280) and amino acid permeases ( mtr , PA14_36220) were up-regulated 3 to 7-fold. Furthermore P. aeruginosa strongly repressed branched-chain amino acid degradation as illustrated by a 5 to 16-fold decrease in expression of the lpdV - bkdB-bdhA-bdkA1 and...”
Q03PN3 ABC-type amino acid transport system, permease component from Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
33% identity, 89% coverage
B6D87_RS09950 amino acid ABC transporter permease from Pseudomonas fragi
36% identity, 80% coverage
EF1118 amino acid ABC transporter, permease protein from Enterococcus faecalis V583
34% identity, 86% coverage
OG1RF_10896 amino acid ABC transporter permease from Enterococcus faecalis OG1RF
34% identity, 86% coverage
PSPPH_2462 glutamine ABC transporter, permease protein from Pseudomonas syringae pv. phaseolicola 1448A
34% identity, 82% coverage
DR2155 amino acid ABC transporter, permease protein from Deinococcus radiodurans R1
34% identity, 75% coverage
TC 3.A.1.3.16 / A1VZQ3 PEP1B, component of Uptake system for glutamate and aspartate from Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
CJJ81176_0927 amino acid ABC transporter, permease protein PEB1 from Campylobacter jejuni subsp. jejuni 81-176
Cj0920c putative ABC-type amino-acid transporter permease protein from Campylobacter jejuni subsp. jejuni NCTC 11168
CJE0998 amino acid ABC transporter, permease protein PEB1 from Campylobacter jejuni RM1221
33% identity, 86% coverage
- substrates: aspartate, glutamate
- Metabolic and fitness determinants for in vitro growth and intestinal colonization of the bacterial pathogen Campylobacter jejuni
Gao, PLoS biology 2017 - “...methionine ABC transporter CJJ81176_0926 * peb1 7.27 0.00 0.38 amino acid ABC transporter permease protein CJJ81176_0927 * peb1 7.29 0.00 0.60 amino acid ABC transporter permease protein CJJ81176_0928 * pebA 7.40 0.00 0.83 ABC transporter aspartate/glutamate-binding CJJ81176_1035 livM 6.43 0.04 3.15 high affinity branched-chain aa ABC...”
- “...Asp, Glu, Asn, and Gln [ 29 , 57 ], and its downstream genes (CJJ81176_0926, CJJ81176_0927) led to a significant decrease in colonization ( Fig 4A ). A similarly severe loss of colonization was observed for insertion mutants in paqPQ ( Fig 4A ), which encode...”
- Microbiota-Derived Short-Chain Fatty Acids Modulate Expression of Campylobacter jejuni Determinants Required for Commensalism and Virulence
Luethy, mBio 2017 - “...C 4 -dicarboxylate transporter 6.19 Cjj81176_0682 Possible di-/tripeptide transporter 2.61 Cjj81176_0683 Possible di-/tripeptide transporter 5.90 Cjj81176_0927 peb1a Aspartate/glutamate transporter, permease component 2.74 Cjj81176_0928 peb1b Aspartate/glutamate transporter, solute-binding component 5.48 Cjj81176_0929 peb1c Amino acid transporter, ATP-binding component 5.11 Cjj81176_1615 sdaA l -Serine dehydratase 2.66 Cjj81176_1616 sdaC l...”
- Genomic Characterization and Wetland Occurrence of a Novel Campylobacter Isolate from Canada Geese
Linz, Microorganisms 2023 - “...transduction protein (Cj0019c) other PROKKA_01763 37.4 1.34 10 33 YP_002344318.1 amino acid ABC transporter permease (Cj0920c) other PROKKA_01221 29.7 8.74 10 33 YP_002344289.1 putative sensory transduction transcriptional regulator (Cj0890c) other PROKKA_01241 27.7 4.18 10 27 YP_002344614.1 putative two-component regulator ( dccR ) other PROKKA_01196 30.0 2.33...”
- Survival of Campylobacter jejuni 11168H in Acanthamoebae castellanii Provides Mechanistic Insight into Host Pathogen Interactions
Nasher, Microorganisms 2022 - “...Cj0967 Periplasmic protein 2.103994 1.08 10 4 Cj1682c gltA Citrate synthase 2.097224 1.27 10 20 Cj0920c hisM Putative ABC-type amino-acid transporter permease protein 2.09015 9.49 10 16 Cj0864 Putative periplasmic protein-thioredoxin-like protein 2.063197 1.12 10 3 Cj0728 Putative periplasmic protein 2.052897 3.32 10 4 Cj0917c cstA...”
- Survival of Campylobacter jejuni in Acanthamoebae castellanii provides mechanistic insight into host pathogen interactions
Nasher, 2022 - Campylobacter jejuni Demonstrates Conserved Proteomic and Transcriptomic Responses When Co-cultured With Human INT 407 and Caco-2 Epithelial Cells
Negretti, Frontiers in microbiology 2019 - “...each of the four amino acids serine ( sdaC ), aspartate and glutamate [ Cj0919c, Cj0920c, Cj0921c (Peb1A), and Cj0922c (PebC)] ( Stahl et al., 2012 ) and proline ( putA and putP ) were seen to increase from 2.4 to 4 h ( Hofreuter et...”
- Transcriptomic Analysis of the Campylobacter jejuni Response to T4-Like Phage NCTC 12673 Infection
Sacher, Viruses 2018 - “...essential for growth on glutamate [ 50 ], and the aspartate/glutamate transport genes cj0919c , cj0920c , and peb1A , were all downregulated 1.6- to 2.5-fold by 120 min p.i., as were the proline and serine biosynthesis/transport genes proA , putP , and sdaAC , which...”
- Cj1199 Affect the Development of Erythromycin Resistance in Campylobacter jejuni through Regulation of Leucine Biosynthesis
Hao, Frontiers in microbiology 2017 - “...amino acid biosynthesis. The leuABCD genes participated in leucine biosynthesis pathway. Five genes ( Cj0919c, Cj0920c, peb1A, pebC , and ceuC ) encoded transporters or binding proteins. The permease protein (Cj0919c-Cj0920c), substrate-binding protein (Peb1A), and ATP-binding protein (PebC) worked cooperatively in an ABC-type amino acid transport...”
- “...0.4997 Cj0922c/pebC amino-acid ABC transporter ATP-binding protein 0.461 Cj0921c/peb1A bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein 0.4597 Cj0920c putative ABC-type amino-acid transporter permease 0.3920 Cj1353/ceuC enterochelin uptake permease 0.4557 Cj1241 putative MFS transport protein/Arabinose eux permease 2.3237 Amino acid biosynthesis Cj1716c/leuD isopropylmalate isomerase small subunin 0.3996 Cj1717c/leuC isopropylmalate...”
- Rapid identification of novel immunodominant proteins and characterization of a specific linear epitope of Campylobacter jejuni
Hoppe, PloS one 2013 - “...by microarrays and ELISA. Subsequently, seven proteins were selected for epitope mapping. For cj0669 and cj0920c linear epitopes were identified. For cj0669, specificity assays revealed a specific linear epitope site. Consequently, an eleven amino acid residue sequence TLIKELKRLGI was analyzed via alanine scan, which revealed the...”
- “...for epitope mapping and succeeded in identifying linear epitopes for two proteins, namely cj0669 and cj0920c not described before. Furthermore, assays were performed to assess specificity of the binding as well as investigating the relevance of the amino acid residues involved via alanine scanning. Additionally, the...”
- Nutrient acquisition and metabolism by Campylobacter jejuni
Stahl, Frontiers in cellular and infection microbiology 2012 - “...Both amino acids are taken up through the Peb1 system, composed of the proteins Cj0919c, Cj0920c, Cj0921c (Peb1A), and Cj0922c (PebC). Work by del Rocio Leon-Kempis et al. ( 2006 ) has confirmed the function of Peb1A as the transporter responsible for most, if not all,...”
- More
- Genetic characterisation of a subset of Campylobacter jejuni isolates from clinical and poultry sources in Ireland
Truccollo, PloS one 2021 - “...in this study were present in broiler and absent from clinical C . jejuni genomes CJE0998 , JJD26997_0895 , and CJJ81176_1165 , which are involved in adhesion and biofilm formation. Notably, a higher recovery rate of all virulence genes previously amplified by conventional PCR ( dnaJ...”
- “...for human colonisation. Indeed, we found that they had a low prevalence of 9.8% ( CJE0998 ), 12.5% ( JJD26997_0895 ), and 4.5% ( CJJ81176_1165 ) in the clinical isolates from Redondo et al (2019), which reflects that they are likely not essential for human infection,...”
SSA_1568 ABC transporter membrane-spanning permease, arginine/histidine transport, putative from Streptococcus sanguinis SK36
35% identity, 86% coverage
- ciaR impacts biofilm formation by regulating an arginine biosynthesis pathway in Streptococcus sanguinis SK36
Zhu, Scientific reports 2017 - “...argB , argC , argG , argH and argJ ) and two arginine/histidine permease genes (SSA_1568 and SSA_1569) were upregulated in ciaR . In contrast to ciaR , most of strains constructed to contain deletions in each of these genes produced more biofilm and water-insoluble glucan...”
- “...argB , argC , argG , argH and argJ ) and two arginine/histidine permease genes (SSA_1568 and SSA_1569) was significantly increased in ciaR (Fig. 3C ). ciaR reduces biofilm formation by activating the arginine biosynthesis pathway To further test the hypothesis, eight double mutants ( ciaR...”
- Involvement of signal peptidase I in Streptococcus sanguinis biofilm formation
Aynapudi, Microbiology (Reading, England) 2017 - “...protein No SSA_0614 1.595 2.34E-09 Transporter No SSA_1569 1.603 9.98E-11 Arginine/histidine ABC transporter permease No SSA_1568 1.615 2.63E-14 Arginine/histidine ABC transporter permease No SSA_2096 2.016 8.18E-13 ATP-dependent protease, ATP- binding subunit No *Values are SSA _0351:SK36. Cutoff for fold change is 1.5-fold decrease or increase. Cutoff...”
EP10_002624 amino acid ABC transporter permease from Geobacillus icigianus
33% identity, 88% coverage
- The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
Peltek, International journal of molecular sciences 2024 - “...(EP10_002156) and genes encoding transporters of glutamine and other amino acids (EP10_000138, EP10_001536, EP10_002622, EP10_00263, EP10_002624, and EP10_002625). These data indicate the beginning of a recovery of systems responsible for the utilization of amino acids and of other carbon sources from the environment; this is because...”
- “...1.222678 0.000381 Glutamine transport ATP-binding protein GlnQ EP10_002623 1.151767 0.003803 ABC transporter glutamine-binding protein GlnH EP10_002624 1.383302 0.00058 Putative glutamine ABC transporter permease protein GlnM, EP10_002625 1.382731 0.001782 Putative glutamine ABC transporter permease protein GlnP ijms-25-12059-t005_Table 5 Table 5 Genes and operons whose levels of transcription...”
Pf1N1B4_773 ABC transporter for L-asparagine and L-glutamate, permease subunit 2 from Pseudomonas fluorescens FW300-N1B4
32% identity, 86% coverage
- mutant phenotype: # Important for glutamate and asparagine utilization and cofit with other components
AO353_16280 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 from Pseudomonas fluorescens FW300-N2E3
31% identity, 86% coverage
- mutant phenotype: # Specifically important in carbon source L-Aspartic Acid; pH ; carbon source L-Asparagine; carbon source L-Glutamic acid monopotassium salt monohydrate; carbon source L-Glutamine
D822_03264 amino acid ABC transporter permease from Streptococcus ratti FA-1 = DSM 20564
32% identity, 92% coverage
GLNM_BACSU / O34671 Probable glutamine ABC transporter permease protein GlnM from Bacillus subtilis (strain 168) (see paper)
31% identity, 87% coverage
- function: Part of the ABC transporter complex GlnHMPQ involved in glutamine transport. Probably responsible for the translocation of the substrate across the membrane (By similarity).
subunit: The complex is composed of two ATP-binding proteins (GlnQ), two transmembrane proteins (GlnM and GlnP) and a solute-binding protein (GlnH).
CD630_21760 amino acid ABC transporter permease from Clostridioides difficile 630
CD2176 probable amino-acid ABC transporter, permease protein from Clostridium difficile 630
31% identity, 87% coverage
- The repertoire of ABC proteins in Clostridioides difficile
Pipatthana, Computational and structural biotechnology journal 2021 - “...NBD 7 235 cd630_21030 cd630_21040 TMD-TMD-NBD Antibiotic Exporter 67 cd630_21720 NBD 4 249 cd630_21740 cd630_21750 cd630_21760 NBD-SBD-TMD-TMD-SBD Cystine/amino acid Importer cd630_21770 68 cd630_22100 TMD/NBD 6 610 cd630_22110 TMD/NBD-TMD/NBD Multidrug Exporter 69 cd630_22110 TMD/NBD 6 748 cd630_22100 TMD/NBD-TMD/NBD Multidrug 70 cd630_23130 NBD 11 231 cd630_23110 cd630_23120 SBD-TMD-NBD...”
- The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties
Pantaléon, PloS one 2015 - “...proteome of bacteria in biofilm CD630_26720 AppA CD630_32840 Serine protease, HrtA family 630 erm matrix CD630_21760 ABC-type transport system, cystine/aminoacid-family permease CD630_10350 Cwp16 CD630_10360 Cwp17 630 erm biofilm secretome CD630_08270 Rbo CD630_28010 Conserved hypothetical protein 10.1371/journal.pone.0124971.g005 Fig 5 C . difficile biofilm development. Schematic representation of...”
- Control of Clostridium difficile Physiopathology in Response to Cysteine Availability
Dubois, Infection and immunity 2016 - “...(55, 56). The ABC transporter system composed of CD2177, CD2176, CD2175, CD2174, and CD2172 is likely involved in the uptake of cystine and/or cysteine in C....”
- “...proteins of E. coli and Bacillus subtilis (57), while CD2176 and CD2175 are similar to the L-cystine permeases of E. coli and B. subtilis. The expression of...”
LBAT_1257 amino acid ABC transporter permease from Lactobacillus acetotolerans
33% identity, 88% coverage
- Transcriptome responses of Lactobacillus acetotolerans F28 to a short and long term ethanol stress
Yang, Scientific reports 2017 - “...amino acid import including opuABC (glycine/betaine ABC transporter permease), another glnP (glutamine ABC transporter permease, LBAT_1257), metQ (ABC transporter ATP-binding component), metN (methionine ABC transporter ATP-binding component), metP (methionine ABC transporter permease), and another glnQ (amino acid ABC transporter ATP-binding component, LBAT_0131) were also down-regulated in...”
LMRG_02270 glutamine ABC transporter, permease/substrate-binding protein from Listeria monocytogenes 10403S
39% identity, 36% coverage
- L-glutamine Induces Expression of Listeria monocytogenes Virulence Genes
Haber, PLoS pathogens 2017 - “...as well as newly identified potential virulence factors [ 21 ]. One of these genes, LMRG_02270 , which encodes a polypeptide that is a fusion of a substrate-binding protein (SBP) and a transmembrane domain (TMD) of an ATP Binding Cassette (ABC) transporter, was chosen for further...”
- “...Deletion of LMRG_022701 genes leads to a reduced type I interferon response in macrophage cells LMRG_02270 is the first gene of a two-gene operon ( Fig 1A ), the second of which, LMRG_02271 , contains all of the canonical motifs of a nucleotide-binding domain (NBD) of...”
lmo0847 similar to Glutamine ABC transporter (binding and transport protein) from Listeria monocytogenes EGD-e
NP_464373 glutamine ABC transporter from Listeria monocytogenes EGD-e
39% identity, 36% coverage
- Acid shock of Listeria monocytogenes at low environmental temperatures induces prfA, epithelial cell invasion, and lethality towards Caenorhabditis elegans
Neuhaus, BMC genomics 2013 - “...set of genes encoding the following predicted functions: a transcriptional regulator (lmo0109), glutamine ABC transporter (lmo0847 and lmo1740), a subunit of a sugar ABC transporter (lmo1389), the IIA component of a mannose-specific phosphotransferase system (PTS, lmo1997), a protein similar to glutamate decarboxylases (lmo2434), and a stress...”
- “...were selected for microarray validation by qRT-PCR: prfA , hly , flhB, cheA , lmo0109, lmo0847, lmo1740, rsbR , lmo1389, lmo1997, lmo2434, and lmo2784 (see Additional file 3 for more functional details). The validated genes checked at various time points () displayed a significant correlation (level...”
- Membrane chaperone SecDF plays a role in the secretion of Listeria monocytogenes major virulence factors
Burg-Golani, Journal of bacteriology 2013 - “...lmo0688 lmo0692 lmo0697 lmo0706 lmo0708 lmo0713 lmo0724 lmo0847 20bp upstream lmo1072 lmo1527 lmo1687 lmo1693 lmo1855 lmo1856 lmo2110 lmo2531 lmo2715 lmo2461...”
- Dual role of CcpC protein in regulation of aconitase gene expression in Listeria monocytogenes and Bacillus subtilis
Mittal, Microbiology (Reading, England) 2013 - “...of citB as well as of citZ and the lmo0847 gene, which encodes a putative glutamine transporter (Kim et al., 2006; Mittal et al., 2009). The organization...”
- “...Microbiol 185, 136-146. regulation of citB and lmo0847 in Listeria monocytogenes. J Bacteriol 188, 179-190. http://mic.sgmjournals.org family regulator. J Mol...”
- Characterization of the intracellular glutamate decarboxylase system: analysis of its function, transcription, and role in the acid resistance of various strains of Listeria monocytogenes
Karatzas, Applied and environmental microbiology 2012 - “...acidified DM (Glt). Glutamine is probably imported by Lmo0847, a putative glutamine transporter (19), and subsequently converted to Glti. Pools of Glti could be...”
- “...Sonenshein AL. 2006. CcpC-dependent regulation of citB and lmo0847 in Listeria monocytogenes. J. Bacteriol. 188:179 -190. Murray EGD, Webb RA, Swann MBR. 1926....”
- Listeria monocytogenes grown at 7° C shows reduced acid survival and an altered transcriptional response to acid shock compared to L. monocytogenes grown at 37° C
Ivy, Applied and environmental microbiology 2012 - “...lmo0681 lmo0683 lmo0806 lmo0808 lmo0809 lmo0810 lmo0811 lmo0847 lmo0848 lmo1041 lmo1046 lmo1089 (tagD) Similar to protein gp35 from bacteriophage A118 Similar...”
- Global transcriptional analysis of spontaneous sakacin P-resistant mutant strains of Listeria monocytogenes during growth on different sugars
Tessema, PloS one 2011 - “...3 0.8 10 3 lmo0541 ABC transporter (binding protein) 0.8 10 3 1.0 10 3 lmo0847 glutamine ABC transporter (binding and transport protein) 0.7 10 5 1.0 10 5 lmo0848 amino acid ABC transporter, ATP-binding protein 0.7 10 5 0.9 10 4 lmo1007 unknown 0.7 10...”
- “..., citZ and citB (oxidation portion of tricarboxylic acid cycle) [39] , [40] , and lmo0847 (a putative glutamine ATP-binding cassette (ABC) transporter) [39] . In addition a number of pts and other transporter and utilization genes for sugars that was not present in the growth...”
- Pyruvate carboxylase plays a crucial role in carbon metabolism of extra- and intracellularly replicating Listeria monocytogenes
Schär, Journal of bacteriology 2010 - “...mutant, probably by the gene products of lmo0847 and lmo1740, encoding putative GltK-homologous ABC transporters for glutamate/aspartate. Nevertheless, even an...”
- Genomic and proteomic analysis of the Alkali-Tolerance Response (AlTR) in Listeria monocytogenes 10403S
Giotis, BMC microbiology 2008 - “...permease protein TagG lmo2250 arpJ -3.65 0.007 Similar to amino acid ABC transporter, permease protein lmo0847 NA -3.34 0.008 Similar to glutamine ABC transporter (binding and transport protein) lmo0997 clpE 3.64 0.013 ATP-dependent protease LMOf2365_2469 NA 3.44 0.025 Anions Phosphate ABC transporter, ATP-binding protein LMOf2365_2470 NA...”
- More
- CcpC-dependent regulation of citB and lmo0847 in Listeria monocytogenes.
Kim, Journal of bacteriology 2006 - GeneRIF: regulated by CcpC in media containing an excess of glucose and glutamine.
Psyr_3910 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine from Pseudomonas syringae pv. syringae B728a
31% identity, 86% coverage
PSPTO_4173 amino acid ABC transporter, permease protein from Pseudomonas syringae pv. tomato str. DC3000
31% identity, 86% coverage
- Data-Independent Acquisition Proteomics Unravels the Effects of Iron Ions on Coronatine Synthesis in Pseudomonas syringae pv. tomato DC3000
He, Frontiers in microbiology 2020 - “...et al., 2003 ). The expression of ABC transporters responsible for amino acid uptake (PSPTO_4887, PSPTO_4173, PSPTO_4919, PSPTO_1258, PSPTO_1256, and PSPTO_1255), glucose ABC transporter (PSPTO_1294, PSPTO_1293, and gltK), ribose ABC transporters (rbsA-1), iron ABC transporters (PSPTO_5562 and PSPTO_5561), peptide transporters (PSPTO_4562, PSPTO_4559, dppC, PSPTO_4558, and PSPTO_4564),...”
PfGW456L13_4772 ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 from Pseudomonas fluorescens GW456-L13
31% identity, 86% coverage
- mutant phenotype: Specific phenotypes on L-Asparagine; L-Asparagine. also has weak phenotypes on other a.a., but not on aspartate; weak phenotype on glutamate; also is detrimental during growth on glutamine (along with a downstream HK-RR), which could imply that it leaks glutamate; K10002 : glutamate/aspartate transport system permease protein
VT47_18655 amino acid ABC transporter permease from Pseudomonas syringae pv. syringae
31% identity, 86% coverage
Ldb1299 Amino Acid ABC transporter, substrate binding /permease protein from Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
34% identity, 37% coverage
TC 3.A.1.3.25 / Q9CES5 Glutamine ABC transporter permease and substrate binding protein protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity from Lactococcus lactis subsp. lactis (strain IL1403)
L165 glutamine ABC transporter permease and substrate binding protein PROTEIN from Lactococcus lactis subsp. lactis Il1403
WP_003132767 amino acid ABC transporter substrate-binding protein/permease from Lactococcus lactis subsp. lactis
36% identity, 29% coverage
- substrates: Asparagine, Glutamine, glutamate
- The S-component fold: a link between bacterial transporters and receptors
Partipilo, Communications biology 2024 - “...RibU was used as a negative control, while that of GlnP 85 (UniProt accession number: Q9CES5) was used as a positive control. The inquiry on SignalP 5.0 accounted for the Gram-positive/negative origin of the organism harboring the receptors. The sequence logo of helix 0 (Fig. 4a...”
- “...identifiers (UniProt accession numbers: number E5QVT2, Q1G930, A2RI47, A2RMJ9, P94513, P54595, P0AA93, P0AD14, Q08430, Q2G061, Q9CES5, Q2JYM9, Q488U0, F5RD42, C6WYA8, Q64AC4, E8TNX1, A8TXH3, A0A4R3E8R1, A2SU24) and corresponding protein structures were obtained from online resources publicly available, and described in the main document and the supplementary information....”
- Dynamics of diversified A-to-I editing in Streptococcus pyogenes is governed by changes in mRNA stability
Wulff, Nucleic acids research 2024 - “...18.2 1022344 SPy_1239 pepN aminopeptidase N L179 21.3 19.9 27.8 1302726 SPy_1584 aroE shikimate dehydrogenase L165 22.9 14.0 29.9 Recoding / non-synonymous editing 365684 SPy_0442 glpT glycerol-3-phosphate permease T14A 3.6 2.2 1.8 375257 SPy_0458 ftsK DNA segregation ATPase K13E 30.4 25.8 27.0 390540 SPy_0477 putative Nudix...”
- Phosphoribosyl Diphosphate (PRPP): Biosynthesis, Enzymology, Utilization, and Metabolic Significance
Hove-Jensen, Microbiology and molecular biology reviews : MMBR 2017 - “...Q183 M199 V200 V201 V205 E207 Q105 T128 L129 S132 V144 L165 A173 H179 F180 F181 K185 N198 K107 E130 E131 Y134 K136 L169 E177 Y183 S184 Y185 E189 A202 R106 H128...”
- Antimicrobial activity of MDL 63,246, a new semisynthetic glycopeptide antibiotic
Goldstein, Antimicrobial agents and chemotherapy 1995 - “...4 mg of MDL 63,246 per ml against S. aureus L1524 and L165 (Fig. 2a and b), but it gave a somewhat lower level of killing at 48 h against L1658 (Fig. 2c),...”
- “...Bactericidal activity of MDL 63,246 against S. aureus L1524 (a), L165 (b), and L1658 (c). , untreated control; F, MDL 63,246 (2 and 4 mg/ml for L1524 and L1658;...”
- Structural characterization and modeling of the Borrelia burgdorferi hybrid histidine kinase Hk1 periplasmic sensor: A system for sensing small molecules associated with tick feeding
Bauer, Journal of structural biology 2015 - “...(GenBank accession KFX35677); GlnBP, GlnP Substrate Binding Domain 2 (sbd2) from Lactococcus lactis (GenBank accession WP_003132767); HisJ, ABC transporter substrate-binding protein HisJ from E. coli (GenBank accession AAA85769). Figure 2 Refined crystal structure of B. burgdorferi Hk1 sensor domain D1 A . Ribbon drawing of the...”
lin2352 similar to amino acid ABC transporter, permease protein from Listeria innocua Clip11262
34% identity, 45% coverage
LMRG_01581 hypothetical protein from Listeria monocytogenes 10403S
34% identity, 45% coverage
lmo2250 similar to amino acid ABC transporter, permease protein from Listeria monocytogenes EGD-e
34% identity, 45% coverage
- The stressosome is required to transduce low pH signals leading to increased transcription of the amino acid-based acid tolerance mechanisms in Listeria monocytogenes
Guerreiro, Access microbiology 2022 - “...]). In L. monocytogenes , the arginine ABC-transporter gene, arpJ [ 45 ] (encoded by lmo2250 ), was transcriptionally upregulated under acidic conditions [ 11 ], suggesting increased import of l -arginine in response to acidification of the medium. Additionally, the acid inducible arginine decarboxylase AdiA,...”
- Lactococcus lactis, an Attractive Cell Factory for the Expression of Functional Membrane Proteins
Frelet-Barrand, Biomolecules 2022 - “...6 1% Lmo1422 binding-protein-dependent transport system permease 55.7 6 L. monocytogenes 1% [ 60 ] Lmo2250 ABC transporter 53.1 6 2% cwaA cell wall-anchored adhesion-associated protein 93.7 2 L. plantarum - [ 83 ] OppA oligopeptide-binding protein 59.7 p L. salivarius - [ 84 ] XylP...”
- The absence of N-acetylglucosamine in wall teichoic acids of Listeria monocytogenes modifies biofilm architecture and tolerance to rinsing and cleaning procedures
Brauge, PloS one 2018 - “...of the GlcNAc residue). We then tried to relate the presence of mutations in the lmo2250 gene to the sampling nature, the pulsotype, or the sampling site of the L . monocytogenes strains, but no direct relationship could be demonstrated. Indeed, several strains with different mutations...”
- An In Vivo Selection Identifies Listeria monocytogenes Genes Required to Sense the Intracellular Environment and Activate Virulence Factor Expression
Reniere, PLoS pathogens 2016 (no snippet) - Acid shock of Listeria monocytogenes at low environmental temperatures induces prfA, epithelial cell invasion, and lethality towards Caenorhabditis elegans
Neuhaus, BMC genomics 2013 - “...Mutant attenuated in survival within macrophages [ 58 ] 37C 1* 1* 2.5 2.7 2.0 lmo2250 arpJ ABC-transporter for arginine Mutant attenuated in intracellular growth [ 59 ] 37C 1* 2.3 2.0 2.0 1* See legend of Table 1 . Acid shock is characterized by a...”
- Global transcriptional analysis of spontaneous sakacin P-resistant mutant strains of Listeria monocytogenes during growth on different sugars
Tessema, PloS one 2011 - “...0.6 10 5 lmo1255 PTS trehalose specific enzyme IIBC 2.5 10 9 0.6 10 7 lmo2250 ( arpJ ) amino acid ABC transporter, permease protein 0.7 10 7 0.6 10 3 lmo2683 cellobiose PTS enzyme IIB component 1.5 10 6 1.4 10 8 lmo2684 cellobiose PTS...”
- Genomic and proteomic analysis of the Alkali-Tolerance Response (AlTR) in Listeria monocytogenes 10403S
Giotis, BMC microbiology 2008 - “...0.007 Amino acids, peptides and amines Highly similar to teichoic acid translocation permease protein TagG lmo2250 arpJ -3.65 0.007 Similar to amino acid ABC transporter, permease protein lmo0847 NA -3.34 0.008 Similar to glutamine ABC transporter (binding and transport protein) lmo0997 clpE 3.64 0.013 ATP-dependent protease...”
lin0840 similar to Glutamine ABC transporter (binding and transport protein) from Listeria innocua Clip11262
38% identity, 36% coverage
N134_RS04205 ABC transporter substrate-binding protein/permease from Limosilactobacillus reuteri TD1
33% identity, 41% coverage
SAG0716 amino acid ABC transporter, permease protein from Streptococcus agalactiae 2603V/R
33% identity, 92% coverage
CPE0601 probable amino acid ABC transporter from Clostridium perfringens str. 13
34% identity, 88% coverage
DET0418 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Dehalococcoides ethenogenes 195
32% identity, 79% coverage
K562_12100 amino acid ABC transporter permease from Burkholderia cenocepacia
38% identity, 80% coverage
- Profiling cell envelope-antibiotic interactions reveals vulnerabilities to β-lactams in a multidrug-resistant bacterium
Hogan, Nature communications 2023 - “...condition. These were: K562_RS24650 (ABC-type amino acid transporter), K562_22855 (putative glycosyltransferase), K562_05000 (hydrolase family protein), K562_12100 (acyl-CoA dehydrogenase), K562_01045 (Raf kinase inhibitor-like protein), K562_06455 (putative PHA depolymerase protein), K562_13470 (GudD glucarate dehydratase), K562_16220 (DUF3025 domain-containing protein), K562_18550 (hypothetical protein), K562_28510 (hypothetical protein). Strain fitness values were...”
TC 3.A.1.3.22 / Q9I404 Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida from Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
PA1340 probable permease of ABC transporter from Pseudomonas aeruginosa PAO1
PA14_46930 putative permease of ABC transporter from Pseudomonas aeruginosa UCBPP-PA14
32% identity, 86% coverage
- substrates: Glutamic Acid, Glutamine, N-acetylglutamic acid
- Distinct transcriptome and traits of freshly dispersed <i>Pseudomonas aeruginosa</i> cells
Kalia, mSphere 2024 - “...Upregulated 1.24985 Upregulated 0.820095 PA1318 cyoB-cytochrome o ubiquinol oxidase subunit 1 Upregulated 0.840862 Upregulated 0.713546 PA1340 AatM Upregulated 1.068743 Upregulated 0.607256 PA1551 Probable ferredoxin Upregulated 1.101473 Upregulated 1.379079 PA1552 Cytochrome c oxidase, cbb3-type CcoP subunit Upregulated 1.176545 Upregulated 0.800953 PA1553 Cytochrome c oxidase, cbb3-type, coO subunit...”
- Utilization of L-glutamate as a preferred or sole nutrient in Pseudomonas aeruginosa PAO1 depends on genes encoding for the enhancer-binding protein AauR, the sigma factor RpoN and the transporter complex AatJQMP
Lundgren, BMC microbiology 2021 - “...carbon sources The aauR ( PA1335 ), aatJ ( PA1342 ) and aatQM ( PA1341 PA1340 ) genes were individually deleted from the genome of P. aeruginosa PAO1. The resulting markerless aauR , aatJ , and aatQM mutants, in addition to an rpoN ::-Km mutant and...”
- Global reprogramming of virulence and antibiotic resistance in Pseudomonas aeruginosa by a single nucleotide polymorphism in elongation factor, fusA1
Maunders, The Journal of biological chemistry 2020 (secret) - Increased ParB level affects expression of stress response, adaptation and virulence operons and potentiates repression of promoters adjacent to the high affinity binding sites parS3 and parS4 in Pseudomonas aeruginosa
Kawalek, PloS one 2017 - “...2,1 2 probable hydrolase PA1337 ansB -2,0 6 glutaminase-asparaginase PA1338 ggt -2,5 6 gamma-glutamyltranspeptidase precursor PA1340 aatM -2,8 6 putative amino acid transporter PA1341 aatQ -3,1 6 putative amino acid transporter Genes involved in PQS synthesis PA0996 pqsA -3,2 5 PqsA, probable coenzyme A ligase PA0997...”
- “...Similarly, five genes downregulated in response to BexR overproduction, PA0998 , PA1337 , PA1338 , PA1340 and PA1341 , are also downregulated in the analysed ParB -overproducing cells ( Table 4 ). The expression of bexR gene is known to be bistable, meaning that this gene...”
- ChIP-Seq and RNA-Seq reveal an AmrZ-mediated mechanism for cyclic di-GMP synthesis and biofilm development by Pseudomonas aeruginosa
Jones, PLoS pathogens 2014 - “...PA4844 3.1 4.69 chemotaxis transducer PA3367 3.02 3.17 hypothetical protein (contains type 1 export signal) PA1340 3.01 5.87 amino acid ABC transporter membrane protein PA3951 2.91 3.72 hypothetical protein (no prediction) PA3413 2.90 3.30 predicted SOS response gene rhlR 2.88 5.57 transcriptional regulator RhlR PA1664 2.86...”
- High-throughput phenotypic characterization of Pseudomonas aeruginosa membrane transport genes
Johnson, PLoS genetics 2008 - “...acid ABC transporter periplasmic binding protein PA1339 PAK amino acid ABC transporter ATP binding protein PA1340 PAK amino acid ABC transporter membrane protein PA1341 PAK amino acid ABC transporter membrane protein PA1418 PAK sodiumsolute symporter PA1485 PA01 amino acid APC family transporter PA1590 PAK branched chain...”
- “...-C +/ PA1339 amino acid ABC transporter ATP binding protein L-Glutamic Acid - C +/ PA1340 amino acid ABC transporter membrane protein L-Glutamic Acid - C +/ L-Glutamine C +/ L-Glutamic Acid - N +/ D-Glutamic Acid - N - N-Acetyl-L-Glutamic Acid N +/ PA1341 amino...”
- Characterization of nutrient-induced dispersion in Pseudomonas aeruginosa PAO1 biofilm
Sauer, Journal of bacteriology 2004 - “...PA4432 PA3647 PA1341 PA0282 PA1339 PA0280 PA1340 Regulatory protein TypA Bacterioferritin Argininosuccinate synthase ATP sulfurylase GTP-binding subunit/APS...”
- Pseudomonas aeruginosa Alters Its Transcriptome Related to Carbon Metabolism and Virulence as a Possible Survival Strategy in Blood from Trauma Patients
Elmassry, mSystems 2019 - “...PA14_64870 ; four genes encoding the glutamate and aspartate transport system, PA14_46910 , PA14_46920 , PA14_46930 , and PA14_46950 , plus a fifth gene, ansB , which is involved in glutamate and aspartate metabolism; and six genes related to glycine and serine metabolism, gcvH2 , gcvP2...”
ARTQ_BACSU / P54536 Arginine transport system permease protein ArtQ from Bacillus subtilis (strain 168) (see paper)
33% identity, 86% coverage
- function: Part of a binding-protein-dependent transport system for arginine. Probably responsible for the translocation of the substrate across the membrane.
disruption phenotype: Cells show impaired growth on arginine as the nitrogen source.
UE46_13335 ABC transporter permease subunit from Listeria weihenstephanensis
33% identity, 44% coverage
Ac3H11_2554 ABC transporter for L-Histidine, permease component 1 from Acidovorax sp. GW101-3H11
32% identity, 88% coverage
- mutant phenotype: Specific phenotypes on L-Histidine. In a gene cluster that also includes hutD and imidazolonepropionase. Some subunits are annotated as transporting glutamine.
SA1675 hypothetical protein from Staphylococcus aureus subsp. aureus N315
SAV1858 similar to glutamine-binding periplasmic protein from Staphylococcus aureus subsp. aureus Mu50
31% identity, 49% coverage
NWMN_1750 extracellular glutamine-binding protein from Staphylococcus aureus subsp. aureus str. Newman
SAOUHSC_01991 ABC transporter, permease protein, putative from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_1808 amino acid ABC transporter, permease/substrate-binding protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
SACOL1916 amino acid ABC transporter, permease/substrate-binding protein from Staphylococcus aureus subsp. aureus COL
ILP77_RS08845 ABC transporter permease subunit from Staphylococcus aureus
31% identity, 44% coverage
- Molecular Mechanisms of Staphylococcus and Pseudomonas Interactions in Cystic Fibrosis
Biswas, Frontiers in cellular and infection microbiology 2021 - “...gltB and gltD that convert glutamine to glutamate. Moreover, increased expression of glutamine binding protein (NWMN_1750) in S. aureus and ammonium transporter (PA14_24780) in P. aeruginosa indicate that both bacteria try to acquire nitrogen from extracellular sources. These modifications suggest that co-existence induces competition for nutrient...”
- Transcriptional profiling of Pseudomonas aeruginosa and Staphylococcus aureus during in vitro co-culture
Tognon, BMC genomics 2019 - “...Moreover, both bacteria seemed to acquire extracellular N-sources as reflected by the increased expression of NWMN_1750 in S. aureus , encoding a glutamine binding protein, and PA14_24780 in P. aeruginosa , an ammonium transporter. Taken together, these findings indicate that co-culture rapidly induces conditions of nitrogen...”
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...5.0 Hypothetical NWMN_1749 SA1674 tcyC 1.8 e 7.1 ABC transporter: cystine (ATPase) e + Down NWMN_1750 SA1675 tycB 1.6 e 6.7 ABC transporter: cystine (permease) e + Down NWMN_1751 SA1676 tycA 1.2 e 4.8 ABC transporter: cystine (cystine binding) e + NWMN_1877 SA1755 chp 32.7 Chemotaxis-inhibiting...”
- CodY in Staphylococcus aureus: a regulatory link between metabolism and virulence gene expression
Pohl, Journal of bacteriology 2009 - “...NWMN_1311 NWMN_1348 NWMN_1616 NWMN_1617 NWMN_1749 NWMN_1750 NWMN_1960 NWMN_1961 NWMN_1962 NWMN_1963 NWMN_1964 NWMN_1965 NWMN_1966 NWMN_2347 NWMN_2500 NWMN_2501...”
- Spontaneous formation of MXene-oxidized sono/chemo-dynamic sonosensitizer/nanocatalyst for antibacteria and bone-tissue regeneration
Yu, Journal of nanobiotechnology 2023 - “...which were related to carbohydrate metabolism. In addition, the expression of genes (SAOUHSC_02137, SAOUHSC_01990 and SAOUHSC_01991) associated with cell membrane transport proteins was decreased. Importantly, the expression of genes (rpsS, inf-3, mutL, rplC and rpmG) associated with protein synthesis was also reduced. This may be related...”
- Protectome analysis: a new selective bioinformatics tool for bacterial vaccine candidate discovery
Altindis, Molecular & cellular proteomics : MCP 2015 - “...S. aureus: SAOUHSC_00544*, SAOUHSC_00545* S. aureus: SAOUHSC_01991, SAOUHSC_02699 GBS: SAG0136, SAG0290, SAG0717, SAG0949, SAG1431, SAG1610, SAG1642, SAG1466 S....”
- The Staphylococcus aureus KdpDE two-component system couples extracellular K+ sensing and Agr signaling to infection programming
Xue, Infection and immunity 2011 - “...SAOUHSC_02523 SAOUHSC_02858 SAOUHSC_01296 SAOUHSC_01729 SAOUHSC_01991 SAOUHSC_00202 SAOUHSC_02850 SAOUHSC_03047 SAOUHSC_01032 SAOUHSC_01072 SAOUHSC_00704...”
- Identification of the main glutamine and glutamate transporters in Staphylococcus aureus and their impact on c-di-AMP production
Zeden, Molecular microbiology 2020 - “...glutamate transport in other bacteria (SchuurmanWolters & Poolman, 2005 ). S. aureus contains a glnPQ (SAUSA300_1808 SAUSA300_1807) operon with glnP coding for a substratebinding domainpermease fusion protein and glnQ coding for the cytoplasmic nucleotidebinding ATPase domain. The results from a previous study suggested that this transporter...”
- Differential gene expression in Staphylococcus aureus exposed to Orange II and Sudan III azo dyes
Pan, Journal of industrial microbiology & biotechnology 2015 - “...TGCATTACCTGATTCTGAACCTT SAUSA300_0846 (argG) SAUSA300_1808 SAUSA300_0914 GTGGCGCAGCATAAGGAT GGGCATGGAGTCGTGAAG GTGGCGCAGCATAAGGAT ACTGCGATGTATGCACAAGC...”
- “...2.06 SAUSA300_2385 SAUSA300_1231 SAUSA300_0864 SAUSA300_2538 SAUSA300_1808 SAUSA300_1916 SAUSA300_0914 SAUSA300_2006 ilvD EG Amino acid permease family protein...”
- Daptomycin resistance mechanisms in clinically derived Staphylococcus aureus strains assessed by a combined transcriptomics and proteomics approach
Fischer, The Journal of antimicrobial chemotherapy 2011 - “...arcA arcB arcB1 arcB2 arcD arg argF argH SACOL0408 SACOL1916 SAV2440 lacA lacB lacD lacE lacF lacG lldP2 manA SA0208 scrA tagG treP treC SAV0734 SAV2417 MW0149...”
- Tricarboxylic acid cycle-dependent attenuation of Staphylococcus aureus in vivo virulence by selective inhibition of amino acid transport
Zhu, Infection and immunity 2009 - “...no. NC_002951). A 1.4-kb PCR product encompassing SACOL1916 (putative glutamine permease gene, glnP) was amplified using primers COL1916-f and COL1916-r and...”
- “...portion of the putative Gln permease gene (glnP, orf SACOL1916) was replaced in S. aureus strain UAMS-1 with an ermB cassette and TCA cycle activity was...”
- A new oxidative sensing and regulation pathway mediated by the MgrA homologue SarZ in Staphylococcus aureus
Chen, Molecular microbiology 2009 - “...3.8 Conserved hypothetical protein SACOL1849 2.3 - Conserved hypothetical protein SACOL1915 4.1 Glutamate ABC transporter SACOL1916 3.8 Amino acid ABC transporter SACOL2461 3.7 + Conserved hypothetical protein SACOL2579 3.6 Phytone dehydrogenase SACOL2585 4.0 -2.0 pfoS/R like regulatory protein SACOL2619 3.1 -2.4 Amino acid permiase SACOL2704 3.0...”
- Antibacterial and antibiofilm activities of protocatechualdehyde and its synergy with ampicillin against methicillin-resistant Staphylococcus aureus
Wang, Frontiers in microbiology 2024 - “...resistance to antibiotics ( Smith et al., 2019 ). Under the stimulation of PA, artQ (ILP77_RS08845) was significantly upregulated. Therefore, it is speculated that the upregulation of artQ would promote the intake of antibiotics, resulting in decrease of drug resistance. 3.4.5.5 Genes associated with genetic information...”
SAR1949 putative extracellular glutamine-binding protein from Staphylococcus aureus subsp. aureus MRSA252
DA471_RS01680 ABC transporter permease subunit from Staphylococcus aureus
31% identity, 44% coverage
SE1541 glutamine-binding periplasmic protein from Staphylococcus epidermidis ATCC 12228
30% identity, 45% coverage
SERP_RS06915 ABC transporter substrate-binding protein/permease from Staphylococcus epidermidis RP62A
SERP1395 amino acid ABC transporter, permease/amino acid-binding protein, putative from Staphylococcus epidermidis RP62A
30% identity, 45% coverage
- Mutation of gdpS gene induces a viable but non-culturable state in Staphylococcus epidermidis and changes in the global transcriptional profile
Zhu, BMC microbiology 2022 - “...( gdpS /WT) Biological functions/pathways SERP_RS02180 gdpS GGDEF domain-containing protein -10.65 SERP_RS05895 hypothetical protein 1.01 SERP_RS06915 glutamate ABC transporter permease 1.04 SERP_RS08330 ilvC ketol-acid reductoisomerase 1.34 Valine, leucine and isoleucine biosynthesis SERP_RS08335 leuA 2-isopropylmalate synthase 1.03 SERP_RS08340 leuB 3-isopropylmalate dehydrogenase 1.1 SERP_RS09425 ssaA secretory antigen precursor...”
- Gram-positive three-component antimicrobial peptide-sensing system
Li, Proceedings of the National Academy of Sciences of the United States of America 2007 - “...SERP0573 SERP0712 SERP1470 SERP1772 SERP2170 SERP2442 SERP0971 SERP1394 SERP1395 SERP1951 SERP1952 2.05* 2.07* 2.05* 2.15* 2.07* 2.3* 0.33 0.41 Displays is a...”
- “...were slightly down-regulated (genes SERP1394, SERP1395, SERP1951, SERP1952). Thus, the 9470 www.pnas.orgcgidoi10.1073pnas.0702159104 Fig. 1. Gene regulatory...”
IUJ47_RS06845 amino acid ABC transporter substrate-binding protein/permease from Enterococcus faecalis
33% identity, 29% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...protein/permease IUJ47_RS07395 0.116 Amino acid ABC transporter ATP-binding protein IUJ47_RS10590 0.124 ABC transporter ATP-binding protein/permease IUJ47_RS06845 0.129 Amino acid ABC transporter substrate-binding protein/permease IUJ47_RS07470 0.136 Oligopeptide ABC transporter permease Opp1B IUJ47_RS02495 0.157 Peptide ABC transporter substrate-binding protein IUJ47_RS07475 0.198 Oligopeptide ABC transporter permease Opp1C IUJ47_RS01265 0.211...”
EF0761 amino acid ABC transporter, amino acid-binding/permease protein from Enterococcus faecalis V583
33% identity, 29% coverage
EF0893 amino acid ABC transporter, amino acid-binding/permease protein from Enterococcus faecalis V583
WOK_00999 ABC transporter permease subunit from Enterococcus faecalis EnGen0359
35% identity, 45% coverage
- The Coexistence of Bacterial Species Restructures Biofilm Architecture and Increases Tolerance to Antimicrobial Agents
Dong, Microbiology spectrum 2023 - “...metabolism pathways. In terms of nutrient transport, the expression of 2 DEGs ( ef0892 and ef0893 ) involved in amino acid transport was upregulated 6.3-fold at 24 h ( Table1 ). The expression of 7 DEGs ( gltA , glnA , gdhA , glmS , purF...”
- “...system EIID components 5.0 +2.8 Arginine/Lysine/Histidine ef0892 Amino acid ABC transporter ATP-binding protein +6.3 +5.3 ef0893 ABC transporter permease subunit +6.3 +1.7 Glutamine metabolism gltA NADPH-dependent glutamate synthase +3.9 4.5 glnA Type I glutamate-ammonia ligase +5.7 +3.0 gdhA NADP-specific glutamate dehydrogenase +6.4 +2.8 Glutamine catalyzing glmS...”
- Drosophila host model reveals new enterococcus faecalis quorum-sensing associated virulence factors
Teixeira, PloS one 2013 - “...Hypothetical protein +11 EF0891 7 Aspartate aminotransferase putative 4 EF0892 Aminoacid ABC transporter,ATP-binding protein 3 EF0893 Aminoacid ABC transporter/permease 3 3 3 EF1097 Putative Bacteriocin +31 +23 +30 +47 EF1218 8 spermidine/putrescine ABC transporter,permease 3 EF1351 Hypothetical protein +6 +8 +4 EF1352 Magnesium-translocating, P-type ATPase +5...”
- “...ef1815, ef1816 ); those affected only if either one of the proteases was absent ( ef0893 ); those for which mRNA levels were altered only when both proteases were absent ( ef0411 , ef0563 , ef0891 , ef0892 , ef1218 ); those for which mRNA accumulated...”
- Global transcriptional analysis of the stringent response in Enterococcus faecalis
Gaca, Microbiology (Reading, England) 2012 - “...EF0675 EF0706 EF0758 EF0759 EF0807 EF0820 EF0867 EF0891 EF0893 EF0910 EF1117 EF1118 EF1119 EF1120 EF1211 EF1405 EF1413 EF1513 EF1584 EF1585 EF1597 EF1672 EF1681...”
- Impact of manganese, copper and zinc ions on the transcriptome of the nosocomial pathogen Enterococcus faecalis V583
Abrantes, PloS one 2011 - “...the first gene was also repressed under zinc stress. With the exception of arcA and ef0893 , all genes common to the three metal stress conditions were overexpressed in the presence of zinc and down-regulated in the presence of manganese and copper. Two homologous systems, efaCBA...”
- “...ef0578 6.40 4.77 1.49 helix-turn-helix, iron-dependent repressor family ef0579 2.62 1.90 1.27 transcriptional regulator, putative ef0893 1.52 1.72 2.18 amino acid ABC transporter, amino acid binding/ permease protein ef1057 (mntH2) 2.97 7.69 3.10 Mn 2+ /Fe 2+ transporter, NRAMP family ef1058 5.36 5.80 3.78 universal stress...”
- Differences of protein expression in enterococcus faecalis biofilm during resistance to environmental pressures
Jiang, Technology and health care : official journal of the European Society for Engineering and Medicine 2024 - “...E2YAA7 ABC transporter, permease protein HMPREF9493_00603 R3JG22 His/Glu/Gln/Arg/opine family amino ABC transporter, permease, 3-TM region WOK_00999 E2YFG9 ABC transporter, ATP-binding protein HMPREF9493_02321 J6MXR6 Putative glutamine ABC transporter permease protein GlnP HMPREF1332_03123 E2YAV8 ABC transporter, ATP-binding protein HMPREF9493_00680 E2YAV7 Efflux ABC transporter, permease protein HMPREF9493_00679 A0A1G1S9Y6 PTS...”
IUJ47_RS07400, OG1RF_10621 ABC transporter permease subunit from Enterococcus faecalis OG1RF
35% identity, 45% coverage
DVU1237 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Desulfovibrio vulgaris Hildenborough
34% identity, 73% coverage
Dde_1386 Amino acid ABC transporter, permease protein from Desulfovibrio desulfuricans G20
34% identity, 57% coverage
PA5075 probable permease of ABC transporter from Pseudomonas aeruginosa PAO1
34% identity, 57% coverage
BAU10_19275 amino acid ABC transporter permease from Vibrio alginolyticus
30% identity, 90% coverage
Lreu_0294 amino acid ABC transporter permease from Limosilactobacillus reuteri subsp. reuteri
Lreu_0294 polar amino acid ABC transporter, inner membrane subunit from Lactobacillus reuteri DSM 20016
33% identity, 85% coverage
WIGMOR_0595 amino acid ABC transporter permease from Wigglesworthia glossinidia endosymbiont of Glossina morsitans
30% identity, 85% coverage
N134_RS01525 amino acid ABC transporter permease from Limosilactobacillus reuteri TD1
33% identity, 85% coverage
- Investigating Differential Expressed Genes of Limosilactobacillus reuteri LR08 Regulated by Soybean Protein and Peptides
Zhu, Foods (Basel, Switzerland) 2022 - “...showed marked expression changes in response to dpep treatment. TcyA ( N134_RS01535 ), tcyB ( N134_RS01525 ), and tcyC ( N134_RS01530 ) encoding transporter substrate-binding domain-containing protein [ 35 ], amino acid ABC transporter permease, and amino acid ABC transporter ATP-binding protein, which jointly participated in...”
- “...accounting for 60.41%, among which the expression patterns of metC ( N134_RS01520 ), tycB ( N134_RS01525 ), tycC ( N134_RS01530 ), and opuC ( N134_RS00920 ) in the 3 groups were all in accordance with those of in RNA-seq. These results were deemed to be relatively...”
LSEI_1344 ABC-type amino acid transport system, permease and periplasmic component from Lactobacillus casei ATCC 334
31% identity, 45% coverage
- Effect of periodontal pathogens on the metatranscriptome of a healthy multispecies biofilm model
Frias-Lopez, Journal of bacteriology 2012 - “...of them related to peptide transport (LSEI_1344, LSEI_2063, LSEI_1892, LSEI_0175, LSEI_1207, LSEI_2446, LSEI_2447, LSEI_1261, LSEI_1345, LSEI_2628, LSEI_0308,...”
TC 3.A.1.3.19 / Q88NY4 PP1069, component of Acidic amino acid uptake porter, AatJMQP from Pseudomonas putida (strain KT2440) (see paper)
PP1069 amino acid ABC transporter, permease protein from Pseudomonas putida KT2440
31% identity, 86% coverage
- substrates: Asparagine, Glutamine, aspartate, glutamate
tcdb comment: It is the sole system that transports glutamate and glutamine, but it can also transport aspartate and asparagine (Singh and Röhm 2008) - UEG Week 2024 Poster Presentations
, United European gastroenterology journal 2024 - UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023
LGG_RS13465 ABC transporter substrate-binding protein/permease from Lacticaseibacillus rhamnosus GG
31% identity, 45% coverage
T1E_4502 amino acid ABC transporter permease from Pseudomonas putida DOT-T1E
31% identity, 86% coverage
Atu5408 ABC transporter, membrane spanning protein (amino acid) from Agrobacterium tumefaciens str. C58 (Cereon)
30% identity, 76% coverage
- Large deletions in the pAtC58 megaplasmid of Agrobacterium tumefaciens can confer reduced carriage cost and increased expression of virulence genes
Morton, Genome biology and evolution 2013 - “...truncated At plasmid is approximately 0.35 Mb with deletion of all genes between Atu5207 and Atu5408 (positions 206,308400,472). Figure 1 A and B depict the deletion and shows the resulting new sequence where Atu5207 and Atu5408 are convergent with one another. Using primers that are flanking...”
- “...directly or indirectly negatively regulates expression of these virulence genes is encoded between Atu5207 and Atu5408 . We did not find that the presence of the truncated pAtC58, relative to the full-length plasmid, had any impact on tumor size or number based on standard assays in...”
PPYC1_20185 amino acid ABC transporter substrate-binding protein/permease from Paenibacillus polymyxa
32% identity, 39% coverage
GLUD_CORGL / P48245 Glutamate transport system permease protein GluD; Glutamate uptake system protein GluD from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
TC 3.A.1.3.9 / P48245 GluD aka CGL1953, component of Glutamate porter from Corynebacterium glutamicum (Brevibacterium flavum) (see 2 papers)
31% identity, 81% coverage
- function: Part of the ABC transporter complex GluABCD involved in glutamate uptake. Probably responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (GluA), two transmembrane proteins (GluC and GluD) and a solute-binding protein (GluB).
disruption phenotype: Deletion of the gluABCD cluster almost abolishes glutamate uptake activity. - substrates: glutamate
cg2139 glutamate permease from Corynebacterium glutamicum ATCC 13032
30% identity, 70% coverage
Dde_3071 Amino acid ABC transporter, permease protein from Desulfovibrio desulfuricans G20
Dde_3071 amino acid ABC transporter permease from Oleidesulfovibrio alaskensis G20
30% identity, 71% coverage
LBA0112 putative glutamine ABC transporter from Lactobacillus acidophilus NCFM
29% identity, 40% coverage
SMc03133 PUTATIVE AMINO-ACID TRANSPORT SYSTEM PERMEASE ABC TRANSPORTER PROTEIN from Sinorhizobium meliloti 1021
34% identity, 70% coverage
- Inter-replicon Gene Flow Contributes to Transcriptional Integration in the Sinorhizobium meliloti Multipartite Genome
diCenzo, G3 (Bethesda, Md.) 2018 - “...( smc03027 + :: lacZ ), SmFL1485 ( sma0089 + :: gusA ), SmFL1705 ( smc03133 - :: gusA ), SmFL4407 ( smc03121 + :: lacZ ), SmFL6033 ( smc02780 + :: gusA ), and SmFL6082 ( smb21039 - :: lacZ ). Each fusion was recombined...”
- Transcriptome analysis of the role of GlnD/GlnBK in nitrogen stress adaptation by Sinorhizobium meliloti Rm1021
Yurgel, PloS one 2013 - “...expression of some of the genes comprising Cluster II.I. The D,L-2-aminoadipic acid transport system (SMc03131, SMc03133, and SMc03135) was also induced in wild type cells and repressed in the glnD mutant under high nitrogen. D,L-2-aminoadipic acid acts as a glutamine synthetase inhibitor [38] . The induction...”
GltK / b0653 glutamate/aspartate ABC transporter membrane subunit GltK (EC 7.4.2.1) from Escherichia coli K-12 substr. MG1655 (see 3 papers)
GltK / P0AER5 glutamate/aspartate ABC transporter membrane subunit GltK (EC 7.4.2.1) from Escherichia coli (strain K12) (see 3 papers)
GLTK_ECOLI / P0AER5 Glutamate/aspartate import permease protein GltK from Escherichia coli (strain K12) (see 2 papers)
TC 3.A.1.3.4 / P0AER5 Glutamate/aspartate transport system permease protein GltK aka B0653, component of Glutamate/aspartate porter from Escherichia coli (see 4 papers)
c0737 Glutamate/aspartate transport system permease protein gltK from Escherichia coli CFT073
b0653 glutamate and aspartate transporter subunit from Escherichia coli str. K-12 substr. MG1655
Z0803 glutamate/aspartate transport system permease from Escherichia coli O157:H7 EDL933
ECs0692 glutamate/aspartate transport system permease from Escherichia coli O157:H7 str. Sakai
29% identity, 95% coverage
- function: Part of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. Probably responsible for the translocation of the substrate across the membrane.
function: (Microbial infection) Probably transports the toxic C- terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Toxin transport is strain-specific, mutations in this gene do not confer resistance to several other tested CdiA toxins.
subunit: The complex is composed of two ATP-binding proteins (GltL), two transmembrane proteins (GltJ and GltK) and a solute-binding protein (GltI).
disruption phenotype: Disruption confers resistance to cellular contact-dependent growth inhibition (CDI) CdiA of P.luminescens strain TTO1, but not to several other tested CdiA toxins. - substrates: glutamate
tcdb comment: Similar in sequence to 3.A.1.3.19 which is specific for Glu, Asp, Gln and Asn (Singh and Röhm 2008) - CEACAMs serve as toxin-stimulated receptors for enterotoxigenic Escherichia coli
Sheikh, Proceedings of the National Academy of Sciences of the United States of America 2020 (secret) - Genome-wide analysis of the response to nitric oxide in uropathogenic Escherichia coli CFT073
Mehta, Microbial genomics 2015 - “...c2580 Putative colanic acid biosynthesis acetyltransferase WcaF 12.33 c1870 c1870 Hypothetical protein YdcX 11.85 gltK c0737 Glutamate/aspartate transport system permease protein GltK 11.74 dppB c4358 Dipeptide transport system permease protein DppB 11.50 sdhD c0800 Succinate dehydrogenase hydrophobic membrane anchor protein 11.21 c0937 c0937 Hypothetical protein 11.10...”
- Burkholderia multivorans requires species-specific GltJK for entry of a contact-dependent growth inhibition system protein
Myers-Morales, Molecular microbiology 2021 - “...241294, and 553678 replaced with nucleotides 487, 241294, and 553675 from E. coli MG1655 gltK (b0653), respectively. Chimeric gene gltK Chim2 is the opposite of gltK Chim1 , consisting of E. coli MG1655 gltK coding sequence with nucleotides 487, 241294, and 553678 replaced with nucleotides 487,...”
- Escherichia coli toxin/antitoxin pair MqsR/MqsA regulate toxin CspD
Kim, Environmental microbiology 2010 - “...potential Metabolism related gltL b0652 4.0 1.1 1.1 ATP-binding protein of glutamate/aspartate transport system gltK b0653 5.3 1.1 1.1 Glutamate/aspartate transport system permease gltJ b0654 6.5 1.1 1.0 Glutamate/aspartate transport system permease gltI b0655 4.9 2.0 1.2 Putative periplasmic binding transport protein putA b1014 2.0 6.1...”
- Sulfur and nitrogen limitation in Escherichia coli K-12: specific homeostatic responses
Gyaneshwar, Journal of bacteriology 2005 - “...J contained four genes regulated by NtrC/Nac (b0652, b0653, b2309, and b2310), three trp biosynthetic genes (b1260, b1261, and b1263), and six arg biosynthetic...”
- RcsB contributes to the distinct stress fitness among Escherichia coli O157:H7 curli variants of the 1993 hamburger-associated outbreak strains
Carter, Applied and environmental microbiology 2012 - “...hisQ hisJ argT oppD dppA ylbB cstA cstC dadA Z0802 Z0803 Z0804 Z1033 Z2223 Z2224 Z2276 Z2277 Z2278 Z2279 Z3010 Z3568 Z3569 Z3570 Z3571 Z3572 Z2022 Z4961 Z0671...”
- Physiological Response of Escherichia coli O157:H7 Sakai to Dynamic Changes in Temperature and Water Activity as Experienced during Carcass Chilling
King, Molecular & cellular proteomics : MCP 2016 - “...ECs3540 , proW / ECs3541 ), transport proteins for charged solutes such as glutamate ( ECs0692 , ECs0693 ), a putrescine transporter ATP-binding subunit ( ECs0935 ) and histidine transport system permease protein ( ECs3192 ). A number of genes involved in DNA metabolism were upregulated,...”
- Differential expression of virulence and stress fitness genes between Escherichia coli O157:H7 strains with clinical or bovine-biased genotypes
Vanaja, Applied and environmental microbiology 2010 - “...regulated (involved in nitrogen metabolism) ECs0169 ECs0504 ECs0505 ECs0692 ECs0693 ECs0889 ECs2784 ECs3194 ECs4091 ECs4790 glnD glnK amtB gltK gltJ glnH nac...”
BC0873 Cystine transport system permease protein from Bacillus cereus ATCC 14579
33% identity, 83% coverage
CT129 ABC Amino Acid Transporter Permease from Chlamydia trachomatis D/UW-3/CX
32% identity, 86% coverage
LSA_RS06720 amino acid ABC transporter permease from Fructilactobacillus sanfranciscensis TMW 1.1304
27% identity, 85% coverage
SGO_1037 glutamine ABC transporter permease and substrate binding protein from Streptococcus gordonii str. Challis substr. CH1
30% identity, 44% coverage
- Potential of Prebiotic D-Tagatose for Prevention of Oral Disease
Mayumi, Frontiers in cellular and infection microbiology 2021 - “...S. oralis , the polar amino acid transporter gene (SOR_1115) was up-regulated, whereas SMU_1179c and SGO_1037, orthologous genes of SOR_1115, were down-regulated. These gene expression changes may trigger changes in BCAAs and alanine pools, since glutamate and its substrate glutamine are polar amino acids, and streptococci...”
- Streptococcus gordonii Type I Lipoteichoic Acid Contributes to Surface Protein Biogenesis
Lima, mSphere 2019 - “...Foldase protein GlcK SGO_1144 Glucokinase GdhA SGO_0276 Glutamate dehydrogenase SGO_1036 Glutamine transport system ATP-binding protein SGO_1037 Glutamine transport system substrate-binding protein Gap SGO_0207 Glyceraldehyde 3-phosphate dehydrogenase SGO_0390 Glycerol-3-phosphate dehydrogenase SGO_0164 Glycerol-3-phosphate dehydrogenase SGO_0832 Hypothetical protein SGO_1065 Hypothetical protein SGO_1677 Hypothetical protein SGO_0378 Hypothetical protein SGO_1232 l...”
- Mass Spectrometric Analysis of Whole Secretome and Amylase-precipitated Secretome Proteins from Streptococcus gordonii.
Maddi, Journal of proteomics & bioinformatics 2014 - “...protein domain n 76 3 5.2 Glutamine ABC transporter permease and substrate binding protein * SGO_1037 ABC transporter 53 3 6.4 Thioredoxin family protein SGO_1171 Thioredoxin 18 3 31.2 D-Alanyl-D-Alanine carboxypeptidase * SGO_1585 D-alanyl-D-alanine carboxypeptidase 51 3 6.7 5-nucleotidase, lipoprotein * SGO_1860 Haloaciddehalogenase-like hydrolases 32 3...”
GBAA_0856 amino acid ABC transporter permease from Bacillus anthracis str. 'Ames Ancestor'
33% identity, 83% coverage
GLNP_BACSU / O34606 Probable glutamine ABC transporter permease protein GlnP from Bacillus subtilis (strain 168) (see paper)
30% identity, 90% coverage
- function: Part of the ABC transporter complex GlnHMPQ involved in glutamine transport. Probably responsible for the translocation of the substrate across the membrane (By similarity).
subunit: The complex is composed of two ATP-binding proteins (GlnQ), two transmembrane proteins (GlnM and GlnP) and a solute-binding protein (GlnH).
SSA_1359 Arginine/histidine ABC transporter, permease component, putative from Streptococcus sanguinis SK36
30% identity, 29% coverage
Q9KKR2 Amino acid ABC transporter, permease protein from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 79% coverage
- Comparative genome analysis of non-toxigenic non-O1 versus toxigenic O1 Vibrio cholerae.
Mukherjee, Genomics discovery 2014 - “...Transport ATP-binding protein CydC VC_1180 Q9KSS6 OSU_2737 L1QVL8 Amino acid ABC transporter, permease proteint VC_A1040 Q9KKR2 OSU_1389 L1QY57 Peptide ABC transporter, permease protein, putative VC_A0590 Q9KLZ9 OSU_0554 L1R1Z6 Multidrug transporter, putative VC_1391 Q9KS68 OSU_2315 L1QVM0 Thiamin ABC transporter, periplasmic thiamin-binding protein VC_2539 Q9KP40 OSU_1094 L1QYM0 Cbb3-type...”
SEN0632 glutamate/aspartate transport system permease protein GltK from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
29% identity, 94% coverage
- Global transcriptomic analysis of ethanol tolerance response in Salmonella Enteritidis
He, Current research in food science 2022 - “...SEN1292 oppD 2.08 Oligopeptide transporter ATP-binding protein SEN0634 gltI 3.30 Glutamate and aspartate transporter subunit SEN0632 gltK 2.44 Glutamate/aspartate transport system permease GltK SEN0633 gltJ 2.31 Glutamate/aspartate transport system permease GltJ SEN0199 fhuB 3.21 Iron-hydroxamate transporter permease subunit SEN0197 fhuC 2.55 Iron-hydroxamate transporter ATP-binding subunit SEN0198...”
VpaChn25_2987 amino acid ABC transporter permease from Vibrio parahaemolyticus
32% identity, 78% coverage
VP0007 amino acid ABC transproter, permease protein from Vibrio parahaemolyticus RIMD 2210633
32% identity, 78% coverage
- Molecular analysis of the emergence of pandemic Vibrio parahaemolyticus
Boyd, BMC microbiology 2008 - “...file 4 ). VPaI-9 is a 22 kb region integrated between homologues of VP0006 and VP0007. VPaI-9 encodes an integrase, an excisionase, a helicase and a type I restriction modification system. ORFs VP1386 to VP1420 are absent from AQ3810. This regions encodes T6SS (ORFs VP1401 to...”
TC 3.A.1.3.18 / Q8YPM8 NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (see paper)
alr4165 permease protein of amino acid ABC transporter from Nostoc sp. PCC 7120
35% identity, 69% coverage
- substrates: Amino acids
- Amino Acid Transporters and Release of Hydrophobic Amino Acids in the Heterocyst-Forming Cyanobacterium Anabaena sp. Strain PCC 7120
Pernil, Life (Basel, Switzerland) 2015 - “...N-II 3.A.1.3 Asp , Glu, Asn, alr4164 natF PSB [ 28 ] Gln, Met, Thr, alr4165 natG TM Ala, Ser, Gly, alr4166 natH TM His alr4167 bgtA ATPase Bgt 3.A.1.3 Lys , Arg , Orn, alr4167 bgtA ATPase [ 28 ] His, Gln alr3187 bgtB PSB...”
- “...cluster of four genes: natF ( alr4164 ) encodes a periplasmic substrate-binding protein, natG ( alr4165 ) and natH ( alr4166 ) encode transmembrane (permease) proteins, and bgtA ( alr4167 ) encodes an ATPase [ 28 ]. The third one, the system Bgt, is the product...”
- Functional Dependence between Septal Protein SepJ from Anabaena sp. Strain PCC 7120 and an Amino Acid ABC-Type Uptake Transporter
Escudero, Journal of bacteriology 2015 - “...natH bgtA bgtB all1046 alr1834 all1047 all1248 all2912 alr4164 alr4165 alr4166 alr4167 alr3187 1893 1861 1894 2177 0815 0246 0247 0248 0249 0248 e96 e109 e99...”
TcyL / b1918 cystine ABC transporter membrane subunit (EC 7.4.2.12) from Escherichia coli K-12 substr. MG1655 (see 6 papers)
tcyL / P0AFT2 cystine ABC transporter membrane subunit (EC 7.4.2.12) from Escherichia coli (strain K12) (see 3 papers)
TCYL_ECOLI / P0AFT2 L-cystine transport system permease protein TcyL from Escherichia coli (strain K12) (see 5 papers)
TC 3.A.1.3.10 / P0AFT2 Inner membrane amino-acid ABC transporter permease protein YECS CysY aka B1918, component of Cystine/cysteine/diaminopimelate transporter, CysXYZ; these proteins are also designated FliY/YecS/YecC from Escherichia coli (see 4 papers)
S2057 putative transport system permease protein (former yecC) from Shigella flexneri 2a str. 2457T
UTI89_C2119 putative transport system permease protein from Escherichia coli UTI89
b1918 predicted transporter subunit: membrane component of ABC superfamily from Escherichia coli str. K-12 substr. MG1655
31% identity, 85% coverage
- function: Part of the ABC transporter complex TcyJLN involved in L- cystine import (PubMed:20351115, PubMed:25139244, PubMed:25837721, PubMed:26350134). This high affinity cystine transporter is involved in resistance to oxidative stress by forming a L-cysteine/L-cystine shuttle system with the EamA transporter, which exports L-cysteine as reducing equivalents to the periplasm to prevent the cells from oxidative stress. Exported L-cysteine can reduce the periplasmic hydrogen peroxide to water, and then generated L-cystine is imported back into the cytoplasm via the TcyJLN complex (PubMed:20351115, PubMed:25837721). Functions at low cystine concentrations (PubMed:26350134). The system can also transport L-cysteine, diaminopimelic acid (DAP), djenkolate, lanthionine, D-cystine, homocystine, and it mediates accumulation of the toxic compounds L- selenaproline (SCA) and L-selenocystine (SeCys) (PubMed:25139244, PubMed:26350134). Responsible for the translocation of the substrate across the membrane (Probable).
subunit: The complex is composed of two ATP-binding proteins (TcyN), two transmembrane proteins (TcyL) and a solute-binding protein (TcyJ).
disruption phenotype: Disruption of the gene decreases uptake of cystine (PubMed:25837721). The tcyL-tcyP double mutant cannot grow in the minimal medium containing L-cystine as a sole sulfur source is completely resistant to both L-selenaproline and L-selenocystine (PubMed:25139244, PubMed:25837721). - substrates: Cystine, DAP
tcdb comment: Note, another transporter is designated CysZ in E. coli (TC# 2.A.121.1.1). CysXYZ also transports the toxic amino acid analogues, L-selenaproline (SCA; L-selenazolidine-4-carboxylic acid) and L-selenocystine (SeCys) (Deutch et al. 2014). FliY binds L-cystine, L-cysteine, and D-cysteine with micromolar affinities, but binding of the L- and D-enantiomers induced different conformational changes in FliY, where the L- enantiomer/SBP complex interacted more efficiently with the YecSC transporter. YecSC has low basal ATPase activity that is moderately stimulated by apo-FliY, more strongly by D-cysteine-bound FliY, and maximally by L-cysteine- or L-cystine-bound FliY (Sabrialabe et al. 2020) - Development and validation of a resistance and virulence gene microarray targeting Escherichia coli and Salmonella enterica
Davis, Journal of microbiological methods 2010 - “.... Seven isolates were assayed twice ( Supplementary Table 1 ), Salmonella enterica serovar Typhimurium S2057 was assayed four times, and E. coli O157:H7 EDL933 ( Perna, et al., 2001 ) was assayed five times by the same technician. These data were used to calculate Kappa...”
- “...EDL933 was 0.67 (0.41, 0.92) and for 4 replicate assays of Salmonella enterica serovar Typhimurium S2057 was 0.83 (0.63, 1.0). 3b. Inter-rater reliability The ICC for all four laboratories over all probes was 0.27 (95% confidence interval (CI) 0.24, 0.29). The Kappa statistic for each laboratory...”
- R-factor cointegrate formation in Salmonella typhimurium bacteriophage type 201 strains
Helmuth, Journal of bacteriology 1981 - “...M346 S2049 S. typhimurium S. typhimurium S2050 S. typhimurium S2057 S. typhimurium S2060 S. typhimurium BB1 E. coli BB4 E. coli BB53 S. typhimurium BB67 S....”
- “...with regard to the plasmid banding pattern. Strains S2049 and S2057 differed from the other strains only in the lack of the 3.2-Md plasmid (Fig. 1, track 3)....”
- Genetic requirements for uropathogenic <i>E. coli</i> proliferation in the bladder cell infection cycle
Mediati, mSystems 2024 - “...2.85E-02 4.48E-01 ( 42 ) UTI89_C0235 aspV Aspartate tRNA 3.28 2.80E-02 4.59E-01 ( 43 ) UTI89_C2119 yecS Cystine ABC transporter integral membrane subunit 2.78 3.24E-02 4.86E-01 This study UTI89_C3724 yrdA -Class carbonic anhydrase (pH regulation) 2.78 3.11E-03 1.35E-01 This study UTI89_C0070 Hypothetical protein 2.57 1.68E-02 3.25E-01...”
- Human body temperature (37degrees C) increases the expression of iron, carbohydrate, and amino acid utilization genes in Escherichia coli K-12
White-Ziegler, Journal of bacteriology 2007 - “...ATP-binding component of a transport system yecS b1918 Putative amino acid transport protein (ABC superfamily, membrane) 5432 J. BACTERIOL. WHITE-ZIEGLER ET...”
- Sulfur and nitrogen limitation in Escherichia coli K-12: specific homeostatic responses
Gyaneshwar, Journal of bacteriology 2005 - “...to be a misnomer (37). ASAP designates fliY, yecS (b1918), and yecC (b1917) components of an ABC transporter and includes yecS and yecC in the operon. ASAP...”
- DNA microarray analyses of the long-term adaptive response of Escherichia coli to acetate and propionate
Polen, Applied and environmental microbiology 2003 - “...Gene Operon organization Function Name Acetate Propionate NaCl b1918 b1919 b1920 yecC b1919 fliY 1 1 1 Putative transport system permease protein Putative...”
MSMEG_2726 glutamate permease from Mycobacterium smegmatis str. MC2 155
32% identity, 88% coverage
- Elucidating the functional role of Mycobacterium smegmatis recX in stress response
Prasad, Scientific reports 2019 - “...CTGGTCGTTATCGGTCGAAT 16S rRNA FP CTGAGATACGGCCCAGACTC 16S rRNA RP CGTCGATGGTGAAAGAGGTT MSMEG_2725 FP ATCGGCTACCAGATCACGTT MSMEG_2725 RP CGCAAAGTTCACGCTGATCA MSMEG_2726 FP CAACCATCCAACTGACGGTG MSMEG_2726 RP TCCCCATCCAGTTCATCACC MSMEG_2720 FP TTTCCTCGCCTGGTTCTTCA MSMEG_2720 RP CGCACCAATACCCTTCGTTC (RP and FP stand for reverse and forward primers respectively). The cDNA synthesis was performed using the following parameters:...”
- “...was performed to verify the authenticity of the amplified product. Similarly, the levels of MSMEG_2725, MSMEG_2726 and MSMEG_2720 ORFs in M . smegmatis mc 2 155 wild-type, recA recX and recX mutant cells were determined by RT-qPCR. Western blot analysis The whole cell lysates of M...”
EF0247 amino acid ABC transporter, amino acid-binding/permease protein from Enterococcus faecalis V583
30% identity, 42% coverage
IUJ47_RS04720 ABC transporter permease subunit from Enterococcus faecalis
30% identity, 42% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...0.253 Phosphate ABC transporter permease subunit PstC IUJ47_RS11400 0.256 Phosphate ABC transporter ATP-binding protein PstB IUJ47_RS04720 0.265 ABC transporter permease subunit IUJ47_RS12860 0.279 Energy-coupling factor transporter transmembrane protein EcfT IUJ47_RS09165 0.282 Carbohydrate ABC transporter permease IUJ47_RS11395 0.285 Phosphate ABC transporter ATP-binding protein PstB IUJ47_RS04685 0.288 Energy-coupling...”
BAD_RS03070 ABC transporter substrate-binding protein/permease from Bifidobacterium adolescentis ATCC 15703
31% identity, 41% coverage
GBAA4375 amino acid ABC transporter, permease protein from Bacillus anthracis str. 'Ames Ancestor'
30% identity, 86% coverage
OEOE_RS03595 ABC transporter substrate-binding protein/permease from Oenococcus oeni PSU-1
28% identity, 41% coverage
- Transcriptomic and Proteomic Analysis of Oenococcus oeni Adaptation to Wine Stress Conditions
Margalef-Català, Frontiers in microbiology 2016 - “.... An example of each profile is shown. Profile I: OEOE_RS07930 (UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase); Profile II: OEOE_RS03595 (amino acid ABC transporter substrate-binding protein); Profile III: OEOE_RS05245 (oligoendopeptidase F); Profile IV: OEOE_RS07040 (glycerol-3-phosphate ABC transporter permease); Profile V: OEOE_RS03155 (F0F1 ATP synthase subunit A); Profile VI: OEOE_RS01045 (PTS...”
W903_RS07235 ABC transporter substrate-binding protein/permease from Streptococcus agalactiae CNCTC 10/84
SAG1466 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus agalactiae 2603V/R
28% identity, 29% coverage
- Nitric Oxide Production and Effects in Group B Streptococcus Chorioamnionitis
Keith, Pathogens (Basel, Switzerland) 2022 - “...YBBM-related iron transporter (fetB) 3.19 4.23 3.71 SAK_RS04085 W903_RS03765 hypothetical protein 3.02 4.18 3.60 SAK_RS07535 W903_RS07235 membrane component of amino acid ABC transporter 3.22 3.47 3.34 SAK_RS07540 W903_RS07240 hypothetical protein 3.22 3.30 3.26 SAK_RS06865 W903_RS06570 5-nucleotidase-related 3.16 3.34 3.25 SAK_RS04495 W903_RS04200 hypothetical protein 2.87 2.25 2.56...”
- Protectome analysis: a new selective bioinformatics tool for bacterial vaccine candidate discovery
Altindis, Molecular & cellular proteomics : MCP 2015 - “...SAG0290, SAG0717, SAG0949, SAG1431, SAG1610, SAG1642, SAG1466 S. aureus: SAOUHSC_00634*, SAOUHSC_02690 GBS: SAG1533, SAG0535, SAG1234, SAG1938 S. aureus:...”
- CsrRS and environmental pH regulate group B streptococcus adherence to human epithelial cells and extracellular matrix
Park, Infection and immunity 2012 - “...Regulatory function Transport and binding proteins Other adhesins sag1007 sag1466 GlnP sag1467 GlnQ sag0765 sag1331 sag1350 sag0971 Sar5 25 4 36 34 8, 28 1, 42...”
- “...1312 1311 F R AAAGGAGTTGCTGAGCGTGT ACCAAAACGACCAGAAGGTG sag1007 sag1466 GlnP 1353 1354 F R TTGCTGCTACTATCGCTCTTTC CTACGACTTGCTTCCATTTGAC sag1467 GlnQ 1389 1390...”
- Transcriptional and proteomic profiles of group B Streptococcus type V reveal potential adherence proteins associated with high-level invasion
Johri, Infection and immunity 2007 - “...SAG1257 SAG1262 SAG1337 SAG1359 SAG1732 SAG1007 SAG1393 SAG1466 SAG1796 Unknown function SAG0019 SAG0306 SAG1186 SAG1381 SAG1628 a Cation-transporting ATPase,...”
- “...SAG1108 SAG1257 SAG1262 SAG1359 SAG0514 SAG1007 SAG1441 SAG1466 SAG1610 SAG1796 Unknown function SAG0019 SAG0306 SAG0886 SAG1186 SAG1350 SAG1126 SAG1381 a...”
D0C805 Glutamate/aspartate transport system permease protein GltK from Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
A6739_RS09455, FQU82_01780, IX87_RS02655, KZA74_10940 amino acid ABC transporter permease from Acinetobacter baumannii
31% identity, 86% coverage
- <i>OmpH</i> is Involved in the Decrease of <i>Acinetobacter baumannii</i> Biofilm by the Antimicrobial Peptide Cec4
Qiu, Drug design, development and therapy 2024 - “...value KEGG-ABC transporter aotQ 1.479873143 0.000332958 glnQ D0C804 1.658356275 0.000395028 gltI D0C807 1.603455392 0.009493657 gltK D0C805 1.45762851 0.000184436 hisM 1.29203391 0.000113647 HMPREF0010_00886 1.189703016 0.001059408 HMPREF0010_01038 1.290063642 0.000108447 HMPREF0010_01713 1.153820896 0.003645927 HMPREF0010_02504 D0CCM4 1.515294175 0.000346461 HMPREF0010_02965 1.034329905 0.001250861 HMPREF0010_03358 1.46539906 0.001734293 HMPREF0010_03359 D0CF29 1.033785341 0.006549767 HMPREF0010_03362 1.095054779...”
- Strategies for Rapid Identification of Acinetobacter baumannii Membrane Proteins and Polymyxin B's Effects
Lu, Frontiers in cellular and infection microbiology 2021 - “...strain AYE to perform the KEGG pathway enrichment. According to the analysis results, D0CAD3 and D0C805 were involved in the ABC transporter pathway while D0CBP8 and D0C805 were involved in the two-component system pathway, indicating the extensive effects of polymyxin B on the membrane proteins of...”
- “...due to the imperfect KEGG pathway database ( A. baumannii strain AYE), only D0CAD3 and D0C805 were involved in the ABC transporter pathway while D0CBP8 and D0C805 were involved in the two-component system pathway. The upstream and downstream genes of the pathway are currently not annotated...”
- DNA damage response coregulator <i>ddrR</i> affects many cellular pathways and processes in <i>Acinetobacter baumannii</i> 17978
Cook, Frontiers in cellular and infection microbiology 2023 - “...NSC KZA74_10790 NSC NSC 38 A1S_1498/KZA74_10910 NSC NSC KZA74_10910 NSC NSC 39 A1S_1492/KZA74_10940 NSC NSC KZA74_10940 NSC NSC 40 A1S_0771/KZA74_14830 NSC R KZA74_14830 NSC NSC 41 A1S_0549/KZA74_15695 NSC NSC KZA74_15695 NSC R 42 A1S_0548/KZA74_15700 NSC NSC KZA74_15700 NSC R 43 A1S_0292/KZA74_16950 NSC NSC KZA74_16950 NSC NSC...”
- Transcriptomic analysis reveals the regulatory role of quorum sensing in the Acinetobacter baumannii ATCC 19606 via RNA-seq
Xiong, BMC microbiology 2022 - “...to be enriched in the two-component system, including FQU82_00307 ( pilS ), FQU82_01779, FQU82_02017, FQU82_01778, FQU82_01780, FQU82_01752, FQU82_02461 ( kdpA ), and FQU82_02460 ( kdpB ). The downregulated DEGs in this pathway included FQU82_02258 ( cydA ), FQU82_02259 ( cydB ), FQU82_02260 ( cydX ), FQU82_02840,...”
- Transcriptome Analysis of Acinetobacter baumannii in Rapid Response to Subinhibitory Concentration of Minocycline
Gao, International journal of environmental research and public health 2022 - “...NADH-azoreductase (A6739_RS08375), TIGR01244 family phosphatase (A6739_RS08405), MBL fold metallo-hydrolase (A6739_RS08410), amino acid ABC transporter permease (A6739_RS09455), APC family permease (A6739_RS11485) and copper resistance protein NlpE (A6739_RS12210) were downregulated. 3.6. Validation of sRNA Fifteen sRNAs, 1248, 5182, 4806, 6534, 6535, 6543, 6544, 1767, 2875, 2876, 3161, 4172,...”
- “...hydrolase, oxidoreductase A6739_RS08410 - 1.273424919 down MBL fold metallo-hydrolase beta-lactamase, protein dimerization, zinc ion binding A6739_RS09455 - 1.043166606 down amino acid ABC transporter permease transmembrane transporter A6739_RS10785 - 1.769148258 up hypothetical protein - A6739_RS11485 plaP 1.747668925 down APC family permease transmembrane transporter A6739_RS11675 - 1.162127898 up...”
- Antimicrobial Peptide Cec4 Eradicates the Bacteria of Clinical Carbapenem-Resistant Acinetobacter baumannii Biofilm
Liu, Frontiers in microbiology 2020 - “...( Table 1 ). The expression of the amino acid ABC transporter permease, ATP-binding proteins (IX87_RS02655, IX87_RS02660, and artP) in the ABC transport system was down-regulated 1.68-fold, 1.61-fold, and 1.66-fold; the MFS transporter (IX87_RS20020) was down-regulated 2.96-fold, and the EamA family transporter (IX87_RS12100) expression was down-regulated...”
- “...log 2 Fold_change Corrected p -value Membrane protein IX87_RS20020 MFS transporter 2.96 2.87 10 4 IX87_RS02655 amino acid ABC transporter permease 1.68 4.86 10 3 artP amino acid ABC transporter ATP-binding protein 1.66 2.30 10 2 IX87_RS02660 amino acid ABC transporter permease 1.61 7.77 10 3...”
SSU1675 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus suis P1/7
SSUBM407_1747 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus suis BM407
B9H01_RS09035 ABC transporter substrate-binding protein/permease from Streptococcus suis
30% identity, 40% coverage
- Identification of conditionally essential genes for Streptococcus suis infection in pigs
Arenas, Virulence 2020 - “...ABC transporter membrane protein 4.2 2.8 4.5 SSU0883 Glutamine ABC transporter, glutamine-binding protein/permease protein 2.2 SSU1675 Glutamine ABC transporter, glutamine-binding protein/permease protein 2.3 SSU1852 Amino acid ABC transporter permease 3.8 2.5 3.7 SSU1662 oppF Oligopeptide transport ATP-binding protein 5.1 SSU1583 manL Mannose-specific phosphotransferase system 7.4 6.2...”
- “...in blood [ 35 ]. Our Tn-Seq approach identified three conditionally essential glutamine transporters (SSU0883, SSU1675, SSU0447) for blood and brain but not for CSF. These observations point out variation in the acquisition of glutamine at different sites of infection. In S. pneumoniae , mutants lacking...”
- Proteomic and Bioinformatic Analysis of Streptococcus suis Human Isolates: Combined Prediction of Potential Vaccine Candidates
Prados, Vaccines 2020 - “...in this last subcategory were found in the six clinical isolates: SSUBM407_0896, SSUBM407_1298, SSUBM407_1682, and SSUBM407_1747. Interestingly, among the LPXTG cell wall proteins, we identified the major pilus protein encoded by the locus SSUBM407_0414 . Pili proteins have been shown previously to be trypsin resistant [...”
- “...family protein SSUBM407_1659 Putative mannose-specific phosphotransferase system (PTS), IID component SSUBM407_1682 Enoyl-CoA hydratase/isomerase family protein SSUBM407_1747 Glutamine ABC transporter, glutamine-binding protein/permease protein SSUBM407_1834 Nicotinamide mononucleotide transporter SSUBM407_1894 ABC transporter ATP-binding membrane protein SSUBM407_1895 ABC transporter ATP-binding membrane protein SSUBM407_1994 Putative beta-glucosidase Membrane proteins (1 TMD) SSUBM407_0010...”
- Transcriptome and metabolome profiling to elucidate the mechanism underlying the poor growth of <i>Streptococcus suis</i> serotype 2 after orphan response regulator CovR deletion
Zong, Frontiers in veterinary science 2023 - “...accuracy of RNA-seq data was validated by performing qRT-PCR on the selected DEGs. Among them, B9H01_RS09035 is glutamine ABC transporter substrate-binding protein; B9H01_RS06585 is glutamine ABC transporter permease; B9H01_RS06580 is glutamine ABC transporter permease; B9H01_RS05040 is peptide ABC transporter ATP-binding protein; B9H01_RS05035 is amino acid ABC...”
- “...1 Primers used in this study. Gene Forward (5 -3 ) Reverse (5 -3 ) B9H01_RS09035 GGGGCTAACAAACAGACT AAGACACCGATGAGGAGA B9H01_RS06585 CCGAGATTATCCGTGGTG GCCTCAAAGTAGCGTCCC B9H01_RS06580 TGCGTCGGACTCTATCAC TGGAAGAATGGTCGGAAT B9H01_RS05040 CCTTCCGTTCAAATGTCG CGTTGCTTCTGACCACCT B9H01_RS05035 CGTTATCGCTACCACAAA ACAGCACCAGCAGAAAGG B9H01_RS01490 TTGGCAGGACATCTATTA AGGAAACGAAACATTACTC B9H01_RS09790 AAATCGGGCAGGCTTACT CCTTACGCATACGGTTGG B9H01_RS06570 TTTTGGGAATCAATAAGGC CGGATAGCATAGCAGGGT B9H01_RS09040 CTCAATCATCGGTTCATC CACGGTAAGTCGTCAAAT 16S rRNA ACTTGAGTGCAGAAGGGGAGAG GCGTCAGTTACAGACCAGAGAGC...”
SSUBM407_0896 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus suis BM407
30% identity, 29% coverage
- Proteomic and Bioinformatic Analysis of Streptococcus suis Human Isolates: Combined Prediction of Potential Vaccine Candidates
Prados, Vaccines 2020 - “...identified. Actually, only four in this last subcategory were found in the six clinical isolates: SSUBM407_0896, SSUBM407_1298, SSUBM407_1682, and SSUBM407_1747. Interestingly, among the LPXTG cell wall proteins, we identified the major pilus protein encoded by the locus SSUBM407_0414 . Pili proteins have been shown previously to...”
- “...SSUBM407_0621 DNA translocase FtsK SSUBM407_0673 Putative glycosyl transferase SSUBM407_0687 Putative sulfatase SSUBM407_0762 Putative membrane protein SSUBM407_0896 Putative glutamine ABC transporter, glutamine-binding protein/permease protein SSUBM407_1196 Putative membrane protein SSUBM407_1297 Putative chain length determinant protein SSUBM407_1298 Integral membrane regulatory protein Wzg SSUBM407_1333 Large-conductance mechanosensitive channel SSUBM407_1406 Putative peptidoglycan...”
SAK_RS07535 ABC transporter substrate-binding protein/permease from Streptococcus agalactiae A909
28% identity, 29% coverage
- Nitric Oxide Production and Effects in Group B Streptococcus Chorioamnionitis
Keith, Pathogens (Basel, Switzerland) 2022 - “...protein YBBM-related iron transporter (fetB) 3.19 4.23 3.71 SAK_RS04085 W903_RS03765 hypothetical protein 3.02 4.18 3.60 SAK_RS07535 W903_RS07235 membrane component of amino acid ABC transporter 3.22 3.47 3.34 SAK_RS07540 W903_RS07240 hypothetical protein 3.22 3.30 3.26 SAK_RS06865 W903_RS06570 5-nucleotidase-related 3.16 3.34 3.25 SAK_RS04495 W903_RS04200 hypothetical protein 2.87 2.25...”
OA04_29540 amino acid ABC transporter permease from Pectobacterium versatile
28% identity, 96% coverage
SSA_1961 Amino acid ABC transporter, amino acid-binding protein/permease protein, putative from Streptococcus sanguinis SK36
29% identity, 41% coverage
DVU2340 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family from Desulfovibrio vulgaris Hildenborough
35% identity, 90% coverage
- Prediction and Characterization of Missing Proteomic Data in Desulfovibrio vulgaris
Li, Comparative and functional genomics 2011 - “...exporter DVU1068 3.92 301.98 x 5.76 270.52 x Branched-chain amino acid ABC transporter, permease proteins DVU2340 6.00 11276.00 x 7.00 11625.00 x Amino acid ABC transporter, permease protein DVU2572 3.19 2831.50 x 5.77 7937.50 x Ferrous iron transport protein A DVU2574 4.62 5005.50 x 8.85 8857.00...”
B9H01_RS05035 ABC transporter substrate-binding protein/permease from Streptococcus suis YS1
SSU0883 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus suis P1/7
30% identity, 29% coverage
- Transcriptome and metabolome profiling to elucidate the mechanism underlying the poor growth of <i>Streptococcus suis</i> serotype 2 after orphan response regulator CovR deletion
Zong, Frontiers in veterinary science 2023 - “...transporter permease; B9H01_RS06580 is glutamine ABC transporter permease; B9H01_RS05040 is peptide ABC transporter ATP-binding protein; B9H01_RS05035 is amino acid ABC transporter permease; B9H01_RS09790 is ABC transporter ATP-binding protein; and B9H01_RS01490, B9H01_RS06570, and B9H01_RS09040 are ABC transporters. To begin, RNA extraction was followed as described in the...”
- “...(5 -3 ) B9H01_RS09035 GGGGCTAACAAACAGACT AAGACACCGATGAGGAGA B9H01_RS06585 CCGAGATTATCCGTGGTG GCCTCAAAGTAGCGTCCC B9H01_RS06580 TGCGTCGGACTCTATCAC TGGAAGAATGGTCGGAAT B9H01_RS05040 CCTTCCGTTCAAATGTCG CGTTGCTTCTGACCACCT B9H01_RS05035 CGTTATCGCTACCACAAA ACAGCACCAGCAGAAAGG B9H01_RS01490 TTGGCAGGACATCTATTA AGGAAACGAAACATTACTC B9H01_RS09790 AAATCGGGCAGGCTTACT CCTTACGCATACGGTTGG B9H01_RS06570 TTTTGGGAATCAATAAGGC CGGATAGCATAGCAGGGT B9H01_RS09040 CTCAATCATCGGTTCATC CACGGTAAGTCGTCAAAT 16S rRNA ACTTGAGTGCAGAAGGGGAGAG GCGTCAGTTACAGACCAGAGAGC Statistical analyses The data in this study were analyzed using SPSS (Version...”
- Identification of conditionally essential genes for Streptococcus suis infection in pigs
Arenas, Virulence 2020 - “...To obtain knockout mutants in S. suis strain 10 (SSU0114, glA , SSU0469, fhs , SSU0883, penA , SSU1501, SSU1869, SSU1940), DNA fragments corresponding to flanking regions of the genes of interest and a spectinomycin-resistance cassette were amplified from chromosomal DNA of S. suis strain 10...”
- “...transporter (Permease) 7.4 6.3 8.1 SSU1865 Metal cation ABC transporter membrane protein 4.2 2.8 4.5 SSU0883 Glutamine ABC transporter, glutamine-binding protein/permease protein 2.2 SSU1675 Glutamine ABC transporter, glutamine-binding protein/permease protein 2.3 SSU1852 Amino acid ABC transporter permease 3.8 2.5 3.7 SSU1662 oppF Oligopeptide transport ATP-binding protein...”
SPy0277 putative glutamine-binding periplasmic protein from Streptococcus pyogenes M1 GAS
28% identity, 41% coverage
- Multilocus analysis of extracellular putative virulence proteins made by group A Streptococcus: population genetics, human serologic response, and gene transcription
Reid, Proceedings of the National Academy of Sciences of the United States of America 2001 - “...spy0843, 694,643-697,669; spy0747, 607,542-610,274; spy0501, 402,159-403,352; spy0277, 241,807-243,375. eAs determined by WIT2 or BLAST analysis. fAmino acid...”
- “...genes assembled randomly in the following order: spy0277, spy1857, spy0501, spy1239, spy1972, spy0843, spy1361, spy0747, spy0872, spy1986, spy1858, and spy2211....”
SM12261_RS05465 ABC transporter substrate-binding protein/permease from Streptococcus mitis NCTC 12261
27% identity, 30% coverage
SPD_1098 amino acid ABC transporter, amino acid-binding protein/permease protein from Streptococcus pneumoniae D39
SP_1241 amino acid ABC transporter, amino acid-binding protein/permease protein from Streptococcus pneumoniae TIGR4
27% identity, 30% coverage
- A Tn-seq Screen of Streptococcus pneumoniae Uncovers DNA Repair as the Major Pathway for Desiccation Tolerance and Transmission
Matthews, Infection and immunity 2021 (secret) - Glutamate Dehydrogenase (GdhA) of Streptococcus pneumoniae Is Required for High Temperature Adaptation
Gazioglu, Infection and immunity 2021 (secret) - Dynamic Pneumococcal Genetic Adaptations Support Bacterial Growth and Inflammation during Coinfection with Influenza
Smith, Infection and immunity 2021 - “...protein SPD_0994 ribF Riboflavin biosynthesis protein RibF SPD_1087 fhs Formate-tetrahydrofolate ligase SPD_1090 Membrane protein, putative SPD_1098 Amino acid ABC transporter, amino acid-binding protein/permease protein SPD_1099 Amino acid ABC transporter, ATP-binding protein SPD_1130 licD2 Phosphotransferase LicD2 SPD_1293 Acetyltransferase, GNAT family protein SPD_1309 pgdA Peptidoglycan GlcNAc deacetylase SPD_1333...”
- Panproteome-wide analysis of antibody responses to whole cell pneumococcal vaccination
Campo, eLife 2018 - “...(0.0460.169) 0.178 (0.1330.387) 0.278 (0.1050.447) 0.495 (0.2580.576) Both GlnPH4 Amino acid ABC transporter permease GlnPH4 SPD_1098 4.006 (3.3444.515) 0.083 (0.0160.317) 0.089 (0.0190.155) 0.154 (0.0060.296) 0.269 (0.1730.367) Linear mixed effects GroEL Chaperonin GroEL SPD_1709 2.252 (1.1293.083) 0.057 (0.1010.010) 0.396 (0.1940.571) 0.068 (0.0330.856) 0.426 (0.1070.963) Both HtrA Surface-associated...”
- Cysteine-Mediated Gene Expression and Characterization of the CmbR Regulon in Streptococcus pneumoniae
Afzal, Frontiers in microbiology 2016 - “...Glutamine synthetase, GlnA -2.7 spd_0449 Hypothetical protein -1.5 spd_0558 Cell wall-associated serine protease, PrtA -4.4 spd_1098 Amino acid ABC transporter, GlnP -1.9 spd_1099 Amino acid ABC transporter, GlnQ -2.0 spd_1402 Non-heme iron-containing ferritin -2.6 spd_1461 Manganese ABC transporter, ATP-binding protein, PsaB -4.0 spd_1462 Manganese ABC transporter,...”
- N-acetylglucosamine-Mediated Expression of nagA and nagB in Streptococcus pneumoniae
Afzal, Frontiers in cellular and infection microbiology 2016 - “...GlnA 3.3 spd_1099 Amino acid ABC transporter, ATP-binding protein 3.3 spd_0447 Transcriptional regulator, GlnR 3.7 spd_1098 Amino acid ABC transporter, amino acid-binding protein 4.4 a Gene numbers refer to D39 locus tags. b D39 annotation (Lanie et al., 2007 ). c Ratio represents the fold increase/decrease...”
- Sialic acid-mediated gene expression in Streptococcus pneumoniae and role of NanR as a transcriptional activator of the nan gene cluster
Afzal, Applied and environmental microbiology 2015 - “...Downregulated genes spd_0334 spd_0447 spd_0448 spd_0901 spd_1098 spd_1099 spd_1158 spd_1514 spd_1515 spd_1516 spd_1956 Ratiob Hypothetical protein Hypothetical...”
- Site-specific contributions of glutamine-dependent regulator GlnR and GlnR-regulated genes to virulence of Streptococcus pneumoniae
Hendriksen, Infection and immunity 2008 - “...SPD_1988 SPD_1994 SPD_0096 SPD_0381 SPD_0448 SPD_0803 SPD_1098 SPD_1099 SPD_1402 SPD_1524 SPD_1526 SPD_1526 SPD_1607 SPD_2068 SP_1986 SP_2031 SP_2036 SP_2125...”
- Lactococcus lactis, an Attractive Cell Factory for the Expression of Functional Membrane Proteins
Frelet-Barrand, Biomolecules 2022 - “...55.5 6 23% [ 60 ] SP_0453 ABC transporter, AA-binding protein/permease protein 57.4 6 <1% SP_1241 ABC transporter, AA-binding protein/permease protein 78.4 3 <1% LacS MFS transporter 56.6 12 S. thermophilus 12% [ 11 ] SfbA/FbaA streptococcal fibronectin-binding protein A 37.8 1 Streptococcus - [ 90...”
- The Effect of Impaired Polyamine Transport on Pneumococcal Transcriptome
Nakamya, Pathogens (Basel, Switzerland) 2021 - “...SP_1870 2.7 <0.0001 Iron-compound ABC transporter SP_1871 SP_1871 2.9 <0.0001 Iron ABC transporter ATP-binding protein SP_1241 SP_1241 3.1 <0.0001 Glutamine transport system substrate-binding SP_1242 SP_1242 3.2 <0.0001 Glutamine transport system ATP-binding protein SP_2087 pstB 41.8 <0.0001 Phosphate ABC transporter ATP-binding protein SP_2085 pstC 37.2 <0.0001 Phosphate...”
- Prediction and Validation of Immunogenic Domains of Pneumococcal Proteins Recognized by Human CD4+ T Cells
van, Infection and immunity 2019 - “...456 94.88 1.51 44 SP_0008 TIGR4 122 Uncharacterized protein Cell membrane 89 89.29 1.25 36 SP_1241 TIGR4 721 Amino acid ABC transporter, amino acid-binding protein Cell membrane 466 53.86 1.33 35 , 36 SP_0468 TIGR4 283 Putative sortase Cell membrane 165 43.68 2.45 36 SP_2204 TIGR4...”
- “...5168 0.73 17 32.05 1.28 96116 AAK YTRAKYYYSKSREKV YTI 97114 1.12 11 15.5 0.45 7 SP_1241 Amino acid ABC transporter, amino acid-binding protein 694720 MYA ILAIFYLVIITLLTRLAKRLE KRI 694711, 703720 1.14 36 66.02 3.45 508531 QNN YKQLLSGLGITLALALIS FAI 508525, 514531 0.93 23 47.43 3.12 123 MKKKFLAFLLILFPIFSLGI AKA...”
- Site-specific contributions of glutamine-dependent regulator GlnR and GlnR-regulated genes to virulence of Streptococcus pneumoniae
Hendriksen, Infection and immunity 2008 - “...spr1961 SP_2157 SP_2160 SP_2166 SP_0100 SP_0418 SP_0502 SP_0910 SP_1241 SP_1242 SP_1572 SP_1714 spr1560 SP_1715 SP_1824 SP_2239 adh2 fucA acp glnA glnP glnQ dpr...”
ACSP50_7166 amino acid ABC transporter permease from Actinoplanes sp. SE50/110
32% identity, 88% coverage
YPTB3955 ABC amino acid transporter, permease subunit from Yersinia pseudotuberculosis IP 32953
30% identity, 85% coverage
YPO4109 putative amino acid transport system permease from Yersinia pestis CO92
YPDSF_3926 amino acid transport system permease from Yersinia pestis Pestoides F
30% identity, 85% coverage
N149_0892 amino acid ABC transporter permease from Campylobacter coli 15-537360
27% identity, 87% coverage
ACIAD2058 glutamate/aspartate transport protein (ABC superfamily, membrane) from Acinetobacter sp. ADP1
30% identity, 86% coverage
SGO_1727 amino acid-binding permease protein from Streptococcus gordonii str. Challis substr. CH1
29% identity, 41% coverage
VC0009 amino acid ABC transproter, permease protein from Vibrio cholerae O1 biovar eltor str. N16961
31% identity, 85% coverage
- Maintenance of chromosome structure in Pseudomonas aeruginosa
Rybenkov, FEMS microbiology letters 2014 - “...cassettes. rH , rpmH; rA , rnpA; yD , yidD; v8 , VC0008; v9 , VC0009; v10 , VC0010; p66 , PA5566; yyB , yyaB; yA , yaaA; yB , yaaB . Fig. 2 A working model of bacterial chromosome. Chromosome structure is stabilized by various...”
AO353_21720 ABC transporter for D-glucosamine, permease component 2 from Pseudomonas fluorescens FW300-N2E3
32% identity, 86% coverage
- mutant phenotype: # Specifically important in nitrogen source D-Glucosamine Hydrochloride; carbon source D-Glucosamine Hydrochloride
OSU_1389 amino acid ABC transporter permease from Vibrio cholerae PS15
30% identity, 79% coverage
- Comparative genome analysis of non-toxigenic non-O1 versus toxigenic O1 Vibrio cholerae.
Mukherjee, Genomics discovery 2014 - “...ATP-binding protein CydC VC_1180 Q9KSS6 OSU_2737 L1QVL8 Amino acid ABC transporter, permease proteint VC_A1040 Q9KKR2 OSU_1389 L1QY57 Peptide ABC transporter, permease protein, putative VC_A0590 Q9KLZ9 OSU_0554 L1R1Z6 Multidrug transporter, putative VC_1391 Q9KS68 OSU_2315 L1QVM0 Thiamin ABC transporter, periplasmic thiamin-binding protein VC_2539 Q9KP40 OSU_1094 L1QYM0 Cbb3-type cytochrome...”
SAG0136 amino acid ABC transporter, amino acid-binding protein/permease protein from Streptococcus agalactiae 2603V/R
29% identity, 41% coverage
- Protectome analysis: a new selective bioinformatics tool for bacterial vaccine candidate discovery
Altindis, Molecular & cellular proteomics : MCP 2015 - “...SAOUHSC_00545* S. aureus: SAOUHSC_01991, SAOUHSC_02699 GBS: SAG0136, SAG0290, SAG0717, SAG0949, SAG1431, SAG1610, SAG1642, SAG1466 S. aureus: SAOUHSC_00634*,...”
spr1120 ABC transporter membrane spanning permease - glutamine transport from Streptococcus pneumoniae R6
27% identity, 30% coverage
- Azithromycin resistance mutations in Streptococcus pneumoniae as revealed by a chemogenomic screen
Gingras, Microbial genomics 2020 - “...regions of genes pertaining to glutamine metabolism. Six different non-synonymous mutations were found in genes spr1120 ( glnP , two mutations) and spr1121 ( glnQ , four mutations) respectively coding for the membrane-spanning and ATP-binding domains of the ATP-binding cassette (ABC) transporter GlnPQ ( Table 4...”
- “...Interestingly, a deletion of one nucleotide in the 35 element of the predicted promoter for spr1120 ( glnP ) was detected in mutants M14 and M21 ( Table 4 , Fig. S1a). From its location the mutation is likely to influence the transcription of the gene...”
- Penicillin induces alterations in glutamine metabolism in Streptococcus pneumoniae
El, Scientific reports 2017 - “...factor IF-3 1.20 spr0864 lguL lactoylglutathione lyase 1.20 spr1012 rplU 50S ribosomal protein L21 1.41 spr1120 glnP e amino acid ABC transporter substrate-binding protein 1.36 spr1121 glnQ e amino acid ABC transporter ATP-binding protein 1.05 spr1144 smf DNA processing protein DprA 1.58 spr1208 hypothetical protein 1.00...”
- A Pneumococcal Protein Array as a Platform to Discover Serodiagnostic Antigens Against Infection
Olaya-Abril, Molecular & cellular proteomics : MCP 2015 - “...SP_0348 (97) spr0043 (85), spr0857 (87) spr0012 (84) spr1120 (89), spr1216 (90), spr1887 (100) SPJ_1852 (96), SPP_0072 (94), spr0601 (98), spr1221 (99), spr1496...”
- Characterization of a glutamate transporter operon, glnQHMP, in Streptococcus mutans and its role in acid tolerance
Krastel, Journal of bacteriology 2010 - “...downregulated expression of the glutamine transporter genes spr1120 and spr1121 (36). Similarly, in S. mutans, acid-induced stress results in decreased activity...”
PP0656 amino acid ABC transporter, permease protein, putative from Pseudomonas putida KT2440
30% identity, 78% coverage
4ymtC / Q8RCC3 Crystal structure of an amino acid abc transporter complex with arginines (see paper)
29% identity, 88% coverage
RT0118 glutamine transport system permease protein GlnP from Rickettsia typhi str. wilmington
29% identity, 87% coverage
- Genome-wide screen for temperature-regulated genes of the obligate intracellular bacterium, Rickettsia typhi
Dreher-Lesnick, BMC microbiology 2008 - “...0.6 (0.3, 0.6, 1.8) RT0473 cysteine desulfurase [Rickettsia typhi str. Wilmington] 0.6 (0.7, 0.7, 0.5) RT0118 glutamine transport system permease protein GlnP [Rickettsia typhi str. Wilmington] 0.6 (0.3, 0.9, 0.4) RT0474 cysteine desulfurase protein IscS/NifS [Rickettsia typhi str. Wilmington] 0.6 (0.4, 0.9, 0.6) Nucleotide transport and...”
- “...R. typhi genes observed to be downregulated in these functional groups (Figure 1 ). Interestingly, RT0118, a gene encoding a glutamate transport system permease protein showed a 1.5 fold downregulation upon the temperature shift (Table 1 ). Bovarnick and Snyder [ 47 ] were the first...”
- Complete genome sequence of Rickettsia typhi and comparison with sequences of other rickettsiae
McLeod, Journal of bacteriology 2004 - “...potassium transporter (RT0798), a glutamine transporter (RT0118, RT0139, and RT0859), a putrescine/ornithine transporter (RT0470), a ribonucleotide transporter...”
STM1952 putative ABC-type amino acid transporter, permease component from Salmonella typhimurium LT2
30% identity, 86% coverage
- Analysis of In Vivo Transcriptome of Intracellular Bacterial Pathogen Salmonella enterica serovar Typhmurium Isolated from Mouse Spleen
Sun, Pathogens (Basel, Switzerland) 2021 - “...], bioA , bioD , ugtl [ 44 , 45 ], ugd [ 46 ], STM1952 , cysH , sspH2 [ 47 ], entC , Fe-S , pqaB [ 48 ]; Antimicrobial resistance protein 3 virK [ 49 ], mig-14 [ 50 ], pagP [ 44...”
- The Rcs phosphorelay system is specific to enteric pathogens/commensals and activates ydeI, a gene important for persistent Salmonella infection of mice
Erickson, Molecular microbiology 2006 - “...STM1515 STM1492 STM3363 STM2311 STM2795 STM1589 STM1284 STM4451 STM0615 STM1952 STM0680 flgD flgB tufA rplP cdh osmY +7.83 1.43 +6.42 1.56 +2.64 1.15 +1.86 1.10...”
A5I0Z1 ABC transporter, permease protein from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
CBO1150 ABC transporter, permease protein from Clostridium botulinum A str. ATCC 3502
29% identity, 96% coverage
SM12261_RS07190 amino acid ABC transporter permease from Streptococcus mitis NCTC 12261
30% identity, 85% coverage
- Human Serum Supplementation Promotes Streptococcus mitis Growth and Induces Specific Transcriptomic Responses
Wei, Microbiology spectrum 2023 - “...ATP-binding protein SM12261_RS07180 3.84 Transporter substrate-binding domain-containing protein SM12261_RS07185 3.32 Amino acid ABC transporter permease SM12261_RS07190 2.83 Amino acid ABC transporter permease Peptide uptake 10 SM12261_RS06745 aliB 1.70 Peptide ABC transporter substrate-binding protein; amiA aliA/B homolog 11 SM12261_RS07850 1.75 Peptide ABC transporter substrate-binding protein (AliB-like ORF2)...”
PP0226 cysteine ABC transporter, permease protein, putative from Pseudomonas putida KT2440
31% identity, 86% coverage
ID870_01670 amino acid ABC transporter permease from Streptococcus agalactiae CJB111
29% identity, 88% coverage
NGO0373 putative ABC transporter, permease protein, amino acid from Neisseria gonorrhoeae FA 1090
25% identity, 86% coverage
- A Novel Platform Using RNA Signatures To Accelerate Antimicrobial Susceptibility Testing in Neisseria gonorrhoeae
Hashemi, Journal of clinical microbiology 2020 (secret) - MpeR regulates the mtr efflux locus in Neisseria gonorrhoeae and modulates antimicrobial resistance by an iron-responsive mechanism
Mercante, Antimicrobial agents and chemotherapy 2012 - “...change Functional classification MpeR repressed NGO0018 NGO0205 NGO0373 NGO0393 NGO0678 NGO0679 NGO0754 NGO0795 NGO0863 NGO0891 NGO0916 NGO1046 NGO1273 NGO1368...”
- “...NGO1770 NGO1780 NGO1809 NGO2013 NGO2014 NGO2094 NGO0018 lolA NGO0373 NGO0393 NGO0678 leuC mobA bfrB NGO0863 NGO0891 sucB clpB NGO1273 mtrF nqrD nqrF grpE...”
- Deep sequencing-based analysis of the anaerobic stimulon in Neisseria gonorrhoeae
Isabella, BMC genomics 2011 - “...transporter, periplasmic binding protein Fur, Lrp oxiA NGO0372 -6.7 -20.0 Bacterial extracellular solute-binding protein FarR NGO0373 -3.7 -11.1 ABC-type arginine transport system, permease component FarR glnQ NGO0374 -2.9 -11.1 ABC-type amino acid transporter, ATP-binding protein FarR, FNR citT NGO0377 -5.6 -9.1 Di- and tri-carboxylate transporters (inorganic...”
- “...AmtB nspA NGO0233 -3.4 2.6 Outer membrane protein greB NGO0262 -4.5 -1.8 Transcription elongation factor NGO0373 -7.4 -2.5 Amino acid ABC transporter, permease protein NGO0377 -7.4 -150.4 Probable transmembrane transport protein cspA NGO0410 -3.6 3.2 Cold shock protein A NGO0492 7.7 1.8 Putative phage associated protein...”
- Phasevarions mediate random switching of gene expression in pathogenic Neisseria
Srikhanta, PLoS pathogens 2009 - “...Cysteine synthase 2.23 4.20 NGO0372 Amino acid ABC transporter, periplasmic binding protein 2.27 5.301.18 3.28 NGO0373 Amino acid ABC transporter, permease protein 3.01 7.240.588 5.47 NGO0374 Amino acid ABC transporter, ATP-binding protein 2.81 3.830.616 7.14 NGO0656 oxalate/formate antiporter 2.39 3.040.708 6.04 NGO0655 Exodeoxyribonuclease VII, large subunit...”
AO356_00470 ABC transporter for D-Glucosamine, permease component 1 from Pseudomonas fluorescens FW300-N2C3
Pf6N2E2_2051 ABC transporter for D-Glucosamine Hydrochloride, permease component 1 from Pseudomonas fluorescens FW300-N2E2
32% identity, 84% coverage
- mutant phenotype: Specific phenotypes on D-Glucosamine Hydrochloride. Detrimental on D-serine as N source
- mutant phenotype: Specific phenotypes on D-Glucosamine Hydrochloride.
A1S_1492 glutamate/aspartate transport protein from Acinetobacter baumannii ATCC 17978
32% identity, 79% coverage
ARGU_CORGL / Q8NQU3 Arginine transport system permease protein ArgU from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
39% identity, 49% coverage
- function: Part of the ABC transporter complex ArgTUV involved in L- arginine import (PubMed:37061714). May also transport L-citrulline (PubMed:37061714). Probably responsible for the translocation of the substrate across the membrane (Probable).
subunit: The complex is probably composed of two ATP-binding proteins (ArgV), two transmembrane proteins (ArgU) and a solute-binding protein (ArgT).
disruption phenotype: Deletion of argTUV in an L-arginine producer strain results in a faster and 24% higher L-arginine production in comparison to the parental strain.
NMB0788 amino acid ABC transporter, permease protein from Neisseria meningitidis MC58
25% identity, 85% coverage
- The Meningococcal Cysteine Transport System Plays a Crucial Role in Neisseria meningitidis Survival in Human Brain Microvascular Endothelial Cells
Takahashi, mBio 2018 - “...MC58 ( 41 ). In the present study, NMB0787 (amino acid ABC transporter substrate-binding protein), NMB0788 (amino acid ABC transporter permease), and NMB0789 (amino acid ABC transporter ATP-binding protein) were renamed cysteine-binding protein ( cbp ), cysteine transporter permease ( ctp ), and cysteine ATP-binding protein...”
- Metabolism and virulence in Neisseria meningitidis
Schoen, Frontiers in cellular and infection microbiology 2014 - “...( proC, putA ), and of a number of genes for amino acid transporters (NMB0787, NMB0788, NMB2031). Other major groups of metabolic genes essential for growth in serum were those involved in the synthesis of folic acid, pantothenate and pyridine, purines as well as genes required...”
- Interrogation of global mutagenesis data with a genome scale model of Neisseria meningitidis to assess gene fitness in vitro and in sera
Mendum, Genome biology 2011 - “...acquisition ( exbBD, tonB, fetC, fbpB, lbpA ), a number of amino acid transporters (NMB0787, NMB0788, NMB2031), and lactate permease (NMB0543), a gene known to be required for fitness when N. meningitidis is grown on nasopharyngeal explants [ 2 ]. Several genes of central carbon metabolism...”
- Role of Hfq in iron-dependent and -independent gene regulation in Neisseria meningitidis
Mellin, Microbiology (Reading, England) 2010 - “...protein secretion 1.97 2.55 1.57 1.39 NMB0787 Amino acid ABC transporter 2.16 3.01 1.22 1.17 NMB0788 Amino acid ABC transporter 1.90 2.64 1.30 1.10 NMB0881 cysT Sulfate ABC transporter 7.29 4.69 1.93 3.05 NMB1017 sbp Sulfate ABC transporter 8.12 6.30 2.59 1.27 NMB1315 uraA Uracil permease...”
- Transcriptome analysis of Neisseria meningitidis during infection
Dietrich, Journal of bacteriology 2003 - “...12, 2017 by University of California, Berkeley NMB0788 NMB0880 NMB0881 NMB1017 NMB1728 NMB1888 NMB1998 Transcription NMB0126 NMB0132 NMB0617 Metabolism NMB0678...”
- “...NMB0177, NMB0328, NMB0517, NMB0617, NMB0700, NMB0787, NMB0788, NMB0880, NMB0881, NMB0977, NMB0994, NMB0995, NMB1017, NMB1377, NMB1845, NMB1857, and NMB1940....”
- Analysis of the heat shock response of Neisseria meningitidis with cDNA- and oligonucleotide-based DNA microarrays
Guckenberger, Journal of bacteriology 2002 - “...NMB0187 NMB0535 NMB0565 NMB0567 NMB0568 NMB0623 NMB0787 NMB0788 NMB0838 NMB0960 NMB1343 NMB1669 NMB1808 NMB1809 NMB1810 NMB1811 NMB1812 NMB1933 NMB1936 NMB1937...”
OG1RF_10895 amino acid ABC transporter permease from Enterococcus faecalis OG1RF
EF1117 amino acid ABC transporter, permease protein from Enterococcus faecalis V583
29% identity, 85% coverage
- Enterococcus faecalis Adapts to Antimicrobial Conjugated Oligoelectrolytes by Lipid Rearrangement and Differential Expression of Membrane Stress Response Genes
Chilambi, Frontiers in microbiology 2020 - “...these gene loci was measured. However, the transposon mutants of ABC transporters encoded by OG1RF_12536, OG1RF_10895, OG1RF_10896, OG1RF_10760, and OG1RF_10368 did not show any changes in susceptibility despite being differentially expressed in the transcriptomic analysis. The results seem to show that both COEs compromise the membrane...”
- Sortase-Dependent Proteins Promote Gastrointestinal Colonization by Enterococci
Banla, Infection and immunity 2019 (secret) - Examination of Enterococcus faecalis Toxin-Antitoxin System Toxin Fst Function Utilizing a Pheromone-Inducible Expression Vector with Tight Repression and Broad Dynamic Range
Weaver, Journal of bacteriology 2017 - “...FWD EF1017 REV EF3110 FWD EF3110 REV EF0417 FWD EF0417 REV EF1117 FWD EF1117 REV EF1304 FWD EF1304 REV EF0758 FWD EF0758 REV EF0938 FWD EF0938 REV 16S rRNA FWD...”
- “...Gene OG1RF_RS03875 OG1RF_RS01655 OG1RF_RS04680 OG1RF_RS05570 (EF1017) (EF0417) (EF1117) (EF1304) 0 0.601 0.019 0.060 0.003 0.063 0.001 0.032 0.001 1 0.356 0.036...”
- A Rex family transcriptional repressor influences H2O2 accumulation by Enterococcus faecalis
Vesić, Journal of bacteriology 2013 - “...between the convergently transcribed genes EF1116 and EF1117. This intergenic region encodes a stem-loop transcriptional terminator (28), and in our constructs...”
- “...The segments that encode portions of the EF1116 and EF1117 genes (820 bp and 760 bp, respectively) were assembled together by restriction digest and PCR into an...”
- AhrC and Eep are biofilm infection-associated virulence factors in Enterococcus faecalis
Frank, Infection and immunity 2013 - “...OG1RF chromosome between the convergently transcribed genes EF1117 and EF1116 (31). The 196-nucleotide intragenic region between EF1117 and EF1116 contains a...”
- “...the p23 promoter and integrated into the chromosome between EF1117 and EF1116 60 This study 25; this study 30 20 20 20 20 20 20...”
- Global transcriptional analysis of the stringent response in Enterococcus faecalis
Gaca, Microbiology (Reading, England) 2012 - “...EF0758 EF0759 EF0807 EF0820 EF0867 EF0891 EF0893 EF0910 EF1117 EF1118 EF1119 EF1120 EF1211 EF1405 EF1413 EF1513 EF1584 EF1585 EF1597 EF1672 EF1681 EF1685 EF1982...”
Cj0940c putative glutamine transport system permease from Campylobacter jejuni subsp. jejuni NCTC 11168
27% identity, 83% coverage
- Hyperosmotic stress response of Campylobacter jejuni
Cameron, Journal of bacteriology 2012 - “...permease kdpB peb1B glnP cj0560 cj0677 cj0921c cj0940c 2.2 2.1 2.2 Surface, polysaccharides, antigens Putative periplasmic protein Major antigenic peptide PEB2...”
- Atypical roles for Campylobacter jejuni amino acid ATP binding cassette transporter components PaqP and PaqQ in bacterial stress tolerance and pathogen-host cell dynamics
Lin, Infection and immunity 2009 - “...jejuni proteins that were previously annotated as GlnP (Cj0940c) and GlnQ (Cj0902) based on slightly higher initial BLAST search homologies (37.5% identity to...”
- “...observations). This is supported by the previous annotation of cj0940c and cj0902 as glnP and glnQ, which, like paqP and paqQ, are present in all sequenced...”
- Explorative multifactor approach for investigating global survival mechanisms of Campylobacter jejuni under environmental conditions
Moen, Applied and environmental microbiology 2005 - “...Cj0820c, fliP; Cj0883c, hypothetical protein Cj0883c gene; Cj0940c, glnP; Cj0952c, putative membrane protein gene; Cj1030c, lepA; Cj1148, waaF; Cj1150c, waaE;...”
IUJ47_RS08600 amino acid ABC transporter permease from Enterococcus faecalis
30% identity, 85% coverage
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...IUJ47_RS11415 0.232 Phosphate ABC transporter substrate-binding protein PstS IUJ47_RS10195 0.232 Peptide ABC transporter substrate-binding protein IUJ47_RS08600 0.236 Amino acid ABC transporter permease IUJ47_RS11410 0.253 Phosphate ABC transporter permease subunit PstC IUJ47_RS11400 0.256 Phosphate ABC transporter ATP-binding protein PstB IUJ47_RS04720 0.265 ABC transporter permease subunit IUJ47_RS12860 0.279...”
LSEI_A10 ABC-type amino acid transport system, permease component from Lactobacillus casei ATCC 334
30% identity, 87% coverage
NMA0999 putative amino acid permease integral membrane protein from Neisseria meningitidis Z2491
25% identity, 85% coverage
SERP2004 amino acid ABC transporter, permease protein from Staphylococcus epidermidis RP62A
30% identity, 80% coverage
- Toxin Mediates Sepsis Caused by Methicillin-Resistant Staphylococcus epidermidis
Qin, PLoS pathogens 2017 - “...keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase -7.46 cysC SERP2185 adenylylsulfate kinase -7.41 - SERP2004 amino acid ABC transporter permease -6.80 lacE SERP1790 PTS system, lactose-specific IIBC components -6.80 - SERP1980 nitrite extrusion protein -5.78 cysI SERP2190 sulfite reductase subunit beta -5.74 lacG SERP1789 6-phospho-beta-galactosidase...”
SP_0607 amino acid ABC transporter, permease protein from Streptococcus pneumoniae TIGR4
30% identity, 85% coverage
- Polyamine Synthesis Effects Capsule Expression by Reduction of Precursors in Streptococcus pneumoniae
Ayoola, Frontiers in microbiology 2019 - “...Description change Peptidoglycan biosynthesis glnH SP_0609 Amino acid ABC transporter, amino acid-binding protein 1.6 glnP SP_0607 Amino acid ABC transporter, permease protein 1.5 glnQ SP_0610 Amino acid ABC transporter, ATP-binding protein 1.7 Asd SP_1013 Aspartate-semialdehyde dehydrogenase 5.4 dapA SP_1014 4-hydroxy-tetrahydrodipicolinate synthase 4.8 lys9 SP_0919 Saccharopine dehydrogenase...”
PP_1299 amino acid ABC transporter permease from Pseudomonas putida KT2440
PP1299 general amino acid ABC transporter, permease protein from Pseudomonas putida KT2440
31% identity, 58% coverage
- Production of selenium nanoparticles occurs through an interconnected pathway of sulphur metabolism and oxidative stress response in Pseudomonas putida KT2440
Avendaño, Microbial biotechnology 2023 - “...selenite the overexpression of transporters related to the uptake of amino acids (operon PP_1297, PP_1298, PP_1299 and PP_1300) and ribose (PP_2456, PP_2455). The differences in expression patterns in membrane proteins can be explained considering that selenite reduction leads to the accumulation of extracellular selenium nanoparticles, which...”
- UEG Week 2023 Poster Presentations
, United European gastroenterology journal 2023 - Comparative transcriptomics and proteomics of p-hydroxybenzoate producing Pseudomonas putida S12: novel responses and implications for strain improvement
Verhoef, Applied microbiology and biotechnology 2010 - “...) PP1298 0.51 d 4.6 General amino acid ABC transporter, permease protein ( aapM ) PP1299 0.70 d 2.9 General amino acid ABC transporter, ATP-binding protein ( aapP ) PP1300 0.56 d 3.0 0.61 2.6 Amino acid transporter, AAT family PP3727 2.5 4.2 Aromatic amino acid...”
CJJ81176_0926 amino acid ABC transporter, permease protein PEB1 from Campylobacter jejuni subsp. jejuni 81-176
Cj0919c putative ABC-type amino-acid transporter permease protein from Campylobacter jejuni subsp. jejuni NCTC 11168
27% identity, 87% coverage
- Metabolic and fitness determinants for in vitro growth and intestinal colonization of the bacterial pathogen Campylobacter jejuni
Gao, PLoS biology 2017 - “...metQ 7.11 0.00 0.91 methionine ABC transporter CJJ81176_0795 metN 6.90 0.01 6.79 methionine ABC transporter CJJ81176_0926 * peb1 7.27 0.00 0.38 amino acid ABC transporter permease protein CJJ81176_0927 * peb1 7.29 0.00 0.60 amino acid ABC transporter permease protein CJJ81176_0928 * pebA 7.40 0.00 0.83 ABC...”
- “...of Asp, Glu, Asn, and Gln [ 29 , 57 ], and its downstream genes (CJJ81176_0926, CJJ81176_0927) led to a significant decrease in colonization ( Fig 4A ). A similarly severe loss of colonization was observed for insertion mutants in paqPQ ( Fig 4A ), which...”
- Survival of Campylobacter jejuni 11168H in Acanthamoebae castellanii Provides Mechanistic Insight into Host Pathogen Interactions
Nasher, Microorganisms 2022 - “...Uncharacterized protein 2.508166 5.98 10 6 Cj1450 ciaI Putative ATP/GTP-binding protein 2.461822 3.79 10 17 Cj0919c Aspartate/glutamate/glutamine transport system permease protein 2.401703 7.08 10 10 Cj0459c Uncharacterized protein 2.291369 5.87 10 13 Cj1075 fliW Flagellar assembly factor 2.260313 3.55 10 8 Cj0018c dba Disulfide bond formation...”
- Survival of Campylobacter jejuni in Acanthamoebae castellanii provides mechanistic insight into host pathogen interactions
Nasher, 2022 - Campylobacter jejuni Demonstrates Conserved Proteomic and Transcriptomic Responses When Co-cultured With Human INT 407 and Caco-2 Epithelial Cells
Negretti, Frontiers in microbiology 2019 - “...utilize each of the four amino acids serine ( sdaC ), aspartate and glutamate [ Cj0919c, Cj0920c, Cj0921c (Peb1A), and Cj0922c (PebC)] ( Stahl et al., 2012 ) and proline ( putA and putP ) were seen to increase from 2.4 to 4 h ( Hofreuter...”
- Transcriptomic Analysis of the Campylobacter jejuni Response to T4-Like Phage NCTC 12673 Infection
Sacher, Viruses 2018 - “...which is essential for growth on glutamate [ 50 ], and the aspartate/glutamate transport genes cj0919c , cj0920c , and peb1A , were all downregulated 1.6- to 2.5-fold by 120 min p.i., as were the proline and serine biosynthesis/transport genes proA , putP , and sdaAC...”
- Cj1199 Affect the Development of Erythromycin Resistance in Campylobacter jejuni through Regulation of Leucine Biosynthesis
Hao, Frontiers in microbiology 2017 - “...in amino acid biosynthesis. The leuABCD genes participated in leucine biosynthesis pathway. Five genes ( Cj0919c, Cj0920c, peb1A, pebC , and ceuC ) encoded transporters or binding proteins. The permease protein (Cj0919c-Cj0920c), substrate-binding protein (Peb1A), and ATP-binding protein (PebC) worked cooperatively in an ABC-type amino acid...”
- “...Gene function Fold change Signal tranduction Cj0246c putative MCP-domain signal transduction protein 0.3624 Transporters/binding proteins Cj0919c putative ABC-type amino-acid transporter permease 0.4997 Cj0922c/pebC amino-acid ABC transporter ATP-binding protein 0.461 Cj0921c/peb1A bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein 0.4597 Cj0920c putative ABC-type amino-acid transporter permease 0.3920 Cj1353/ceuC enterochelin uptake...”
- Comparison of Proteomics Profiles of Campylobacter jejuni Strain Bf under Microaerobic and Aerobic Conditions
Rodrigues, Frontiers in microbiology 2016 - “...up glutamate and aspartate using an ABC transporter system encoded by the peb locus ( cj0919c cj0922c ) (Hofreuter, 2014 ). Some studies have described the periplasmic permease Peb1A as a glutamate- and aspartate-binding protein (Leon-Kempis Mdel et al., 2006 ; Mller et al., 2007 )....”
- Defining the metabolic requirements for the growth and colonization capacity of Campylobacter jejuni
Hofreuter, Frontiers in cellular and infection microbiology 2014 - “...jejuni takes up glutamtate through an ABC transporter system encoded by the peb locus ( cj0919c - cj0922c ) harboring genes for two permeases, one ATP-binding protein and one periplasmic substrate-binding protein Peb1A (Cj0921c). The latter has been first described as surface-bound antigen of C. jejuni...”
- Nutrient acquisition and metabolism by Campylobacter jejuni
Stahl, Frontiers in cellular and infection microbiology 2012 - “...other. Both amino acids are taken up through the Peb1 system, composed of the proteins Cj0919c, Cj0920c, Cj0921c (Peb1A), and Cj0922c (PebC). Work by del Rocio Leon-Kempis et al. ( 2006 ) has confirmed the function of Peb1A as the transporter responsible for most, if not...”
- More
pRL80064 putative permease component of ABC transporter from Rhizobium leguminosarum bv. viciae 3841
32% identity, 62% coverage
- Adaptation of Rhizobium leguminosarum to pea, alfalfa and sugar beet rhizospheres investigated by comparative transcriptomics
Ramachandran, Genome biology 2011 - “...RL2418 (MtlE); CUT2, RL4655 (IntA), RL3840 and RL2720; PepT, pRL110281 and pRL110243; PAAT, pRL80060 and pRL80064; POPT, pRL100248; NitT, RL3721. Asterisks indicate a compound metabolized by an enzyme whose expression is elevated (Figure 2) or, in the case of Nod factor, synthesized for export (Figure 3)....”
BOV_1880 amino acid ABC transporter, permease protein from Brucella ovis ATCC 25840
29% identity, 77% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...IM BMEI0113 BruAb11930 BR1954 BOV_1081 BCAN_A1999 PAO Polar amino acid import BP BMEI0114 BruAb11929 BR1953 BOV_1880 BCAN_A1998 PAO Polar amino acid import BP BOV_1879 90 PAO Arginine/Ornithine biding protein precursor BP BruAb20594 BOV_A0594 PAO Arginine/Ornithine biding protein precursor BP BMEI1022 BruAb20595 BRA0632 BOV_A0593 PAO Arginine/Ornithine biding...”
AKL23_RS07020 ABC transporter substrate-binding protein/permease from Streptococcus thermophilus
29% identity, 27% coverage
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...A9497_04145 AKL23_RS04220 AKL23_RS07755 ATP-binding cassette (ABC) transporter ATP-binding protein A9497_00720 A9497_04150 A9497_03405 A9497_03795 AKL23_RS04215 AKL23_RS07760 AKL23_RS07020 AKL23_RS07405 ABC transporter permease A9497_04155 A9497_03360 A9497_03370 A9497_07620 AKL23_RS07765 AKL23_RS06975 AKL23_RS06985 AKL23_RS06990 ABC transporter substrate-binding protein A9497_03375 A9497_03785 A9497_07595 AKL23_RS07395 AKL23_RS01465 AKL23_RS01490 Amino acid A9497_08630 AKL23_RS02545 Transporter A9497_02760 A9497_03620 A9497_09055...”
BCAN_A1999 amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family from Brucella canis ATCC 23365
29% identity, 77% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEI0112 BruAb11931 BR1955 BOV_1882 BCAN_A2000 PAO Polar amino acid import IM BMEI0113 BruAb11930 BR1954 BOV_1081 BCAN_A1999 PAO Polar amino acid import BP BMEI0114 BruAb11929 BR1953 BOV_1880 BCAN_A1998 PAO Polar amino acid import BP BOV_1879 90 PAO Arginine/Ornithine biding protein precursor BP BruAb20594 BOV_A0594 PAO Arginine/Ornithine biding...”
LBAT_0132 ABC transporter substrate-binding protein/permease from Lactobacillus acetotolerans
27% identity, 38% coverage
SCLAV_4660 amino acid ABC transporter permease from Streptomyces clavuligerus
32% identity, 72% coverage
RSp0480 amino acid ABC transporter permease from Ralstonia pseudosolanacearum GMI1000
29% identity, 83% coverage
- Transcriptomes of Ralstonia solanacearum during Root Colonization of Solanum commersonii
Puigvert, Frontiers in plant science 2017 - “...RSUY_41890 2.99 ybtP ABC transporter ATP-binding protein RSUY_RS15985 RSUY_32660 RSp0078 3.05 MFS transporter RSUY_RS18200 RSUY_37310 RSp0480 3.17 amino acid ABC transporter permease RSUY_RS19050 RSUY_39080 RSp0707 3.19 ABC transporter ATP-binding protein RSUY_RS21055 RSUY_43260 RSp1114 3.35 RND transporter RSUY_RS01890 RSUY_03920 RSc3069 3.50 MFS transporter RSUY_RS22255 RSUY_45730 RSp1595 3.73...”
Pf6N2E2_5404 ABC transporter for D-Alanine, permease component 1 from Pseudomonas fluorescens FW300-N2E2
30% identity, 58% coverage
- mutant phenotype: Specific phenotypes on D-Alanine. Also important for histidine utilization, so this may also take up L-histidine
Synpcc7942_0248 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine from Synechococcus elongatus PCC 7942
32% identity, 50% coverage
EP10_002625 amino acid ABC transporter permease from Geobacillus icigianus
30% identity, 90% coverage
- The Transcriptomic Response of Cells of the Thermophilic Bacterium <i>Geobacillus icigianus</i> to Terahertz Irradiation
Peltek, International journal of molecular sciences 2024 - “...genes encoding transporters of glutamine and other amino acids (EP10_000138, EP10_001536, EP10_002622, EP10_00263, EP10_002624, and EP10_002625). These data indicate the beginning of a recovery of systems responsible for the utilization of amino acids and of other carbon sources from the environment; this is because at the...”
- “...ABC transporter glutamine-binding protein GlnH EP10_002624 1.383302 0.00058 Putative glutamine ABC transporter permease protein GlnM, EP10_002625 1.382731 0.001782 Putative glutamine ABC transporter permease protein GlnP ijms-25-12059-t005_Table 5 Table 5 Genes and operons whose levels of transcription declined 10 min after the end of exposure of G....”
SUB1152 glutamine ABC transporter, glutamine-binding protein/permease protein from Streptococcus uberis 0140J
27% identity, 29% coverage
TC 3.A.1.3.18 / Q8YPM7 NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (see paper)
alr4166 permease protein of amino acid ABC transporter from Nostoc sp. PCC 7120
31% identity, 50% coverage
- substrates: Amino acids
- Amino Acid Transporters and Release of Hydrophobic Amino Acids in the Heterocyst-Forming Cyanobacterium Anabaena sp. Strain PCC 7120
Pernil, Life (Basel, Switzerland) 2015 - “...alr4164 natF PSB [ 28 ] Gln, Met, Thr, alr4165 natG TM Ala, Ser, Gly, alr4166 natH TM His alr4167 bgtA ATPase Bgt 3.A.1.3 Lys , Arg , Orn, alr4167 bgtA ATPase [ 28 ] His, Gln alr3187 bgtB PSB and TM N-III 3.A.1.4 Gly ,...”
- “...( alr4164 ) encodes a periplasmic substrate-binding protein, natG ( alr4165 ) and natH ( alr4166 ) encode transmembrane (permease) proteins, and bgtA ( alr4167 ) encodes an ATPase [ 28 ]. The third one, the system Bgt, is the product of bgtB ( alr3187 ),...”
- Functional Dependence between Septal Protein SepJ from Anabaena sp. Strain PCC 7120 and an Amino Acid ABC-Type Uptake Transporter
Escudero, Journal of bacteriology 2015 - “...bgtA bgtB all1046 alr1834 all1047 all1248 all2912 alr4164 alr4165 alr4166 alr4167 alr3187 1893 1861 1894 2177 0815 0246 0247 0248 0249 0248 e96 e109 e99 e93 e78...”
JJD26997_0895 amino acid ABC transporter, permease protein PEB1 from Campylobacter jejuni subsp. doylei 269.97
27% identity, 87% coverage
- Genetic characterisation of a subset of Campylobacter jejuni isolates from clinical and poultry sources in Ireland
Truccollo, PloS one 2021 - “...study were present in broiler and absent from clinical C . jejuni genomes CJE0998 , JJD26997_0895 , and CJJ81176_1165 , which are involved in adhesion and biofilm formation. Notably, a higher recovery rate of all virulence genes previously amplified by conventional PCR ( dnaJ , racR...”
- “...we found that they had a low prevalence of 9.8% ( CJE0998 ), 12.5% ( JJD26997_0895 ), and 4.5% ( CJJ81176_1165 ) in the clinical isolates from Redondo et al (2019), which reflects that they are likely not essential for human infection, however they were present...”
RSUY_37310, RSUY_RS18200 amino acid ABC transporter permease from Ralstonia solanacearum
29% identity, 83% coverage
- Transcriptomes of Ralstonia solanacearum during Root Colonization of Solanum commersonii
Puigvert, Frontiers in plant science 2017 - “...RSUY_RS20395 RSUY_41890 2.99 ybtP ABC transporter ATP-binding protein RSUY_RS15985 RSUY_32660 RSp0078 3.05 MFS transporter RSUY_RS18200 RSUY_37310 RSp0480 3.17 amino acid ABC transporter permease RSUY_RS19050 RSUY_39080 RSp0707 3.19 ABC transporter ATP-binding protein RSUY_RS21055 RSUY_43260 RSp1114 3.35 RND transporter RSUY_RS01890 RSUY_03920 RSc3069 3.50 MFS transporter RSUY_RS22255 RSUY_45730 RSp1595...”
- “...transporter RSUY_RS20395 RSUY_41890 2.99 ybtP ABC transporter ATP-binding protein RSUY_RS15985 RSUY_32660 RSp0078 3.05 MFS transporter RSUY_RS18200 RSUY_37310 RSp0480 3.17 amino acid ABC transporter permease RSUY_RS19050 RSUY_39080 RSp0707 3.19 ABC transporter ATP-binding protein RSUY_RS21055 RSUY_43260 RSp1114 3.35 RND transporter RSUY_RS01890 RSUY_03920 RSc3069 3.50 MFS transporter RSUY_RS22255 RSUY_45730...”
HSISS4_01405 ABC transporter substrate-binding protein/permease from Streptococcus salivarius
28% identity, 27% coverage
A9497_03405 ABC transporter substrate-binding protein/permease from Streptococcus thermophilus
28% identity, 27% coverage
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...protein Amino acid A9497_00725 A9497_04145 AKL23_RS04220 AKL23_RS07755 ATP-binding cassette (ABC) transporter ATP-binding protein A9497_00720 A9497_04150 A9497_03405 A9497_03795 AKL23_RS04215 AKL23_RS07760 AKL23_RS07020 AKL23_RS07405 ABC transporter permease A9497_04155 A9497_03360 A9497_03370 A9497_07620 AKL23_RS07765 AKL23_RS06975 AKL23_RS06985 AKL23_RS06990 ABC transporter substrate-binding protein A9497_03375 A9497_03785 A9497_07595 AKL23_RS07395 AKL23_RS01465 AKL23_RS01490 Amino acid A9497_08630 AKL23_RS02545...”
BURMUCGD2M_3193 glutamate/aspartate ABC transporter, permease protein GltK from Burkholderia multivorans CGD2M
31% identity, 83% coverage
TC 3.A.1.3.12 / P73544 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter (see paper)
sll1270 glutamine-binding periplasmic protein/glutamine transport system permease protein from Synechocystis sp. PCC 6803
35% identity, 29% coverage
- substrates: Arginine, Glutamine, Histidine, lysine
- Deciphering the genetic landscape of enhanced poly-3-hydroxybutyrate production in Synechocystis sp. B12
Santin, Biotechnology for biofuels and bioproducts 2024 - “...Additional file 1 : Fig. S3A), as well as putative amino acid transporters slr1735 , sll1270 and slr0360 (Additional file 1 : Fig. S3A), inferred by sequence homology, which are often used by organisms as an alternative route to take up N from the external environment...”
- Site-2 Protease Slr1821 Regulates Carbon/Nitrogen Homeostasis during Ammonium Stress Acclimation in Cyanobacterium Synechocystis sp. PCC 6803
Lin, International journal of molecular sciences 2023 - “..., slr1200 , slr1201 ), nitrate/nitrite ( nrtABCD/sll1450-53 ), arginine and glutamine ( bgtB / sll1270 ) were consistently suppressed two to twenty folds, thus implying the effective attenuation of excess nitrogen influx. Similar with the suppression of four nitrate/nitrite transporter subunits ( sll1450-53 ), the...”
- Impact of RNase E and RNase J on Global mRNA Metabolism in the Cyanobacterium Synechocystis PCC6803
Cavaiuolo, Frontiers in microbiology 2020 - “...identified in Houot et al. (2007) and corresponding to slr0737 , sll0427 , slr1756 , sll1270 , slr1200 , sll0108 , sll1196 , and slr0772 were down-regulated in our analysis ( Supplementary Tables S2 , S3 ). A decrease in abundance of certain mRNAs could also...”
- Identification of the direct regulon of NtcA during early acclimation to nitrogen starvation in the cyanobacterium Synechocystis sp. PCC 6803
Giner-Lamia, Nucleic acids research 2017 - “...gdhA glutamate dehydrogenase (NADP+) 0.93 2.1E-03 slr1735 bgtA Component of ABC-type Bgt permease 1.27 1.8E-05 sll1270 bgtB Component of ABC-type Bgt permease 4.19 7.0E-81 Ammonium asimilation sll0108 amt1 ammonium/methylammonium permease 5.32 2.8E-216 sll1017 amt2 ammonium/methylammonium permease 4.12 2.7E-15 Urea assimilation slr0447 urtA Component of ABC-type urea...”
- “...5.141 unknown protein 2390100c N slr0288 glnN 2128602 2128851 promoter 4.643 glutamateammonium ligase 2128736 N sll1270 bgtB 1115933 1116332 promoter 4.195 periplasmic substrate-binding and integral membrane protein of the ABC-type Bgt permease 1116162c N sll1017 amt2 401952 402201 promoter 4.123 ammonium/methylammonium permease 402151 N sll0944 2267152...”
- Proteomic and metabolomic analyses reveal metabolic responses to 3-hydroxypropionic acid synthesized internally in cyanobacterium Synechocystis sp. PCC 6803
Wang, Biotechnology for biofuels 2016 - “...strain, 11 transporters were found up-regulated, including Slr1247, Sll0540, Sll0679, Sll0680, Sll1598, Sll0385, Sll1699, Sll0374, Sll1270, Slr0559 and Slr1201. Phosphorus is necessary to the ATP and NADPH synthesis, and in Synechocystis transporters with three associated Pi-binding proteins (PBPs) have been identified, they are PstS1 (Sll0680), PstS2...”
- “...protein Sll0374, urea transport system permease protein Slr1201, arginine/lysine/histidine/glutamine transport system substrate-binding and permease protein Sll1270 and neutral amino acid transport system substrate-binding protein Slr0559 were also up-regulated, although their roles in metabolic responses to 3-HP synthesis is yet to be established. Cofactors and amino acid...”
- RNA-Seq analysis provides insights for understanding photoautotrophic polyhydroxyalkanoate production in recombinant Synechocystis Sp
Lau, PloS one 2014 - “...301.33 395.05 DNA-binding slr1318 iron(III) dicitrate ABC transporter permease 3.5 4.18 19.17 67.18 80.06 transport sll1270 glutamine ABC transporter 2.52 4.15 91.4 230.36 379.34 amino acid transport sll1405 biopolymer transport protein 2.25 4.02 15.07 33.95 60.53 protein transport slr1693 PatA subfamily protein 3.2 4.02 55.32 177.23...”
- Global transcriptional profiles of the copper responses in the cyanobacterium Synechocystis sp. PCC 6803
Giner-Lamia, PloS one 2014 - “...nitric oxide reductase Transport and binding proteins sll0064 0.18 Putative polar amino acid transport system sll1270 bgtB 0.29 ABC-type Bgt permease for basic amino acids and glutamine slr0415 napA 0.29 Na+/H+ antiporter slr0369 envD 0.28 RND multidrug efflux transporter slr0875 mscL 0.25 Large-conductance mechanosensitive channel slr0096...”
- Global proteomics reveal an atypical strategy for carbon/nitrogen assimilation by a cyanobacterium under diverse environmental perturbations
Wegener, Molecular & cellular proteomics : MCP 2010 - “...up-regulated by fourfold under most conditions. Similarly, BgtB (Sll1270), and to some extent BgtA (Slr1735), the periplasmic and ATP-binding components of an...”
- More
B1745_05185 amino acid ABC transporter permease from Lactobacillus amylolyticus
28% identity, 86% coverage
- Adaptive mechanism of Lactobacillus amylolyticus L6 in soymilk environment based on metabolism of nutrients and related gene-expression profiles
Fei, Food science & nutrition 2022 - “...2.39 B1745_04695 clpP ATPdependent Clp protease proteolytic subunit 2.35 B1745_04960 clpE Clp protease ClpE 2.25 B1745_05185 glnP glutamine ABC transporter permease 2.16 B1745_03105 att amino acid permease 2.14 B1745_00925 oppB peptide ABC transporter substratebinding protein 2.07 B1745_00550 htpX zinc metalloprotease HtpX 1.97 B1745_06070 pepT peptidase T...”
- “...of amino acid transporters to supplement amino acid. A glutamate transporter operon (glnQHMP, glnP , B1745_05185; glnM , B1745_05190; glnH , B1745_05195; glnH , B1745_05195) was highly induced in the logarithmic phase to transport the high concentration of free glutamate from the soymilk into the cell...”
EfmE1162_1760 amino acid ABC transporter permease from Enterococcus faecium E1162
30% identity, 86% coverage
- Functional genomic analysis of bile salt resistance in Enterococcus faecium
Zhang, BMC genomics 2013 - “...deletion mutants and in trans complementation Markerless gene deletion mutants in the gltK gene (locustag: EfmE1162_1760) and the gspA gene (locustag: EfmE1162_1186) were created via the Cre- lox recombination system as previously described [ 22 , 28 ]. Briefly, the 5 and 3 flanking regions (approximately...”
- “...in bile resistance (Additional file 1 and 2 ). A single gene, gltK (locus tag EfmE1162_1760), encoding a putative glutamate/aspartate transport system permease protein, was identified by M-TraM with the highest fold change (11.5 fold, which was notably higher than the other identified genes), indicating that...”
HVX45_RS09410 amino acid ABC transporter permease/ATP-binding protein from Escherichia fergusonii
31% identity, 38% coverage
- OrthoRefine: automated enhancement of prior ortholog identification via synteny
Ludwig, BMC bioinformatics 2024 - “...E . coli genes (b0652, b3271, b4106, & b4096), fives genes from E . fergusonii (HVX45_RS09410, HVX45_RS02390, HVX45_RS04025, HVX45_RS07420, & HVX45_RS11505), two genes from E . marmotae (GV529_RS14465 & GV529_RS05870), and one gene from E . albertii (JRC41_RS15115). Most of the genes were annotated as encoding...”
- “...SOG19.1 which consisted of b3271, HVX45_RS11505, & GV529_RS14465, while excluding b4106, b4096, HVX45_RS02390, HVX45_RS04205, & HVX45_RS09410 as presumed paralogs (Fig. 4 ). The BLAST e-values and percent identity from OrthoFinders alignment supported the presence of these two natural subgroups in HOG19 (Additional file 2 : Table...”
PSA3335_RS09775 amino acid ABC transporter permease from Pseudomonas savastanoi pv. savastanoi NCPPB 3335
31% identity, 58% coverage
A9497_06995 ABC transporter substrate-binding protein/permease from Streptococcus thermophilus
27% identity, 43% coverage
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...transporter permease A9497_04685 A9497_04690 AKL23_RS08280 AKL23_RS08285 Permease A9497_07905 AKL23_RS01770 ABC transporter substrate-binding protein Glutamine A9497_01790 A9497_06995 A9497_00730 AKL23_RS04225 AKL23_RS00860 AKL23_RS05335 ABC transporter substrate-binding protein A9497_01795 A9497_01800 A9497_09175 AKL23_RS05340 AKL23_RS05345 AKL23_RS03035 ABC transporter permease A9497_03790 A9497_09180 AKL23_RS03040 AKL23_RS07400 ABC transporter ATP-binding protein Methionine A9497_07635 AKL23_RS01505 ABC transporter...”
SAEMRSA15_23120 amino acid ABC transporter permease from Staphylococcus aureus subsp. aureus HO 5096 0412
SAR2503 transport system membrane protein from Staphylococcus aureus subsp. aureus MRSA252
30% identity, 80% coverage
- Extensive remodelling of the cell wall during the development of Staphylococcus aureus bacteraemia
Douglas, eLife 2023 - “...Alcohol dehydrogenase 2.257841 NE1147 1196127 SAEMRSA15_10750 yfhO 2.212486 NE1597 408213 SAEMRSA15_03430 guaA 1.876101 N/A 2492381 SAEMRSA15_23120 tcyB 1.645759 NE228 1514441 SAEMRSA15_13420 Hypothetical protein 1.600037 NE1349 2430758 SAEMRSA15_22540 tcaA 1.572702 NE285 134276 SAEMRSA15_01100 Hypothetical protein 1.358386 NE599 b SNP position CC30 locus tag Description Log p-Value NTML...”
- Extensive re-modelling of the cell wall during the development ofStaphylococcus aureusbacteraemia
Douglas, 2023 - Transcriptomic and Metabolomic Analysis of a Fusidic Acid-Selected fusA Mutant of Staphylococcus aureus
Gupta, Antibiotics (Basel, Switzerland) 2022 - “...SAV1380, and SAV1381) were upregulated in SH10001st-2, 8 other genes in this category (SACOL1476, SACOL2453, SAR2503, SAV0722, SAS0283, SAV2412, opuCA , and proP ) were downregulated ( Tables S1 and S2 ). At the same time, there were more amino acid biosynthesis genes downregulated ( argF...”
AKL23_RS00860 ABC transporter substrate-binding protein/permease from Streptococcus thermophilus
27% identity, 43% coverage
- Technological and Genomic Analysis of Roles of the Cell-Envelope Protease PrtS in Yoghurt Starter Development
Tian, International journal of molecular sciences 2018 - “...A9497_04690 AKL23_RS08280 AKL23_RS08285 Permease A9497_07905 AKL23_RS01770 ABC transporter substrate-binding protein Glutamine A9497_01790 A9497_06995 A9497_00730 AKL23_RS04225 AKL23_RS00860 AKL23_RS05335 ABC transporter substrate-binding protein A9497_01795 A9497_01800 A9497_09175 AKL23_RS05340 AKL23_RS05345 AKL23_RS03035 ABC transporter permease A9497_03790 A9497_09180 AKL23_RS03040 AKL23_RS07400 ABC transporter ATP-binding protein Methionine A9497_07635 AKL23_RS01505 ABC transporter ATP-binding protein A9497_07640...”
stu0159 polar amino acid ABC uptake transporter substrate binding protein/membrane-spanning protein from Streptococcus thermophilus LMG 18311
27% identity, 43% coverage
- Transcriptome analysis of adaptive heat shock response of Streptococcus thermophilus
Li, PloS one 2011 - “...3 threonine synthase stu0363 E livF 1.8 3.8 branched-chain amino acid transport system ATP-binding protein stu0159 E - 3.6 3.1 polar amino acid transport substrate-binding protein stu1461 E nifS3 5 3.5 Putative cysteine desulfurase stu0479 C atpB 3.2 3.3 F0F1 ATP synthase stu0478 C atpE 6.3...”
- “...Several genes related to ABC transporters are differentially expressed at 50C. stu0158 (ATP-binding protein) and stu0159 (substrate binding protein), forming an operon involved in polar amino acid transport, are significantly down-regulated more than 2 and 3 folds at 50C, respectively. The three genes associated with branched-chain...”
CD2175 probable amino-acid ABC transporter, permease protein from Clostridium difficile 630
26% identity, 88% coverage
AWY96_RS09810 amino acid ABC transporter permease from Serratia plymuthica
29% identity, 94% coverage
NWMN_2312 amino acid ABC transporter, permease protein from Staphylococcus aureus subsp. aureus str. Newman
Q2FVL3 Amino acid ABC transproter, permease protein, putative from Staphylococcus aureus (strain NCTC 8325 / PS 47)
SAOUHSC_02698 amino acid ABC transproter, permease protein, putative from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_2358 ABC transporter, permease protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
B4602_RS12705, SATW20_25430 amino acid ABC transporter permease from Staphylococcus aureus M1179
30% identity, 80% coverage
- Sulfide Homeostasis and Nitroxyl Intersect via Formation of Reactive Sulfur Species in Staphylococcus aureus
Peng, mSphere 2017 - “...antigen precursor SsaA NWMN_2265 SA2153 5.5 Hypothetical NWMN_2311 SA2200 6.1 ABC transporter: amino acid (ATPase) NWMN_2312 SA2201 5.3 ABC transporter: amino acid (permease) NWMN_2313 SA2202 10.1 ABC transporter: amino acid (substrate binding) NWMN_2317 SA2206 sbi 5.0 Immunoglobulin G-binding protein NWMN_2470 SA2357 5.2 Hypothetical (regulatory protein) NWMN_2472...”
- Antimicrobial Activity and Mechanism of Action of Dracocephalum moldavica L. Extracts Against Clinical Isolates of Staphylococcus aureus
Yu, Frontiers in microbiology 2019 - “...DNA-binding Dps Iron-binding ferritin-like antioxidant Ferroxidase Dps1 5.81 0.000240 Q9EZ11 Dihydrodipicolinate reductase DapB 5.72 0.00 Q2FVL3 Cystine transport system permease TcyB 5.57 0.000234 Q2FW99 PTS system mannitol-specific transporter subunit IIB MtlA 4.88 0.00 Q2FWY4 DASS family divalent anion:sodium (Na+) symporter SdcS 4.68 0.000325 Q2G0Z5 FMN reductase...”
- Antibacterial Components and Modes of the Methanol-Phase Extract from Commelina communis Linn
Liu, Plants (Basel, Switzerland) 2023 - “...protein SAOUHSC_02699 2.762 Conserved hypothetical protein SAOUHSC_02697 2.799 Amino acid ABC transporter ATP-binding protein putative SAOUHSC_02698 2.883 Amino acid ABC transporter permease protein putative SAOUHSC_00176 2.892 Bacterial extracellular solute-binding protein putative SAOUHSC_00423 3.536 Conserved hypothetical protein SAOUHSC_02430 3.658 ABC transporter periplasmic binding protein putative SAOUHSC_01656 4.262...”
- Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways
Falord, PloS one 2011 - “...to sulfonate/nitrate/taurine transport system permease 2.2 7.11E15 SAOUHSC_00367 HP similar to proton/sodium-glutamate symporter 2.2 1.55E15 SAOUHSC_02698 Putative amino acid ABC transporter permease 2.1 3.60E14 SAOUHSC_02773 Putative aminobenzoyl-glutamate transporter 2.1 2.86E13 SAOUHSC_00669* HP similar to Pit family transporter 1.9 2.44E10 SAOUHSC_02699 Putative amino acid ABC transporter ATP-binding...”
- Identification of Methicillin-Resistant Staphylococcus aureus (MRSA) Genetic Factors Involved in Human Endothelial Cells Damage, an Important Phenotype Correlated with Persistent Endovascular Infection
Xiao, Antibiotics (Basel, Switzerland) 2022 - “...4.80 SAUSA300_1968 hypothetical putative phage transcriptional regulator 25.23 9.97 SAUSA300_0642 hypothetical hypothetical protein 25.21 4.58 SAUSA300_2358 hypothetical ABC transporter permease 25.11 6.08 SAUSA300_1984 mroQ hypothetical protein 25.07 9.15 SAUSA300_1266 trpF N-(5-phosphoribosyl)anthranilate isomerase 25.05 7.12 SAUSA300_2251 hypothetical dehydrogenase family protein 25.00 3.65 SAUSA300_0706 hypothetical putative osmoprotectant ABC...”
- Human Urine Alters Methicillin-Resistant Staphylococcus aureus Virulence and Transcriptome
Paudel, Applied and environmental microbiology 2021 (secret) - Combined proteomic and transcriptomic analysis of the antimicrobial mechanism of tannic acid against Staphylococcus aureus
Wang, Frontiers in pharmacology 2023 - “...dehydrogenase complex 0.60 0.52 B4602_RS00640 - WP_000290396.1 Aldehyde dehydrogenase family protein 0.35 0.52 ABC transporter B4602_RS12705 hisM WP_000479576.1 Amino acid ABC transporter, permease protein 0.64 0.36 B4602_RS02155 gmpC WP_000825526.1 Dipeptide ABC transporter glycylmethionine-binding lipoprotein 0.40 0.29 B4602_RS11480 - WP_000989091.1 Branched-chain amino acids transporter, Periplasmic Binding Protein...”
- Mutations upstream of fabI in triclosan resistant Staphylococcus aureus strains are associated with elevated fabI gene expression
Grandgirard, BMC genomics 2015 - “...3.3 SAV2412 / SATW20_25420 / ABC transporter ATP-binding protein 10.1 8.5 16.3 25.5 SAV2413 / SATW20_25430 / ABC transporter permease 6.2 4.9 9.6 18.4 SAV2413 / SATW20_25430 / transport system membrane protein 3.9 3.4 4.7 8.0 SAV2414 / SATW20_25440 / extracellular solute-binding lipoprotein 2.4 2.2 3.1...”
HMPREF1332_03123 amino acid ABC transporter permease from Enterococcus faecalis ERV31
29% identity, 85% coverage
- Differences of protein expression in enterococcus faecalis biofilm during resistance to environmental pressures
Jiang, Technology and health care : official journal of the European Society for Engineering and Medicine 2024 - “...WOK_00999 E2YFG9 ABC transporter, ATP-binding protein HMPREF9493_02321 J6MXR6 Putative glutamine ABC transporter permease protein GlnP HMPREF1332_03123 E2YAV8 ABC transporter, ATP-binding protein HMPREF9493_00680 E2YAV7 Efflux ABC transporter, permease protein HMPREF9493_00679 A0A1G1S9Y6 PTS mannose transporter subunit IID BHU49_07340 A0A449DZ27 PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB FKY84_01780 Figure4. Correlation of...”
BIF_00776 amino acid ABC transporter permease from Bifidobacterium animalis subsp. lactis BB-12
29% identity, 56% coverage
- Updated Genome Sequence for the Probiotic Bacterium Bifidobacterium animalis subsp. lactis BB-12
Jensen, Microbiology resource announcements 2021 - “...1419504 +C Intergenic(+328/+40) BIF_00332 / BIF_02065 1424409 4bp36bp Intergenic(+52/47) BIF_00028 / BIF_00780 1429003 1bp16bp Intergenic(+54/44) BIF_00776 / BIF_01792 1429006 TG Intergenic(+57/41) BIF_00776 / BIF_01792 1429008 CT Intergenic(+59/39) BIF_00776 / BIF_01792 1435740 10bp24bp Intergenic(+33/+22) BIF_00308 / BIF_00385 1435753 CA Intergenic(+46/+18) BIF_00308 / BIF_00385 1442201 +G Intergenic(+56/+22) BIF_00264...”
NH16_RS02995 amino acid ABC transporter permease from Leuconostoc mesenteroides subsp. dextranicum
29% identity, 87% coverage
- Cell-Wall-Degrading Enzymes-Related Genes Originating from Rhizoctonia solani Increase Sugar Beet Root Damage in the Presence of Leuconostoc mesenteroides
Majumdar, International journal of molecular sciences 2022 - “...), translation initiation factor IF-1 ( NH16_RS04570 ), and amino acid ABC transporter permease ( NH16_RS02995 ), etc., ( Table 4 ; Figure 7 A). Examples of genes that were highly downregulated (>2-fold) in the presence of R. solani include amino acid ABC transporter permease (...”
- “...DNA-directed RNA polymerase subunit alpha ( NH16_RS04590 ), and amino acid ABC transporter permease ( NH16_RS02995 ), etc., ( Table S5 ; Figure 7 B). At 3 dpi, highly expressed (FPKM~1200-4000) genes were 50S ribosomal protein L13 ( NH16_RS04635 ), response regulator transcription factor ( NH16_RS02055...”
TCYB_BACSU / P42200 L-cystine transport system permease protein TcyB from Bacillus subtilis (strain 168) (see paper)
TC 3.A.1.3.14 / P42200 TcyB (YckJ), component of Uptake system for L-cystine from Bacillus subtilis (see 4 papers)
28% identity, 85% coverage
- function: Part of the ABC transporter complex TcyABC involved in L- cystine import. Probably responsible for the translocation of the substrate across the membrane (Probable).
subunit: The complex is composed of two ATP-binding proteins (TcyC), two transmembrane proteins (TcyB) and a solute-binding protein (TcyA). - substrates: Cystine
- Identification of nutrient partitioning genes participating in rice grain filling by singular value decomposition (SVD) of genome expression data
Anderson, BMC genomics 2003 - “...Arabidopsis thaliana OS023388_r_at YDEZ_ECOLI P77651 ESCHERICHIA COLI. HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN YDEZ. OS014177_at YCKJ_BACSU P42200 BACILLUS SUBTILIS. PROBABLE AMINO-ACID ABC TRANSPORTER PERMEASE PROTEIN. OS022558_i_at R104_SACPA Q92378 SACCHAROMYCES PARADOXUS (YEAST). MEIOTIC RECOMBINATION PROTEIN REC104. OS012669.1_at gi|3044212| acyl-CoA oxidase [Arabidopsis thaliana] OS013723_at GLGC_BACCL P30522 BACILLUS CALDOLYTICUS. GLUCOSE-1-PHOSPHATE...”
NGO2011 putative ABC transporter, permease protein, amino acid from Neisseria gonorrhoeae FA 1090
31% identity, 83% coverage
- Crystal structures of two solute receptors for L-cystine and L-cysteine, respectively, of the human pathogen Neisseria gonorrhoeae
Bulut, Journal of molecular biology 2012 (PubMed)- “...a cluster including genes encoding two transmembrane subunits (Ngo2011, Ngo2012) and an ATPase component (Ngo2013) of an ABC transporter, Ngo0372 is part of an...”
- Fur-mediated activation of gene transcription in the human pathogen Neisseria gonorrhoeae
Yu, Journal of bacteriology 2012 - “...NGO1842-NGO1841 NGO1850 NGO1851 NGO1859 NGO1865-NGO1864 NGO1913 NGO1937 NGO1957 NGO1960 NGO2011 NGO2068 NGO2116 NGO2137 NGO2162 NC ND ND NC ND ND NA NA NA NA NA...”
- Deep sequencing-based analysis of the anaerobic stimulon in Neisseria gonorrhoeae
Isabella, BMC genomics 2011 - “...-3.6 -6.3 Di- and tri-peptide permease, PRT2 sstT NGO1957 -4.5 -11.1 Sodium/serine symport protein glnM NGO2011 -6.7 -12.5 ABC-type amino acid transport system, permease component MtrR, FarR glnP NGO2012 -10.0 -10.0 ABC-type amino acid transport system, permease component FarR glnQ NGO2013 -6.3 -11.1 ABC-type amino acid...”
- MtrR modulates rpoH expression and levels of antimicrobial resistance in Neisseria gonorrhoeae
Folster, Journal of bacteriology 2009 - “...NGO1699 NGO1738 NGO1741 NGO1742 NGO1749 NGO1751 NGO1765 NGO1890 NGO2011 NGO2013 NGO2014 leuS NGO0018 potH rpoH NGO0302 bioA bioD pdxH NGO0756 brfB umpA NGO0863...”
- Two ABC transporter operons and the antimicrobial resistance gene mtrF are pilT responsive in Neisseria gonorrhoeae
Friedrich, Journal of bacteriology 2007 - “...products of the clusters NGO0372 to NGO0374 and NGO2011 to NGO2014 have highest homology to bacterial transporters that import amino acids, and NGO1368 encodes...”
- “...1. Expression of putative ABC transporter genes (NGO0372, NGO2011, and NGO2014), mtrF, and farR in strain MS11pilT 4 h postinfection. Transcript levels were...”
YhdX / b3269 putative ABC transporter membrane subunit YhdX from Escherichia coli K-12 substr. MG1655 (see 4 papers)
35% identity, 32% coverage
NMB1509 amino acid ABC transporter, permease protein from Neisseria meningitidis MC58
33% identity, 73% coverage
AHA_1687 histidine ABC transporter, permease protein HisM from Aeromonas hydrophila subsp. hydrophila ATCC 7966
30% identity, 85% coverage
- Transcriptome differences between enrofloxacin-resistant and enrofloxacin-susceptible strains of Aeromonas hydrophila
Zhu, PloS one 2017 - “...as AHA_2490 (PI3K-Akt signaling pathway); AHA_2490 (NOD-like receptor signaling pathway); AHA_0608, AHA_2812, AHA_0913, AHA_3728, AHA_1964, AHA_1687, AHA_4285, AHA_1595, and AHA_2813 (ABC transporters) were upregulated, while the AHA_1419 (environmental information processing), AHA_1331 (drug metabolism-cytochrome P450), AHA_2360, AHA_1331 (glycolysis/gluconeogenesis), and AHA_1331 (metabolism of xenobiotics by cytochrome P450) genes...”
Dde_3743 amino acid ABC transporter permease from Desulfovibrio desulfuricans G20
32% identity, 81% coverage
SPO2660 amino acid ABC transporter permease from Ruegeria pomeroyi DSS-3
30% identity, 78% coverage
- Bacterial transcriptional response to labile exometabolites from photosynthetic picoeukaryote Micromonas commoda
Ferrer-González, ISME communications 2023 - “...amino acid ABC transporter, permease SPO2658 AAV95903.1 2.3 possible sulfonate ABC transporter, substrate binding protein SPO2660 AAV95905.1 2.6 possible sulfonate ABC transporter, permease SPO2661 AAV95906.1 2.1 possible sulfonate ABC transporter, ATP binding protein SPO2802 AAV96043.1 2.3 nucleoside ABC transporter, substrate binding protein SPO2803 AAV96044.1 4.1 nucleoside...”
- Diel investments in metabolite production and consumption in a model microbial system
Uchimiya, The ISME journal 2022 - “...Cysteate SPO2658 ABC transporter, periplasmic substrate-binding 22.4 [ 41 ] SPO2659 ABC transporter, permease 38.3 SPO2660 ABC transporter, permease 28.0 SPO2661 ABC transporter, ATP-binding 32.7 Sulfur compound Dihydroxypropane-sulfonate (DHPS) SPO0591 hpsK TRAP transporter 13.0 [ 77 ] SPO0592 hpsL TRAP transporter 32.3 SPO0593 hpsM TRAP transporter...”
- Sulfur metabolites that facilitate oceanic phytoplankton-bacteria carbon flux
Landa, The ISME journal 2019 - “...ATP-binding SPO2661 -3.1 <0.001 -6.3 ABC transporter, permease SPO2660 This study ABC transporter, permease SPO2659 This study <0.001 -8.6 This study <0.001...”
SMb21095 putative amino acid uptake ABC transporter permease protein from Sinorhizobium meliloti 1021
32% identity, 60% coverage
- Absence of functional TolC protein causes increased stress response gene expression in Sinorhizobium meliloti
Santos, BMC microbiology 2010 - “...transporter, permease -15.7 SMb20604 ABC transporter, permease -25.0 SMb20605 ABC transporter, periplasmic solute-binding protein -22.4 SMb21095 ABC transporter, permease -10.3 SMb21096 ABC transporter, permease -10.7 SMb21097 ABC transporter periplasmic solute-binding protein -17.5 SMb21114 Putative nitrate transport protein -10.3 SMb21707 ABC transporter, ATP-binding protein -14.4 SMc01597 Putative...”
- “...and SMc01966) had 5-fold decreases expression while two putative ABC-type transporter systems of unknown function (SMb21095, SMb21096, SMb21097 and SMa0391, SMa0392, SMa0394 and SMa0396) had 10-fold decreased expression in the tolC mutant (Table 2 ). The decreased expression of genes involved in nitrogen-rich compound transport is...”
SPO3041 amino acid ABC transporter permease from Ruegeria pomeroyi DSS-3
30% identity, 83% coverage
GLUC_CORGL / P48244 Glutamate transport system permease protein GluC; Glutamate uptake system protein GluC from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
TC 3.A.1.3.9 / P48244 GluC aka CGL1952, component of Glutamate porter from Corynebacterium glutamicum (Brevibacterium flavum) (see 2 papers)
NCgl1877 glutamate ABC transporter permease GluC from Corynebacterium glutamicum ATCC 13032
cg2138 glutamate permease from Corynebacterium glutamicum ATCC 13032
31% identity, 84% coverage
- function: Part of the ABC transporter complex GluABCD involved in glutamate uptake. Probably responsible for the translocation of the substrate across the membrane.
subunit: The complex is composed of two ATP-binding proteins (GluA), two transmembrane proteins (GluC and GluD) and a solute-binding protein (GluB).
disruption phenotype: Deletion of the gluABCD cluster almost abolishes glutamate uptake activity. - substrates: glutamate
- Anaerobic growth of Corynebacterium glutamicum via mixed-acid fermentation
Michel, Applied and environmental microbiology 2015 - “...Cg2137 NCgl1876 gluB 91 Cg2138 Cg2139 Cg2467 Cg2468 NCgl1877 NCgl1878 NCgl2168 NCgl2169 gluC gluD Cg2470 NCgl2170 ABC transporter for glutamate uptake, secreted...”
- The two-component signal transduction system CopRS of Corynebacterium glutamicum is required for adaptation to copper-excess stress
Schelder, PloS one 2011 - “...glutamate uptake system ATP-binding protein 0.38 cg2137 NCgl1876 gluB secreted glutamate binding protein 0.37 cg2138 NCgl1877 gluC glutamate permease 0.39 cg2181 NCgl1915 ABC-type peptide transport system, secreted component 0.24 cg2182 NCgl1916 ABC-type peptide transport system, permease component 0.22 cg2183 NCgl1917 ABC-type peptide transport system, permease component...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...NCgl0895 NCgl0896 NCgl0897 NCgl1305 NCgl1521 NCgl1875 NCgl1876 NCgl1877 NCgl1878 NCgl1915 NCgl1917 NCgl1918 Acc. no. 2394 SILBERBACH ET AL. APPL. ENVIRON....”
- Anaerobic growth of Corynebacterium glutamicum via mixed-acid fermentation
Michel, Applied and environmental microbiology 2015 - “...name Annotation Reference(s) Cg2137 NCgl1876 gluB 91 Cg2138 Cg2139 Cg2467 Cg2468 NCgl1877 NCgl1878 NCgl2168 NCgl2169 gluC gluD Cg2470 NCgl2170 ABC transporter...”
- The two-component signal transduction system CopRS of Corynebacterium glutamicum is required for adaptation to copper-excess stress
Schelder, PloS one 2011 - “...gluA glutamate uptake system ATP-binding protein 0.38 cg2137 NCgl1876 gluB secreted glutamate binding protein 0.37 cg2138 NCgl1877 gluC glutamate permease 0.39 cg2181 NCgl1915 ABC-type peptide transport system, secreted component 0.24 cg2182 NCgl1916 ABC-type peptide transport system, permease component 0.22 cg2183 NCgl1917 ABC-type peptide transport system, permease...”
- RosR (Cg1324), a hydrogen peroxide-sensitive MarR-type transcriptional regulator of Corynebacterium glutamicum
Bussmann, The Journal of biological chemistry 2010 - “...cg1343 cg1342 cg1341 cg1382 cg1671 cg2136 cg2137 cg2138 cg2139 cg2649 cg2773 Gene H2O2-sensitive Transcriptional Regulator RosR SEPTEMBER 17, 2010 * VOLUME...”
- Functional genomics of pH homeostasis in Corynebacterium glutamicum revealed novel links between pH response, oxidative stress, iron homeostasis and methionine synthesis
Follmann, BMC genomics 2009 - “...0 -1.38 -0.39 -0.6 2.7 1.3 2.4 3.3 3.5 4.9 5.5 5.1 GlxR*, AmtR 68 cg2138 aa gluC ABC-type glutamate transporter, permease component 6 -1.19 -0.33 - - - 1.8 1.3 3.0 - - -0.6 GlxR*, AmtR 69 cg2167 rpsO 30S ribosomal protein S15 0 -1.01...”
- The IclR-type transcriptional repressor LtbR regulates the expression of leucine and tryptophan biosynthesis genes in the amino acid producer Corynebacterium glutamicum
Brune, Journal of bacteriology 2007 - “...cg1419 cg2610 cg3360 cg2837 cg2137 cg2836 cg0303 cg3047 cg2138 cg2559 cg2136 cg0961 cg3096 cg3022 cg2636 cg2118 cg2630 cg1084 cg1615 cg1616 cg2937 cg1617 cg1085...”
- Adaptation of Corynebacterium glutamicum to ammonium limitation: a global analysis using transcriptome and proteome techniques
Silberbach, Applied and environmental microbiology 2005 - “...cg1061 cg1062 cg1064 cg1065 cg1066 cg1537 cg1785 cg2136 cg2137 cg2138 cg2139 cg2181 cg2183 cg2184 Gene name cmTb urtAc urtBc urtCc urtDc urtEc ptsG amtA gluA...”
TC 3.A.1.3.7 / Q52665 BztC, component of Glutamate/glutamine/aspartate/asparagine porter from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (see paper)
30% identity, 47% coverage
- substrates: Asparagine, Glutamine, aspartate, glutamate
SMc02120 ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 from Sinorhizobium meliloti 1021
SMc02120 PROBABLE GENERAL L-AMINO ACID TRANSPORT PERMEASE ABC TRANSPORTER PROTEIN from Sinorhizobium meliloti 1021
30% identity, 45% coverage
- mutant phenotype: Specific phenotypes on L-Glutamine; L-Histidine. Mild phenotypes on proline or lysine
- Quantitative proteomic analysis of the Hfq-regulon in Sinorhizobium meliloti 2011
Sobrero, PloS one 2012 - “...and tripeptides [53] ; all proteins encoded by the aap operon ( aapJQMP ; SMc02121, SMc02120, SMc02119, SMc02118), constitute a high affinity transport system for L-amino acids [41] ; and several genes of the liv operon ( livHMGFK ; SMc01946, SMc01948, SMc01949, SMc01950, SMc01951) [41] ,...”
- Role of the Sinorhizobium meliloti global regulator Hfq in gene regulation and symbiosis
Gao, Molecular plant-microbe interactions : MPMI 2010 - “...c SMc02118 ( aapJ ) 2.2 4.1 0.4 SMc02119 ( aapQ ) 4.1 11.0 0.6 SMc02120 ( aapM ) 4.8 8.4 0.4 SMc01946 ( livK ) 5.5 14.0 0.3 SMc01948 ( livF ) 11.0 11.3 0.3 SMc01949 ( livG ) 10 10.9 0.4 SMc01950 ( livM...”
EAM_RS04295 amino acid ABC transporter permease from Erwinia amylovora ATCC 49946
EAMY_0861 putative ABC transport system, inner membrane component from Erwinia amylovora CFBP1430
32% identity, 85% coverage
BBPR_0671 amino acid ABC transporter permease from Bifidobacterium bifidum PRL2010
28% identity, 56% coverage
- Exploring Amino Acid Auxotrophy in Bifidobacterium bifidum PRL2010
Ferrario, Frontiers in microbiology 2015 - “...was identified in PRL2010 (see Supplementary Table S1 ). Moreover, two putative genes (BBPR_0668 and BBPR_0671) predicted to encode two carriers involved in glutamate transport system (GluA and GluD), exhibited 53 and 26% homology, respectively, with the genes that encode the L -cysteine uptake system of...”
TC 3.A.1.3.17 / Q8YSA2 Basic amino acid uptake transporter, BgtAB (see paper)
alr3187 glutamine-binding periplasmic protein of glutamine ABC transporter from Nostoc sp. PCC 7120
30% identity, 40% coverage
- substrates: Arginine, Histidine, lysine
- Amino Acid Transporters and Release of Hydrophobic Amino Acids in the Heterocyst-Forming Cyanobacterium Anabaena sp. Strain PCC 7120
Pernil, Life (Basel, Switzerland) 2015 - “...Bgt 3.A.1.3 Lys , Arg , Orn, alr4167 bgtA ATPase [ 28 ] His, Gln alr3187 bgtB PSB and TM N-III 3.A.1.4 Gly , Pro, Glu, alr2535 natI PSB This work Phe, Leu, Ala, alr2536 natJ TM Gln alr2538 natK TM alr2539 natL ATPase alr2541 natM...”
- “...[ 28 ]. The third one, the system Bgt, is the product of bgtB ( alr3187 ), which encodes a permease protein with an extended periplasmic domain with homology to substrate binding proteins, and bgtA ( alr4167 ), which encodes an ATPase that is shared with...”
- Functional Dependence between Septal Protein SepJ from Anabaena sp. Strain PCC 7120 and an Amino Acid ABC-Type Uptake Transporter
Escudero, Journal of bacteriology 2015 - “...all1046 alr1834 all1047 all1248 all2912 alr4164 alr4165 alr4166 alr4167 alr3187 1893 1861 1894 2177 0815 0246 0247 0248 0249 0248 e96 e109 e99 e93 e78 e106 e58...”
SCO5774 glutamate permease from Streptomyces coelicolor A3(2)
29% identity, 77% coverage
- Transcriptomic analysis of a classical model of carbon catabolite regulation in Streptomyces coelicolor
Romero-Rodríguez, BMC microbiology 2016 - “...but its function in this phenomenon remains unclear. The genes involved in glutamate incorporation ( SCO5774 - 77 ), encoding GluD, GluC, GluB and GluA, respectively), were strongly stimulated (about 16-fold up-regulation) by glucose (A and B). It was not surprising to find that glucose did...”
- “...involved in transport functions ( SCO2306 , SCO2463 - 2464 , SCO3717 , SCO3719 , SCO5774 - 5777 ) and agar metabolism ( SCO3471 - SCO3485 , SCO3486 - 3487 ). Concerning transport functions, these included genes encoding ABC transporters ( SCO2306 , SCO2463 - 2464...”
RSp1576 amino acid ABC transporter permease from Ralstonia pseudosolanacearum GMI1000
31% identity, 73% coverage
SSA_1569 ABC transporter membrane-spanning permease, arginine/histidine transport, putative from Streptococcus sanguinis SK36
30% identity, 86% coverage
- ciaR impacts biofilm formation by regulating an arginine biosynthesis pathway in Streptococcus sanguinis SK36
Zhu, Scientific reports 2017 - “...argC , argG , argH and argJ ) and two arginine/histidine permease genes (SSA_1568 and SSA_1569) were upregulated in ciaR . In contrast to ciaR , most of strains constructed to contain deletions in each of these genes produced more biofilm and water-insoluble glucan than SK36....”
- “...argC , argG , argH and argJ ) and two arginine/histidine permease genes (SSA_1568 and SSA_1569) was significantly increased in ciaR (Fig. 3C ). ciaR reduces biofilm formation by activating the arginine biosynthesis pathway To further test the hypothesis, eight double mutants ( ciaR combined with...”
- Involvement of signal peptidase I in Streptococcus sanguinis biofilm formation
Aynapudi, Microbiology (Reading, England) 2017 - “...protein Yes SSA_0621 1.592 6.52E-14 SOS responce UmuC protein No SSA_0614 1.595 2.34E-09 Transporter No SSA_1569 1.603 9.98E-11 Arginine/histidine ABC transporter permease No SSA_1568 1.615 2.63E-14 Arginine/histidine ABC transporter permease No SSA_2096 2.016 8.18E-13 ATP-dependent protease, ATP- binding subunit No *Values are SSA _0351:SK36. Cutoff for...”
SSU1852 amino-acid ABC transporter permease protein from Streptococcus suis P1/7
SSU05_2068 ABC-type amino acid transport system, permease component from Streptococcus suis 05ZYH33
B9H01_RS09935 amino acid ABC transporter permease from Streptococcus suis
29% identity, 85% coverage
- Identification of conditionally essential genes for Streptococcus suis infection in pigs
Arenas, Virulence 2020 - “...Glutamine ABC transporter, glutamine-binding protein/permease protein 2.2 SSU1675 Glutamine ABC transporter, glutamine-binding protein/permease protein 2.3 SSU1852 Amino acid ABC transporter permease 3.8 2.5 3.7 SSU1662 oppF Oligopeptide transport ATP-binding protein 5.1 SSU1583 manL Mannose-specific phosphotransferase system 7.4 6.2 SSU0751 potA Part of permidine/putrescine ABC transporter 7.8...”
- Rapid evolution of virulence and drug resistance in the emerging zoonotic pathogen Streptococcus suis
Holden, PloS one 2009 - “...toxin protein + + + + SSU1796 toxin-antitoxin system, antitoxin protein + + + + SSU1852 putative amino-acid ABC transporter permease protein + + + SSU1866 metal cation ABC transporter membrane protein + + + SSU1872 CAAX amino terminal protease family protein + + + SSU1881...”
- Genome-wide analysis of an avirulent strain that induces protective immunity against challenge with virulent Streptococcus suis serotype 2
Wang, BMC microbiology 2017 - “...PSN_CDS01399 SSU05_1663 Muramidase-released protein ( mrp ) PSN_CDS00463* SSU05_0753 Agglutinin receptor PSN_CDS02376 SSU05_0965 Adhesin PSN_CDS04016 SSU05_2068 PSN_CDS00076 SSU05_0112 PSN_CDS00520 SSU05_0330 Autotransporter adhesion PSN_CDS00785 * SSU05_0474 Cell surface factors Extracellular protein factor ( ef ) - SSU05_0177 - SSU05_0178 Exotoxins Hemolysin III homolog PSN_CDS02424 SSU05_0994 Putative hemolysin...”
- Transcriptome and metabolome profiling to elucidate the mechanism underlying the poor growth of <i>Streptococcus suis</i> serotype 2 after orphan response regulator CovR deletion
Zong, Frontiers in veterinary science 2023 - “...acid ABC transporter substrate-binding protein genes (B9H01_RS09940) and the amino acid ABC transporter permease gene (B9H01_RS09935) were downregulated, and the amino acid ABC transporter ATP-binding protein genes (B9H01_RS06570, B9H01_RS09040, and B9H01_RS05040) were upregulated in mutant covR compared to SC19. The amino acid ABC transporter is a...”
Pf1N1B4_3432 ABC transporter for L-Arginine and L-Citrulline, permease component 1 from Pseudomonas fluorescens FW300-N1B4
28% identity, 86% coverage
- mutant phenotype: Specific phenotypes on L-Arginine; L-Citrulline.
PSPTO_1133 amino acid ABC transporter, permease protein from Pseudomonas syringae pv. tomato str. DC3000
30% identity, 89% coverage
BCAN_A0759 amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family from Brucella canis ATCC 23365
BR0744 amino acid ABC transporter, permease protein from Brucella suis 1330
30% identity, 45% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BruAb10762 BR0745 BOV_A0890 BCAN_A0760 PAO General L-amino acid import IM BMEI1209, appM BruAb10758 BR0744 BOV_0739 BCAN_A0759 PAO General L-amino acid import IM BMEI1210, appQ BruAb10760 BR0743 BOV_0737 BCAN_A0758 PAO General L-amino acid import BP BMEI1211, appJ BruAb10761 BR0741 BOV_0738 BCAN_A0756 PAO General L-amino acid import BP...”
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...BMEI1208, appP BruAb10762 BR0745 BOV_A0890 BCAN_A0760 PAO General L-amino acid import IM BMEI1209, appM BruAb10758 BR0744 BOV_0739 BCAN_A0759 PAO General L-amino acid import IM BMEI1210, appQ BruAb10760 BR0743 BOV_0737 BCAN_A0758 PAO General L-amino acid import BP BMEI1211, appJ BruAb10761 BR0741 BOV_0738 BCAN_A0756 PAO General L-amino acid...”
BLGT_07620 amino acid ABC transporter permease from Bifidobacterium longum subsp. longum GT15
30% identity, 56% coverage
- The Gene Expression Profile Differs in Growth Phases of the Bifidobacterium Longum Culture
Veselovsky, Microorganisms 2022 - “...quorum sensing, metabolic pathways, homologous recombination, histidine metabolism and glycerolipid metabolism. The transporters (BLGT_07630, BLGT_07625, BLGT_07620, BLGT_07635, BLGT_07350, BLGT_06730, BLGT_06725, BLGT_06720, BLGT_05680, BLGT_04630, BLGT_04635, BLGT_07550, BLGT_01180), Enzymes (BLGT_03450, BLGT_09605, BLGT_07635), DNA repair and recombination proteins (BLGT_07210), Glycosyltransferases (BLGT_03450). The upregulated genes were classified according to their...”
ID870_05695 amino acid ABC transporter permease from Streptococcus agalactiae CJB111
28% identity, 85% coverage
SAG0715 amino acid ABC transporter, permease protein from Streptococcus agalactiae 2603V/R
28% identity, 85% coverage
MMJJ_04340 amino acid ABC transporter permease from Methanococcus maripaludis
28% identity, 83% coverage
- Proteomic and transcriptomic analysis of selenium utilization in Methanococcus maripaludis
Funkner, mSystems 2024 - “...protein +4.18 0.42 JpST1 MMJJ_09770 Putative 2-aminoethylphosphonate transport system permease protein PhnU +4.13 0.26 JpST1 MMJJ_04340 Inner membrane amino-acid ABC transporter permease protein YecS +3.90 0.39 No MMJJ_00180 Putative permease +3.10 0.35 No MMJJ_07110 Phosphate-binding protein PstS 1 precursor +2.73 0.20 JpST2 MMJJ_13030 Tripartite tricarboxylate transporter...”
EAMY_0862 putative ABC transport system, inner membrane component from Erwinia amylovora CFBP1430
32% identity, 83% coverage
- The stringent response regulator (p) ppGpp mediates virulence gene expression and survival in Erwinia amylovora
Yang, BMC genomics 2020 - “...(ATP-binding cassette) transport systems were up-regulated in the (p) ppGpp 0 mutant. Genes ( metNI, EAMY_0862 , and artPI ) encoded in methionine and arginine import systems were up-regulated in the (p) ppGpp 0 mutant (1.31log 2 FC3.24, 1.33log 2 FC2.24, respectively; Additional file 3 :...”
- “...ATP-binding protein 3.24 9.03 EAMY_2729 metI , methionine ABC transport system 1.31 7.53 Arginine (PAAT) EAMY_0862 ABC-type arginine/histidine transport system, permease component 2.24 3.66 EAMY_1315 artP , arginine ABC transport system 1.67 9.20 EAMY_1314 artI , arginine ABC transport system 1.33 9.86 Other polar amino acid...”
Pden_4924 polar amino acid ABC transporter, inner membrane subunit from Paracoccus denitrificans PD1222
29% identity, 88% coverage
BOV_0738 amino acid ABC transporter, permease protein from Brucella ovis ATCC 25840
30% identity, 45% coverage
- ATP-Binding Cassette Systems of Brucella
Jenner, Comparative and functional genomics 2009 - “...appQ BruAb10760 BR0743 BOV_0737 BCAN_A0758 PAO General L-amino acid import BP BMEI1211, appJ BruAb10761 BR0741 BOV_0738 BCAN_A0756 PAO General L-amino acid import BP BMEII0349, appJ BruAb20285 BRA0948 BOV_0736 BCAN_B0969 92 PAO Arginine BP BMEI1627 BruAb10321 BR0295 BOV_0308 93 PAO Cystine import ABC BMEII0599 BruAb20545 BRA0684 BOV_A0640...”
SPO0521 amino acid ABC transporter permease from Ruegeria pomeroyi DSS-3
29% identity, 53% coverage
- A mutant fitness assay identifies bacterial interactions in a model ocean hot spot
Schreier, Proceedings of the National Academy of Sciences of the United States of America 2023 - “...SPOA0237 C4-dicarboxylate transport transcriptional regulatory protein ( dctD -2) Transporter organic acid 0.27 0.25 0.22 SPO0521 glutamate/glutamine/aspartate/asparagine ABC transporter, permease Transporter N-rich amino acid 0.22 SPO0715 phosphocarrier protein HPr Transporter sugar 1.2 SPOA0249 TRAP dicarboxylate transporter ( dctP ) Transporter organic acid 0.13 SPO1496 ABC transporter,...”
SPD_0412 amino acid ABC transporter, amino acid-binding protein/permease protein from Streptococcus pneumoniae D39
SP_0453 amino acid ABC transporter, amino acid-binding protein/permease protein from Streptococcus pneumoniae TIGR4
30% identity, 41% coverage
- SPD_1495 Contributes to Capsular Polysaccharide Synthesis and Virulence in Streptococcus pneumoniae
Zheng, mSystems 2020 - “...upregulated proteins in D39 spd1495 , such as LacB, LacD, DexB, BglA-1, SPD_0559, SPD_1664, and SPD_0412, formed a small network. These proteins are involved in carbohydrate metabolism, which supplies some of the key raw materials for CPS synthesis, such as ATP and NAD + /NADPH, etc....”
- Panproteome-wide analysis of antibody responses to whole cell pneumococcal vaccination
Campo, eLife 2018 - “...0.047 (0.0940.099) 0.192 (0.0590.274) 0.289 (0.2040.393) 0.770 (0.3361.163) Both GlnPH1 Glutamine ABC transporter permease GlnPH1 SPD_0412 1.029 (0.5731.920) 0.026 (0.0460.169) 0.178 (0.1330.387) 0.278 (0.1050.447) 0.495 (0.2580.576) Both GlnPH4 Amino acid ABC transporter permease GlnPH4 SPD_1098 4.006 (3.3444.515) 0.083 (0.0160.317) 0.089 (0.0190.155) 0.154 (0.0060.296) 0.269 (0.1730.367) Linear...”
- Lactococcus lactis, an Attractive Cell Factory for the Expression of Functional Membrane Proteins
Frelet-Barrand, Biomolecules 2022 - “...[ 7 ] ProWX ABC transporter permease- choline transporter 55.5 6 23% [ 60 ] SP_0453 ABC transporter, AA-binding protein/permease protein 57.4 6 <1% SP_1241 ABC transporter, AA-binding protein/permease protein 78.4 3 <1% LacS MFS transporter 56.6 12 S. thermophilus 12% [ 11 ] SfbA/FbaA streptococcal...”
- A Nonadjuvanted Whole-Inactivated Pneumococcal Vaccine Induces Multiserotype Opsonophagocytic Responses Mediated by Noncapsule-Specific Antibodies
David, mBio 2022 - “...Chaperone protein DnaK (HSP70) 26,577.13844.5 19.8732.69 10.385 SP_0981 prsA Foldase protein PrsA 26,301.472,094.91 27,537.6927.66 0.066 SP_0453 Amino acid ABC transporter, amino acid-binding protein/permease protein 25,945.131,861.6 21,189.931,977.88 0.292 SP_2169 adcA Zinc-binding lipoprotein AdcA 25,479.47491.37 7,189.93965.85 1.825 SP_1032 piaA Iron-compound ABC transporter, iron compound-binding protein 24,388.131,030.42 18,096.271,649.89 0.430...”
- The Influence of B Cell Depletion Therapy on Naturally Acquired Immunity to Streptococcus pneumoniae
Ercoli, Frontiers in immunology 2020 - “...8331,8 2660,3 2366 3549,1 0.011** SP_0148 ABC transporter, substrate-binding protein 5790,6 6701 108,2 95,3 0.034* SP_0453 ATP-binding cassette (Glutamine) 4704,1 7706,9 98 100,9 0.218 SP_1174 Unknown 4627,9 2739,4 31,6 70,7 0.005** SP_1518 mltG Endolytic murein transglycosylase 4595,9 3804 0,6 1,34 0.025* SP_1732 stkP Serine/threonine-protein kinase 2650,9...”
- “...whereas IgG responses to other antigens were much more variable between mice (e.g. Sp_0148 and Sp_0453). B cell depletion decreased levels of specific anti-protein IgG to all antigens detected in untreated colonized mice, although the strength of the effect varied between antigens from approximately 50%95% reductions...”
MSMEG_6307, MSMEI_6142 ABC transporter permease subunit from Mycolicibacterium smegmatis MC2 155
A0R5T7 Glutamine-binding periplasmic protein/glutamine transport system permease protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
MSMEG_6307 glutamine-binding periplasmic protein/glutamine transport system permease protein from Mycobacterium smegmatis str. MC2 155
26% identity, 43% coverage
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...5 0.05 0.03 A0QWJ3 secF , MSMEG_2962, MSMEI_2888 Protein-export membrane protein SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727, MSMEI_2660...”
- “...0.05 0.03 A0QWJ3 secF , MSMEG_2962, MSMEI_2888 Protein-export membrane protein SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727, MSMEI_2660 Glutamate-binding...”
- Elucidating the role of c-di-AMP in Mycobacterium smegmatis: Phenotypic characterization and functional analysis
Chaudhary, Heliyon 2023 - “...transporter permease protein YliD 1.32 0.044 12 MSMEG_0549 ABC transporter, permease protein 1.35 0.040 13 MSMEG_6307 Glutamine-binding periplasmic protein/glutamine transport system permease protein 1.49 0.036 14 MSMEG_1064 Phosphate transporter 1.43 0.039 15 MSMEG_0140 Probable conserved mce associated membrane protein 1.42 0.038 16 MSMEG_0142 Mammalian cell entry...”
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...protein 5 0.05 0.03 A0QWJ3 secF , MSMEG_2962, MSMEI_2888 Protein-export membrane protein SecF 0.02 0 A0R5T7 MSMEG_6307, MSMEI_6142 Glutamine-binding periplasmic protein 0.05 0.06 A0R2C0 sugC , MSMEG_5058, MSMEI_4931 ABC transporter, ATP-binding protein SugC 0.02 0.01 A0QT21 MSMEG_1683, MSMEI_1642 Cytosine/purine/uracil/thiamine/allantoin permease family protein 0.02 0.02 A0QVX3 MSMEG_2727,...”
MMP0551 Binding-protein-dependent transport systems inner membrane component from Methanococcus maripaludis S2
29% identity, 83% coverage
BP0767 glutamate/aspartate transport system permease protein from Bordetella pertussis Tohama I
30% identity, 76% coverage
SCO5775 glutamate permease from Streptomyces coelicolor A3(2)
33% identity, 88% coverage
Rru_A0780 Binding-protein-dependent transport systems inner membrane component from Rhodospirillum rubrum ATCC 11170
39% identity, 30% coverage
SMa0081 putative ABC transporter permease from Sinorhizobium meliloti 1021
30% identity, 83% coverage
LBAT_0326 amino acid ABC transporter permease from Lactobacillus acetotolerans
28% identity, 81% coverage
- Transcriptome responses of Lactobacillus acetotolerans F28 to a short and long term ethanol stress
Yang, Scientific reports 2017 - “...plotted against the qRT-PCR log 2 values. Twenty four genes tested are glnP (LBAT_0325), glnP (LBAT_0326), glnQ , mpg , gltP , dck , adhE , groEL , pyrR (LBAT_1269), uraA (LBAT_1270), whiA , ldhA , LBAT_0175, acm , dnaK , hxlR , LBAT_0555, clpE ,...”
NP_882328 putative amino acid ABC transporter permease protein from Bordetella pertussis Tohama I
BP3830 amino acid ABC transporter permease from Bordetella pertussis Tohama I
31% identity, 59% coverage
BLD_0023 ABC-type amino acid transport system permease component from Bifidobacterium longum DJO10A
30% identity, 56% coverage
spr0623 ABC transporter membrane-spanning permease - glutamine transport from Streptococcus pneumoniae R6
SPD_0617 amino acid ABC transporter, permease protein from Streptococcus pneumoniae D39
28% identity, 72% coverage
- Long Persistence of a Streptococcus pneumoniae 23F Clone in a Cystic Fibrosis Patient
Rieger, mSphere 2017 - “...One gene cluster, SPND122_00705 to SPND122_00709 and SPND141_00707 to SPND141_00711 related to the R6 genes spr0623 to spr062 7 (ABC transporter, lactate monooxygenase, 2-lysyl-tRNA synthetase) were not found in D219. However, since these genes are all located on small contigs, including repeat elements such as BOX...”
- The five homologous CiaR-controlled Ccn sRNAs of Streptococcus pneumoniae modulate Zn-resistance
De, PLoS pathogens 2024 - “...degenerate glutamine ABC transporter subunit 11.6 4.05 SPD_0616 glnQ3 glutamine ABC transporter subunit 8.90 3.07 SPD_0617 glnP3b glutamine ABC transporter subunit 11.1 3.63 SPD_0618 glnP3a glutamine ABC transporter subunit 11.8 2.98 SPD_0775 acetyltransferase 3.29 2.71 SPD_1045 degenerate DUF3884 domain protein 4.73 3.16 SPD_1046 lacG-2 6-phospho--galactosidase 3.56...”
- “...degenerate glutamine ABC transporter subunit 11.6 18.0 SPD_0616 glnQ3 glutamine ABC transporter subunit 8.90 16.8 SPD_0617 glnP3b glutamine ABC transporter subunit 11.1 15.8 SPD_0618 glnP3a glutamine ABC transporter subunit 11.8 15.1 SPD_0681 hypothetical protein 2.82 5.45 SPD_0701 ciaR two-component response regulator 2.72 2.56 SPD_0702 ciaH two-component...”
- Deletion of the Zinc Transporter Lipoprotein AdcAII Causes Hyperencapsulation of Streptococcus pneumoniae Associated with Distinct Alleles of the Type I Restriction-Modification System
Durmort, mBio 2020 - “...binding protein 1.51 2.25 1.25 SPD_0616 glnQ Amino acid ABC transporter ATPase 1.56 2.38 1.13 SPD_0617 glnP Amino acid ABC transporter permease 1.76 2.64 1.25 SPD_0618 glnP Amino acid ABC transporter permease 1.71 2.51 1.20 SPD_0851 pyrK Dihydroorotate dehydrogenase II 1.90 1.90 1.16 SPD_0852 pyrD Dihydroorotate...”
- Cysteine-Mediated Gene Expression and Characterization of the CmbR Regulon in Streptococcus pneumoniae
Afzal, Frontiers in microbiology 2016 - “...ABC transporter substrate-binding protein, authentic truncation 3.2 spd_0616 Amino acid ABC transporter, ATP-binding protein 1.9 spd_0617 Amino acid ABC transporter, permease protein 2.0 spd_0618 Amino acid ABC transporter, permease protein 1.6 spd_1073 O -acetylhomoserine aminocarboxypropyltransferase/cysteine synthase 1.6 spd_1074 Hypothetical protein 1.5 spd_1290 Cystine ABC transporter, permease...”
- Ni2+-Dependent and PsaR-Mediated Regulation of the Virulence Genes pcpA, psaBCA, and prtA in Streptococcus pneumoniae
Manzoor, PloS one 2015 - “...a Function b Ratio c P-value spd_0616 Amino acid ABC transporter, ATP-binding protein -4.40 1.32E-05 spd_0617 Amino acid ABC transporter, permease protein -5.99 7.46E-07 spd_0618 Amino acid ABC transporter, permease protein -6.19 4.27E-07 spd_0558 Cell wall-associated serine protease PrtA 3.02 6.65E-05 spd_1461 Manganese ABC transporter, ATP-binding...”
BCAS0575 putative binding-protein-dependent transport system component from Burkholderia cenocepacia J2315
30% identity, 83% coverage
- σ54-Dependent Response to Nitrogen Limitation and Virulence in Burkholderia cenocepacia Strain H111
Lardi, Applied and environmental microbiology 2015 - “...BCAL2224 BCAL0729 BCAM1235 BCAM1236 BCAS0575 BCAS0577 Aspartate aminotransferase Lysine-arginine-ornithine-binding periplasmic protein Aminotransferase, DegT...”
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...M20D 2.0 BCAS0443 Putative binding-protein-dependent transport 5.3 BCAS0574 Amino acid ABC transporter ATP-binding protein 3.7 BCAS0575 Putative binding-protein-dependent transport 2.0 BCAS0577 Periplasmic solute-binding protein 1.5 MEMBRANE PROTEINS BCAL0403 Putative outer membrane-bound lytic murein 1.5 BCAL0624 Putative OmpC, outer membrane porin protein precursor 1.6 BCAL1678 Putative outer...”
- “...1.72 BCAS0569 Conserved hypothetical protein 2.31 d BCAS0574 Amino acid ABC transporter ATP-binding protein 3.67 BCAS0575 Putative binding-protein-dependent transport 2.02 BCAS0577 Periplasmic solute-binding protein 1.54 BCAS0587_J_0 Aminopyrrolnitrin oxidase PrnD (fragment) 2.33 BCAS0588 Putative membrane protein (fragment) 1.52 BCAS0672 Hypothetical protein 1.91 BCAS0713 Putative short-chain oxidoreductase 1.66...”
lp_0802 amino acid ABC transporter substrate-binding protein/permease from Lactiplantibacillus plantarum WCFS1
lp_0802 glutamine ABC transporter, substrate binding and permease protein from Lactobacillus plantarum WCFS1
33% identity, 40% coverage
- Molecular Responses of Lactobacilli to Plant Phenolic Compounds: A Comparative Review of the Mechanisms Involved
López, Antioxidants (Basel, Switzerland) 2021 - “...), aspartate ammonia lyase which produces ammonium ( asnB ), a Gln ABC transporter ( lp_0802 and lp_0803 ), and the ammonium transporter protein ( amtB ). The observed profile agrees with a tight control of intracellular ammonia levels, the previously proposed regulatory function of GlnR...”
- Transcriptomic Evidence of Molecular Mechanisms Underlying the Response of Lactobacillus Plantarum WCFS1 to Hydroxytyrosol
Reverón, Antioxidants (Basel, Switzerland) 2020 - “...or glnA (glutamine synthetase), lp_0822 (glutamine-fructose-6-P transaminase), genes coding for two Gln ABC transporters ( lp_0802 and lp_0803 ) ( lp_2110 and lp_2111 ), lp_2830 (aspartate ammonia lyase which produces fumarate from Asp with the production of ammonium), lp_0956 or asnC (Asn-tRNA ligase) and lp_0349 or...”
- Molecular adaptation of Lactobacillus plantarum WCFS1 to gallic acid revealed by genome-scale transcriptomic signature and physiological analysis
Reverón, Microbial cell factories 2015 - “...i.e. glnA (glutamine synthetase), lp_0822 (glutamine-fructose-6-phosphate transaminase), genes coding for a Gln ABC transporter ( lp_0802 and lp_0803 ), lp_2830 (aspartate ammonia-lyase which produces fumarate from Asp with the production of ammonium), amtB (NH 4 + transport protein), were all downregulated. Among the genes involved in...”
- “...( lp_2830 ), amtB ( lp_0349 ) and a glnPHQ glutamine ABC transport system ( lp_0802 and lp_0803 ) fitting with the previously predicted GlnR regulon architecture [ 20 ]. Besides GlnR, another GA-responsive regulons of L. plantarum were the regulon Lp_2742 ( http://regprecise.lbl.gov/RegPrecise/regulon.jsp ) encompassing...”
Psyr_1073 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine from Pseudomonas syringae pv. syringae B728a
36% identity, 33% coverage
NGO0968 putative ABC transporter, permease protein, amino acid from Neisseria gonorrhoeae FA 1090
32% identity, 73% coverage
HSISS4_00832 amino acid ABC transporter permease from Streptococcus salivarius
30% identity, 79% coverage
NH16_RS09120 amino acid ABC transporter permease from Leuconostoc mesenteroides subsp. dextranicum
31% identity, 88% coverage
- Cell-Wall-Degrading Enzymes-Related Genes Originating from Rhizoctonia solani Increase Sugar Beet Root Damage in the Presence of Leuconostoc mesenteroides
Majumdar, International journal of molecular sciences 2022 - “...downregulated (>2-fold) in the presence of R. solani include amino acid ABC transporter permease ( NH16_RS09120 ), D-alanyl-lipoteichoic acid biosynthesis protein dltD ( NH16_RS02465 ), and nicotinate phosphoribosyltransferase ( NH16_RS01415 ). Some of the highly expressed (FPKM~1400-3000) genes at 2 dpi include translation initiation factor IF-1...”
- “...2102.11 NH16_RS00480 30S ribosome-binding factor RbfA 938.09 2283.04 NH16_RS04555 50S ribosomal protein L15 901.01 2378.87 NH16_RS09120 amino acid ABC transporter permease 830.57 0.00 NH16_RS00875 branched-chain amino acid transport system II carrier protein 812.68 736.23 NH16_RS02465 D-alanyl-lipoteichoic acid biosynthesis protein dltD 196.43 79.37 NH16_RS01415 nicotinate phosphoribosyltransferase 171.19...”
Pf6N2E2_5661 L-Arginine ABC transporter, permease protein AotQ from Pseudomonas fluorescens FW300-N2E2
28% identity, 86% coverage
- mutant phenotype: Specific phenotypes on L-Arginine; L-Arginine. no data for ornithine
VC1861 amino acid ABC transporter, permease protein from Vibrio cholerae O1 biovar eltor str. N16961
29% identity, 85% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory