PaperBLAST
PaperBLAST Hits for reanno::pseudo5_N2C3_1:AO356_26355 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (Pseudomonas fluorescens FW300-N2C3) (375 a.a., MLPTEEQTQI...)
Show query sequence
>reanno::pseudo5_N2C3_1:AO356_26355 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (Pseudomonas fluorescens FW300-N2C3)
MLPTEEQTQIRDMARQFAQERLKPFAAEWDREHRFPREAIAEMAELGFFGMLVPEQWGGC
DTGYLAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGA
FALTEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGIS
AFIVPTDSPGYSVARVEDKLGQHASDTCQILFEEVKVPVGNRLGEEGEGYKIALANLEGG
RVGIAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYA
AALRDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIY
EGTSDIQRMVISRNL
Running BLASTp...
Found 250 similar proteins in the literature:
AO356_26355 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens FW300-N2C3
100% identity, 100% coverage
- mutant phenotype: Important for isoleucine utilization. 2-methylbutaonyl-CoA is an intermediate in the standard pathway and no other gene for the methylbutanoyl-CoA dehydrogenase was apparent in the fitness data.
Pf6N2E2_1146 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens FW300-N2E2
99% identity, 100% coverage
- mutant phenotype: Specifically important for: L-Isoleucine. 2-methylbutanoyl-CoA is an intermediate in isoleucine catabolism.
PS417_13850 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas simiae WCS417
95% identity, 100% coverage
- mutant phenotype: Specifically important for: L-Isoleucine. SEED has it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction in isoleucine catabolism
AO353_25680 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) from Pseudomonas fluorescens FW300-N2E3
94% identity, 100% coverage
- mutant phenotype: Specifically important for: Sodium butyrate. SEED has it as butyryl-CoA dehydrogenase. Also important on isoleucine and valine, which implies that it acts on the other substrates as well
Pf1N1B4_4787 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens FW300-N1B4
93% identity, 100% coverage
- mutant phenotype: Important for isoleucine utilization. 2-methylbutaonyl-CoA is an intermediate in the standard pathway and no other gene for the methylbutanoyl-CoA dehydrogenase was apparent in the fitness data.
PfGW456L13_2983 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens GW456-L13
93% identity, 100% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine, which is oxidized via 2-methylbutanoyl-CoA
BV82_1126 acyl-CoA dehydrogenase from Pseudomonas donghuensis
88% identity, 100% coverage
PP_2216 / Q88KS3 short-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
PP2216, PP_2216 acyl-CoA dehydrogenase family protein from Pseudomonas putida KT2440
87% identity, 100% coverage
- When metabolic prowess is too much of a good thing: how carbon catabolite repression and metabolic versatility impede production of esterified α,ω-diols in Pseudomonas putida KT2440
Lu, Biotechnology for biofuels 2021 - “...PP_2215), FadB : 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase (PP_2047, PP_2136, PP_2214, PP_2217), FadE : acyl-CoA dehydrogenase (PP_2048, PP_2216) [ 36 , 37 ] of -oxidation were deleted, generating P. putida BOX as a control strain. For alkyl acetate ester hydrolysis in P. putida and esterase KO mutants, hexyl...”
- Fatty Acid and Alcohol Metabolism in Pseudomonas putida: Functional Analysis Using Random Barcode Transposon Sequencing
Thompson, Applied and environmental microbiology 2020 (secret) - Metabolic engineering of Pseudomonas putida for increased polyhydroxyalkanoate production from lignin
Salvachúa, Microbial biotechnology 2020 - “...is encoded at PP_2215. This putative operon also encodes an acylCoA dehydrogenase ( fadE ; PP_2216). These two gene clusters, PP_21362137 and PP_22142217, were deleted in strain AG2102, resulting in strain AG2228. Finally, to increase carbon flux from 3hydroxyacylACP to mcl PHAs, an additional, codonoptimized copy...”
- The protein coded by the PP2216 gene of Pseudomonas putida KT2440 is an acyl-CoA dehydrogenase that oxidises only short-chain aliphatic substrates
McMahon, FEMS microbiology letters 2005 (PubMed)- “...coded by the PP2216 gene of Pseudomonas putida KT2440 is an acyl-CoA dehydrogenase that oxidises only short-chain aliphatic substrates Brian McMahon, Mary E....”
- “...2005 Edited by H-P.E. Kohler Abstract A gene (PP2216) that codes for an acyl-CoA dehydrogenase was cloned from Pseudomonas putida strain KT2240 and...”
Psest_2445 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas stutzeri RCH2
86% identity, 99% coverage
- mutant phenotype: Specifically important for: L-Isoleucine. SEED has it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction. 2-methylbutanoyl-CoA is an intermediate in isoleucine catabolism
PA2552 probable acyl-CoA dehydrogenase from Pseudomonas aeruginosa PAO1
82% identity, 100% coverage
- The development of a new parameter for tracking post-transcriptional regulation allows the detailed map of the Pseudomonas aeruginosa Crc regulon
Corona, Scientific reports 2018 - “...2,51 1,98 3,13 Catabolism gcvH2 PA2446 Glycine cleavage system protein H2 2,68 2,37 4,08 Catabolism PA2552 Probable acyl-CoA dehydrogenase 3,27 1,72 1,61 Catabolism PA2553 Probable acyl-CoA thiolase 4,09 2,36 2,63 Transport oprQ PA2760 OprQ 0,33 0,89 2,21 Catabolism pauB3 PA2776 FAD-dependent oxidoreductase 1,55 0,2 2,13 CCM/catabolism...”
- Within-Host Evolution of the Dutch High-Prevalent Pseudomonas aeruginosa Clone ST406 during Chronic Colonization of a Patient with Cystic Fibrosis
van, PloS one 2016 - “...PA2402 Secondary metabolites biosynthesis, transport and catabolism [ 13 ] 4794 GTC[V] > GCC[A] 80 PA2552 Lipid transport and metabolism [ 13 ] 2089 TAG[stop] >TGG[W] 51 PA4661 pagL no COG [ 13 ], [ 14 ] 4856 TTC[F] > TTG[L] 34 PA2492 b mexT Transcription...”
- Dissection of the cis-2-decenoic acid signaling network in Pseudomonas aeruginosa using microarray technique
Rahmani-Badi, Frontiers in microbiology 2015 - “...PA0493, PA0506-PA0508, PA0745-PA0746, PA0879, PA1020-PA1022, PA1187, PA1240, PA1470, PA1535, PA1576, PA1628-PA1629, PA1631, PA1827, PA1869, PA2550, PA2552, PA2815, PA2841, PA2887-PA2891, PA2893, PA3286, PA3426, PA3589, PA3591, PA3593, PA3924,PA4089, PA4330, PA4912, PA4979-PA4980, PA4995, PA5020, PA5524 Protein and Amino acid metabolism thrS, folC, glnA, gmk, tgt, dadA, pauA3A5, gltX, gcvT1T2,...”
- Pseudomonas aeruginosa twitching motility-mediated chemotaxis towards phospholipids and fatty acids: specificity and metabolic requirements
Miller, Journal of bacteriology 2008 - “...PA1736 PA1737 PA2011 PA2012 PA2013 PA2014 PA2015 PA2142 PA2552 PA2553 PA2554 PA2555 PA2557 PA2634 PA2764 PA2862 PA2863 PA2887 PA2888 PA2889 PA3013 PA3014 PA3267...”
- Effect of anaerobiosis and nitrate on gene expression in Pseudomonas aeruginosa
Filiatrault, Infection and immunity 2005 - “...PA2261 PA2264 PA2265 PA2302 PA2303 PA2366 PA2423 PA2478 PA2552 PA2553 PA2554 PA2555 PA2557 PA2572 PA2573 PA2753 PA2754 PA2759 PA2780 PA2790 PA3181 PA3329 PA3330...”
- “...California, Berkeley PA2443 PA2444 PA2445 PA2446 PA2460 PA2483 PA2552 PA2553 PA2554 PA2555 PA2570 PA2573 PA2593 PA2629 PA2663 PA2691 PA2763 PA2798 PA2968 PA2969...”
- A cystic fibrosis epidemic strain of Pseudomonas aeruginosa displays enhanced virulence and antimicrobial resistance
Salunkhe, Journal of bacteriology 2005 - “...PA2345 PA2365 PA2366 PA2367 PA2423 PA2433 PA2512 PA2513 PA2552 PA2553 PA2587 PA2588 PA2591 PA2592 Gene name GENE EXPRESSION IN A P. AERUGINOSA CF EPIDEMIC...”
- Microarray analysis of Pseudomonas aeruginosa quorum-sensing regulons: effects of growth phase and environment
Wagner, Journal of bacteriology 2003 - “...2017 by University of California, Berkeley PA2367 PA2423 PA2552 PA2553 PA2554 PA2555 PA2564 PA2565 PA2566 Change in PAO-JP2 (induced to uninduced) (fold)b...”
BOV_RS12330 acyl-CoA dehydrogenase family protein from Brucella ovis ATCC 25840
75% identity, 100% coverage
- Mining the Flavoproteome of Brucella ovis, the Brucellosis Causing Agent in Ovis aries
Minjárez-Sáenz, Microbiology spectrum 2022 - “...(100) Acyl-CoA_dh_M (PF02770) 188-282 Acyl-CoA_dh_1 (PF00441) 292-447 54 1.3.8.- b Acyl-CoA dehydrogenase Acyl-CoA_dh_N (PF02771) 4-116 BOV_RS12330 ABQ62784.1 FAD 4N5F (63) Acyl-CoA_dh_M (PF02770) 120-214 Acyl-CoA_dh_1 (PF00441) 227-375 55 1.3.8.- b Acyl-CoA dehydrogenase Acyl-CoA_dh_N (PF02771) 9-115 BOV_RS14135 ABQ62889.1 FAD 5LNX (36) Acyl-CoA_dh_M (PF02770) 120-218 Acyl-CoA_dh_1 (PF00441) 231-378 56...”
FQU82_00192 acyl-CoA dehydrogenase family protein from Acinetobacter baumannii
71% identity, 99% coverage
- Transcriptomic analysis reveals the regulatory role of quorum sensing in the Acinetobacter baumannii ATCC 19606 via RNA-seq
Xiong, BMC microbiology 2022 - “...found to be enriched in the propanoate metabolism: FQU82_00191, FQU82_00562, FQU82_03635, FQU82_01642 ( paaF ), FQU82_00192, FQU82_00189 ( mmsA ), FQU82_00193, FQU82_00159 ( prpB ), FQU82_00160 ( prpC ), and FQU82_00161 ( acnD ). In purine metabolism, 8 DEGs were downregulated, including FQU82_00576 ( ndk ),...”
A1S_0105 putative acyl-CoA dehydrogenase from Acinetobacter baumannii ATCC 17978
73% identity, 89% coverage
Ac3H11_2996 2-methyl-branched-chain-enoyl-CoA reductase (EC 1.3.8.5) from Acidovorax sp. GW101-3H11
63% identity, 100% coverage
- mutant phenotype: Specifically important for utilizing L-Isoleucine. Automated validation from mutant phenotype: the predicted function (2-METHYLACYL-COA-DEHYDROGENASE-RXN) was linked to the condition via a SEED subsystem. A more specific reaction was selected manually.
H16_A0172 Acyl-CoA dehydrogenase, short-chain specific from Ralstonia eutropha H16
66% identity, 100% coverage
AK34_3562 acyl-CoA dehydrogenase family protein from Burkholderia dolosa AU0158
62% identity, 99% coverage
BCAM2196 putative acyl-CoA dehydrogenase from Burkholderia cenocepacia J2315
62% identity, 99% coverage
- Burkholderia cenocepacia differential gene expression during host-pathogen interactions and adaptation to the host environment
O'Grady, Frontiers in cellular and infection microbiology 2011 - “...BCAM2193 mmsB, 3-hydroxyisobutyrate dehydrogenase 2.4 BCAM2194 mmsA, methylmalonate-semialdehyde dehydrogenase 2.3 BCAM2195 Putative AMP-binding enzyme 2.5 BCAM2196 Putative acyl-CoA dehydrogenase 2.1 BCAM2237 Putative 2,2-dialkylglycine decarboxylase 2.4 BCAS0397 Metallo peptidase, subfamily M20D 2.0 BCAS0443 Putative binding-protein-dependent transport 5.3 BCAS0574 Amino acid ABC transporter ATP-binding protein 3.7 BCAS0575 Putative...”
- “...2.37 BCAM2193 Putative 3-hydroxyisobutyrate dehydrogenase 2.39 BCAM2194 Methylmalonate-semialdehyde dehydrogenase 2.26 BCAM2195 Putative AMP-binding enzyme 2.51 BCAM2196 Putative acyl-CoA dehydrogenase 2.10 BCAM2237 Putative 2,2-dialkylglycine decarboxylase 2.41 BCAM2260 Major facilitator superfamily protein 1.61 BCAM2338 Putative glycosyltransferase 1.53 BCAM2356 Conserved hypothetical protein 1.63 d BCAM2453 Putative redoxin protein 1.69...”
- Transcriptional responses of Burkholderia cenocepacia to polymyxin B in isogenic strains with diverse polymyxin B resistance phenotypes
Loutet, BMC genomics 2011 - “...5 Table S1). These genes include two clusters ( BCAL1212 to BCAL1215 and BCAM2191 to BCAM2196 ) that are overexpressed by 10-fold or more and are predicted to encode proteins involved in energy production and lipid metabolism. Genes down-regulated by 10-fold or more include one cluster...”
- “...to polymyxin B challenge. There are also genes ( BCAL1212 to BCAL1215 , BCAM2191 to BCAM2196 , BCAL1270 to BCAL1276 , and BCAL1083 ) whose expression is significantly altered in RSF34 4000B compared to RSF34 but are not altered between K56-2 and RSF34. These changes in...”
Bcep1808_3337 acyl-CoA dehydrogenase domain-containing protein from Burkholderia vietnamiensis G4
A4JJ73 Acyl-CoA dehydrogenase domain protein from Burkholderia vietnamiensis (strain G4 / LMG 22486)
62% identity, 99% coverage
- Differential Expression and PAH Degradation: What Burkholderia vietnamiensis G4 Can Tell Us?
Cauduro, International journal of microbiology 2020 - “...Ma et al. [ 60 ]. These genes belong to the dehydrogenase groups: Acyl-CoA dehydrogenase (Bcep1808_3337), aldehyde dehydrogenase (Bcep1808_6786), methylmalonate-semialdehyde dehydrogenase (Bcep1808_3335), and trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase (Bcep1808_0122). Proline is directly related to the presence of a stressing agent, in the case of benzo(a)pyrene, and...”
- “...A4JQ98 Bcep1808_5507 63088..64278(+) 1191 Acetyl-CoA acetyltransferase Yes A4JK60 Bcep1808_3678 423951..426545(-) 2595 Aconitate hydratase Yes A4JJ73 Bcep1808_3337 29534..30667() 1134 Acyl-CoA dehydrogenase Yes A4JTS0 Bcep1808_6786 182448..183836() 1389 Aldehyde dehydrogenase Yes A4JKD6 Bcep1808_3756 501291..502235(+) 945 aldo/keto reductase Yes A4JJ72 Bcep1808_3336 27598..29310(-) 1713 AMP-dependent synthetase/ligase Yes A4JQ96 Bcep1808_5505 60596..62263(+) 1668...”
- Differential Expression and PAH Degradation: What Burkholderia vietnamiensis G4 Can Tell Us?
Cauduro, International journal of microbiology 2020 - “...Yes A4JQ98 Bcep1808_5507 63088..64278(+) 1191 Acetyl-CoA acetyltransferase Yes A4JK60 Bcep1808_3678 423951..426545(-) 2595 Aconitate hydratase Yes A4JJ73 Bcep1808_3337 29534..30667() 1134 Acyl-CoA dehydrogenase Yes A4JTS0 Bcep1808_6786 182448..183836() 1389 Aldehyde dehydrogenase Yes A4JKD6 Bcep1808_3756 501291..502235(+) 945 aldo/keto reductase Yes A4JJ72 Bcep1808_3336 27598..29310(-) 1713 AMP-dependent synthetase/ligase Yes A4JQ96 Bcep1808_5505 60596..62263(+)...”
4n5fA / B4EGC8 Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
62% identity, 99% coverage
- Ligand: dihydroflavine-adenine dinucleotide (4n5fA)
H16_B1192 Acyl-CoA dehydrogenase from Ralstonia eutropha H16
H16_B1192 acyl-CoA dehydrogenase family protein from Cupriavidus necator H16
62% identity, 99% coverage
- Insights into the Degradation of Medium-Chain-Length Dicarboxylic Acids in Cupriavidus necator H16 Reveal β-Oxidation Differences between Dicarboxylic Acids and Fatty Acids
Strittmatter, Applied and environmental microbiology 2022 (secret) - The genetic basis of 3-hydroxypropanoate metabolism in Cupriavidus necator H16
Arenas-López, Biotechnology for biofuels 2019 - “..., H16_B1190), -alanine pyruvate transaminase ( aptA , H16_A0272), branched-chain acyl-CoA dehydrogenase ( acaD , H16_B1192), enoyl-CoA dehydratase ( crt , H16_B1189) and 3-hydroxyisobutyryl-CoA hydrolase ( hibH ; note: the gene is currently annotated to encode an enoyl-CoA hydratase/isomerase, H16_B1188). Divergently transcribed transcriptional regulator genes encode...”
- “...transaminase responsible for the conversion of -alanine to malonate semialdehyde. A gene annotated as acaD (H16_B1192) encoding a putative acyl-CoA dehydrogenase is located immediately upstream of mmsA3 . Downstream of mmsA3 are the aforementioned hbdH (H16_B1190) and also putative genes annotated as encoding 3-hydroxybutyryl-CoA dehydratase (H16_B1189,...”
- Investigations on the microbial catabolism of the organic sulfur compounds TDP and DTDP in Ralstonia eutropha H16 employing DNA microarrays
Peplinski, Applied microbiology and biotechnology 2010 - “...mutase 248.35 2.87 7.00 x H16_A2251 phaY1 d -()-3-hydroxybutyrate oligomer hydrolase 3.07 3.79 9.93 x H16_B1192 Acyl-CoA dehydrogenase 25.89 77.24 2.92 x D Genes putatively involved in the uptake of DTDP H16_A2779 Probable extracytoplasmic solute receptor 5.46 4.13 2.63 x H16_A3718 Probable extracytoplasmic solute receptor 5.37...”
- “...4 ). The first group included four genes involved in fatty acid metabolism: H16_A0234 (threefold), H16_B1192 (3- to 77-fold) encoding acyl-CoA dehydrogenases and the 3-hydroxybutyrate oligomer hydrolase phaY1 (H16_A2251, three- to tenfold) (Table 1C ). The latter enzyme is known to be involved in the degradation...”
ABAYE1412 putative acyl-CoA dehydrogenase protein (acdB-like) from Acinetobacter baumannii AYE
59% identity, 99% coverage
A9762_23430 acyl-CoA dehydrogenase from Pandoraea sp. ISTKB
62% identity, 99% coverage
bglu_2g06260 Acyl-CoA dehydrogenase from Burkholderia glumae BGR1
60% identity, 99% coverage
- RNAseq-based Transcriptome Analysis of Burkholderia glumae Quorum Sensing
Kim, The plant pathology journal 2013 - “...primer (5-GGGGATG TGCTGCAAGGCG-3), which is internal sequence of pVIK112 vector. For pstA (bglu_1g11470) and fadE (bglu_2g06260) mutagenesis, we followed the same procedures as described in astC mutagenesis above. To insert the part of the pstA to pVIK112, EcoR I sequence was added to forward primer and...”
- “...and assayed mutant phenotypes were generated. Two mutants, astC -mutant-related arginine degradation II and fadE (bglu_2g06260) mutant, involved in fatty acid -oxidation I showed defects in swarming motility, whereas pstA mutant involved in phosphate transport did not show any phenotypes compared with wild type. The astC...”
Psest_2440 isobutyryl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas stutzeri RCH2
58% identity, 97% coverage
- mutant phenotype: Important for valine utilization as N source, and isobutyryl-CoA is an intermediate in valine catabolism. SEED annotated it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction
4m9aB / Q2T4A2 Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
62% identity, 99% coverage
- Ligand: dihydroflavine-adenine dinucleotide (4m9aB)
PNUC_RS08115 acyl-CoA dehydrogenase family protein from Polynucleobacter asymbioticus QLW-P1DMWA-1
58% identity, 97% coverage
BP1026B_II0681 acyl-CoA dehydrogenase family protein from Burkholderia pseudomallei 1026b
61% identity, 99% coverage
PP_3492 isobutyryl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas putida KT2440
57% identity, 97% coverage
- mutant phenotype: Specific phenotype: utilization of L-Valine (mild phenotype, but confirmed by conservation)
PS417_13840 isobutyryl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas simiae WCS417
59% identity, 97% coverage
- mutant phenotype: Specifically important for: L-Valine. SEED annotates it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction in valine catabolism
AO353_25670 isobutyryl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens FW300-N2E3
59% identity, 97% coverage
- mutant phenotype: Specifically important for: L-Valine. SEED has it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction in valine catabolism
PfGW456L13_2985 isobutyryl-CoA dehydrogenase (EC 1.3.8.5) from Pseudomonas fluorescens GW456-L13
58% identity, 97% coverage
- mutant phenotype: Specifically important for: L-Valine. Isobutyryl-CoA is an intermediate in valine degradation. SEED annotates it as butyryl-CoA dehydrogenase, which is also expected to perform this reaction
A1S_2149 putative acyl CoA dehydrogenase oxidoreductase protein from Acinetobacter baumannii ATCC 17978
62% identity, 87% coverage
YP_354698 Acyl-CoA dehydrogenase from Rhodobacter sphaeroides 2.4.1
59% identity, 99% coverage
- A Chemo-Enzymatic Road Map to the Synthesis of CoA Esters
Peter, Molecules (Basel, Switzerland) 2016 - “...C and a final extension step for 5 min at 72 C. The butyryl-CoA dehydrogenase YP_354698 gene from Rhodobacter sphaeroides was amplified from chromosomal DNA by PCR using the forward primer GGATTT CATATG AGCGTCCTGACCGAC and the reverse primer GCATTT GGATCC TCACGCCA TGCCCCTGAG introducing a NdeI and...”
BTF1_25115 acyl-CoA dehydrogenase from Bacillus thuringiensis HD-789
52% identity, 99% coverage
- NagRBt Is a Pleiotropic and Dual Transcriptional Regulator in Bacillus thuringiensis
Cao, Frontiers in microbiology 2018 - “...nucleotide metabolism might be on the same operon. The expression of genes, lipoprotein (BTF1_26870), acyl-dehydrogenase (BTF1_25115 and BTF1_08960), and acyl carrier protein (BTF1_17540) involved in fatty acid metabolism were decreased in the Bti75- nagR mutant, suggesting that NagR Bt could activate these genes, rather than repress...”
- “...0.188 0.6781 0.038 BTF1_24870 nuoC NADH dehydrogenase subunit C / / / 0.180 0.199 0.020 BTF1_25115 mmgC Acyl-CoA dehydrogenase / / / 0.172 NT BTF1_26870 Lipoprotein / / / 0.133 0.817 0.038 GENES WITH RECOGNIZED dre SITES BUT NOT DIFFERENTIALLY EXPRESSED IN nagR MUTANT COMPARED TO...”
BC5341 Acyl-CoA dehydrogenase, short-chain specific from Bacillus cereus ATCC 14579
51% identity, 98% coverage
HWX41_RS21030 acyl-CoA dehydrogenase AcdA from Bacillus paramycoides
51% identity, 98% coverage
- Genomic Analysis of Endophytic Bacillus cereus T4S and Its Plant Growth-Promoting Traits
Adeleke, Plants (Basel, Switzerland) 2021 - “...plant hormones. Pathway Gene Product Locus Tag ACC catabolism acd A acyl-CoA dehydrogenase Acd A HWX41_RS21030 Potassium transport kdp A potassium-transporting ATPase subunit A HWX41_RS15255 L-tryptophan production; IAA production ND tryptophan synthase subunit alpha HWX41_RS17780 trp B tryptophan synthase subunit beta HWX41_RS17785 trpC indole-3-glycerol phosphate synthase...”
DSY1718 hypothetical protein from Desulfitobacterium hafniense Y51
52% identity, 96% coverage
TTE0545 Acyl-CoA dehydrogenases from Thermoanaerobacter tengcongensis MB4
48% identity, 98% coverage
Q1D5U4 Acyl-CoA dehydrogenase from Myxococcus xanthus (strain DK1622)
50% identity, 98% coverage
TTHE_RS08250 acyl-CoA dehydrogenase from Thermoanaerobacterium thermosaccharolyticum DSM 571
49% identity, 98% coverage
FN1424 ACYL-COA dehydrogenase, short-chain specific from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
50% identity, 58% coverage
ACDB_BACSU / P45857 Acyl-CoA dehydrogenase; EC 1.3.99.- from Bacillus subtilis (strain 168) (see paper)
49% identity, 99% coverage
- catalytic activity: a 2,3-saturated acyl-CoA + A = a 2,3-dehydroacyl-CoA + AH2 (RHEA:48608)
cofactor: FAD
mmgC / GI|1303933 acyl-CoA dehydrogenase from Bacillus subtilis (see paper)
49% identity, 99% coverage
YP_147450 CoA dehydrogenase from Geobacillus kaustophilus HTA426
50% identity, 98% coverage
- Acyl-CoA dehydrogenases: Dynamic history of protein family evolution
Swigonová, Journal of molecular evolution 2009 - “...SCAD ( Fig. 6b ) in Acidobacteria bacterium (ABF41370), Bacillus cereus (NP_978856), and Geobacillus kaustophilus (YP_147450). With the exception of the active site catalytic residue position and the residue equivalent to human IVD Y371, which is distant in the active site, other residues are the same...”
CBO3199 butyryl-CoA dehydrogenase from Clostridium botulinum A str. ATCC 3502
47% identity, 98% coverage
- Heat shock and prolonged heat stress attenuate neurotoxin and sporulation gene expression in group I Clostridium botulinum strain ATCC 3502
Selby, PloS one 2017 - “...sigE ), motility ( sigD , cheA , and flgE ), and carbon metabolism ( cbo3199 , cbo3202 ), and included genes showing significantly activated or suppressed, or unaffected transcription levels in the microarray analysis. A linear regression analysis revealed a strong correlation between the log...”
- “...compounds in heat stressed C . botulinum culture. Two of these genes ( cbo3202 and cbo3199 ) were linked also to low-temperature stress response of ATCC 3502 at 17C [ 65 ]. Interestingly, butyrate in the growth medium has been shown to induce toxin synthesis by...”
- The cold-induced two-component system CBO0366/CBO0365 regulates metabolic pathways with novel roles in group I Clostridium botulinum ATCC 3502 cold tolerance
Dahlsten, Applied and environmental microbiology 2014 - “...509 in antisense orientation, erm Insertional disruption of cbo3199 at base 467 in antisense orientation, erm Insertional disruption of cbo3202 at base 167 in...”
- “...pMTL007C-E2 with L1.LtrB retargeted to base 467 of cbo3199 in antisense orientation pMTL007C-E2 with L1.LtrB retargeted to base 167 of cbo3202 in antisense...”
- Transcriptomic analysis of (group I) Clostridium botulinum ATCC 3502 cold shock response
Dahlsten, PloS one 2014 - “..., cbo0753 , cbo1407 , cbo2226 , cbo2227 , cbo2525 , cbo2847 , cbo2961 , cbo3199 and cbo3202 one hour after the cold shock, normalized to 16S rrn transcript levels and calibrated to pre-cold-shock transcript levels, were calculated using the Cq values obtained from qPCR runs....”
- “...obtained in a previous study [13] for genes cbo0751, cbo0753, cbo1407, cbo2226, cbo2227, cbo2525, cbo2847, cbo3199 , and cbo3202 ; all other data were produced in the current study. In a linear regression analysis between the microarray and RT-qPCR log 2 fold changes ( Fig. 2...”
KR505_10030 acyl-CoA dehydrogenase from Eubacterium callanderi
50% identity, 98% coverage
- Gut Microbiota Eubacterium callanderi Exerts Anti-Colorectal Cancer Activity
Ryu, Microbiology spectrum 2022 - “...butyric acid biosynthesis. But , butyryl-CoA:acetate CoA transferase (locus_tag, KR505_02670); Bcd , butyryl-CoA dehydrogenase (KR505_02675, KR505_10030); ETF , electron transfer flavoprotein subunit alpha (KR505_10020); ETF , electron transfer flavoprotein subunit beta (KR505_10025); Hbd , hydroxybutyryl dehydrogenase (KR505_10035); Cro , crotonase/enoyl-CoA hydratase (KR505_10040); Thl , acetyl-CoA C-acetyltransferase...”
Acfer_1575 acyl-CoA dehydrogenase domain protein from Acidaminococcus fermentans DSM 20731
48% identity, 59% coverage
- Complete genome sequence of Acidaminococcus fermentans type strain (VR4)
Chang, Standards in genomic sciences 2010 - “...(Acfer_1756) is encoded at the beginning of the gene cluster. Three acyl-CoA dehydrogenase genes (Acfer_1477, Acfer_1575 and Acfer_1583) were annotated at various locations, completing the pathway. Nevertheless, genes encoding 2-hydroxyglutarate dehydrogenase and Butyl-CoA:acetate CoA transferase have not yet been identified. Possibly these enzymes have additional functions...”
- “...decarboxylase subunit r Acfer_1836 glutaconyl-CoA decarboxylase sodium pump, subunit r Acfer_1477 acyl-CoA dehydrogenase domain protein Acfer_1575 acyl-CoA dehydrogenase domain protein Acfer_1583 acyl-CoA dehydrogenase domain protein Enzymes of -lactamase and the related Acfer_0250 -lactamase domain-containing protein Acfer_0522 Zn-dependent hydrolase of the -lactamase fold Acfer_0551 RNA-metabolizing metallo--lactamase Acfer_0879...”
RBIBE_22770 acyl-CoA dehydrogenase from Bacillus velezensis
48% identity, 99% coverage
- Complete genome sequence data of chitin-degrading Bacillus velezensis RB.IBE29
Tran, Data in brief 2023 - “...NarK RBIBE_34730 NADPH-nitrite reductase RBIBE_02980 Nitrite reductase small subunit NirD RBIBE_02970 ACC biosynthesis Acyl-CoA dehydrogenase RBIBE_22770 Acyl-CoA dehydrogenase RBIBE_18460 Acyl-CoA dehydrogenase FadE RBIBE_30110 Acyl-CoA dehydrogenase family protein RBIBE_04320 Acyl-CoA synthetase RBIBE_09970 Iron uptake and siderophore production Iron ABC transporter permease RBIBE_01700 Iron ABC transporter permease RBIBE_35840...”
ACDA_BACSU / P45867 Acyl-CoA dehydrogenase; EC 1.3.99.- from Bacillus subtilis (strain 168) (see paper)
acdA / GB|CAA89868.1 acyl-CoA dehydrogenase; EC 1.3.99.3 from Bacillus subtilis (see paper)
BSU37170 acyl-CoA dehydrogenase from Bacillus subtilis subsp. subtilis str. 168
51% identity, 98% coverage
Ccar_22795 acyl-CoA dehydrogenase from Clostridium carboxidivorans P7
47% identity, 97% coverage
- Combination of Trace Metal to Improve Solventogenesis of Clostridium carboxidivorans P7 in Syngas Fermentation
Han, Frontiers in microbiology 2020 - “...fdhII Formate dehydrogenase Ccar_03945 fdhIII Formate dehydrogenase Ccar_13505 fdhIV Formate dehydrogenase Ccar_16050 fdhV Formate dehydrogenase Ccar_22795 bcd Butyryl-CoA dehydrogenase Butyral-CoA synthesis from acetyl-CoA Ccar_22780 crt Crotonase Ccar_22785 hbd 3-Hydroxybutyryl-CoA dehydrogenase Ccar_22790 thl Acetyl-CoA acetyltransferase Ccar_22800 etfB Electron transfer flavoprotein Ccar_22805 etfA Electron transfer flavoprotein subunit alpha...”
Q18AQ1 butanoyl-CoA dehydrogenase complex (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) from Clostridioides difficile (see paper)
5ol2F / A0A125V4E7 The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
CD630_10540, CDIF630erm_01194 acyl-CoA dehydrogenase from Clostridioides difficile 630
CD1054 butyryl-CoA dehydrogenase from Clostridium difficile 630
47% identity, 99% coverage
- Ligands: flavin-adenine dinucleotide; coenzyme a persulfide; calcium ion (5ol2F)
- The WalRK Two-Component System Is Essential for Proper Cell Envelope Biogenesis in Clostridioides difficile
Müh, Journal of bacteriology 2022 - “...protein 0.07 2.18 0.62 Membrane cd630_30360 30360 Major facilitator superfamily transporter 1.59 2.13 1.11 Membrane cd630_10540 10540 bcd2 Acyl-CoA dehydrogenase 1.93 2.23 1.03 cd630_10550 10550 etfB Electron transfer flavoprotein beta 1.78 2.11 1.07 cd630_10560 10560 etfA Electron transfer flavoprotein alpha 1.95 2.18 1.10 cd630_10570 10570 crt2...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...-3.90 -10.48 -4.50 CD630_04010 CDIF630erm_00529 etfA1 Electron transfer flavoprotein subunit alpha -7.50 -3.90 -10.39 -4.98 CD630_10540 CDIF630erm_01194 bcd2 Butyryl-CoA dehydrogenase -5.89 OFF -8.00 OFF CD630_10550 CDIF630erm_01195 etfB Electron transfer flavoprotein subunit beta -7.47 OFF -7.70 OFF CD630_10560 CDIF630erm_01196 etfA Electron transfer flavoprotein subunit alpha -6.75 OFF...”
- “...-10.48 -4.50 CD630_04010 CDIF630erm_00529 etfA1 Electron transfer flavoprotein subunit alpha -7.50 -3.90 -10.39 -4.98 CD630_10540 CDIF630erm_01194 bcd2 Butyryl-CoA dehydrogenase -5.89 OFF -8.00 OFF CD630_10550 CDIF630erm_01195 etfB Electron transfer flavoprotein subunit beta -7.47 OFF -7.70 OFF CD630_10560 CDIF630erm_01196 etfA Electron transfer flavoprotein subunit alpha -6.75 OFF -7.75...”
- “...three different EtfAB systems. The first is encoded downstream the bcd2 gene encoding butyryl-CoA dehydrogenase (CDIF630erm_01194 01199), the second (CDIF630erm_01319 01320) in an operon with lactate racemase (LarA, CDIF630erm_01318) and a lactate dehydrogenase (CDIF630erm_01321) and the third downstream of acdB encoding a short chain acyl-CoA dehydrogenase...”
- Mining Autoimmune-Disorder-Linked Molecular-Mimicry Candidates in Clostridioides difficile and Prospects of Mimic-Based Vaccine Design: An In Silico Approach
Alshamrani, Microorganisms 2023 - “...QWS55813.1 Q18A34 5 WQLVKELKEA SFKHVSPAGAAVG REVSDGIIAPGY KYTQSNSVCYAK GAGQQSRIHCTRLAG 0.73 1.23 20 Acyl-CoA dehydrogenase P16219 QWS55947.1 Q18AQ1 2 LIFEDCRIPK ITEIYEGTSE 0.72 0.99 21 Acetyl-CoA C-acetyltransferase Q9BWD1 QWS55952.1 Q18AR0 2 NASGINDGAA 0.70 0.75 22 Fe-S cluster assembly scaffold protein NifU Q9H1K1 QWS56138.1 Q18BE3 2 GCGSAIASSS 1.01 1.39 23...”
- Diverse Energy-Conserving Pathways in Clostridium difficile: Growth in the Absence of Amino Acid Stickland Acceptors and the Role of the Wood-Ljungdahl Pathway
Gencic, Journal of bacteriology 2020 (secret) - Role of the global regulator Rex in control of NAD+ -regeneration in Clostridioides (Clostridium) difficile
Bouillaut, Molecular microbiology 2019 - “...with the microarrays, we selected a subset of three genes representative of different fermentation pathways (CD1054 ( bcd2, encoding butyryl-CoA dehydrogenase, Fig. 1 (pathway 4)), CD2344 (encoding a membrane protein in the succinate metabolism gene cluster, ( Fig. 1 (pathway 3)) and adhE (encoding acetaldehyde CoA-alcohol...”
- “...qRT-PCR, we measured the relative amounts of prdA (CD3244) , grdE (CD2354), CD2344 and bcd2 (CD1054) mRNAs in the wild-type and rex mutant (LB-CD24) strains. We found that in the absence or in the presence of excess proline, a rex mutation had only a weak effect...”
- Adaptive strategies and pathogenesis of Clostridium difficile from in vivo transcriptomics
Janoir, Infection and immunity 2013 - “...3-hydroxybutyryl-CoA-dehydrogenase; CD1057, 3-hydroxybutyryl-CoA dehydratase; CD1054, butyryl-CoA dehydrogenase; CD1055-CD1056, electron transfer flavoproteins;...”
- “...involved in the conversion of acetyl-CoA into butyryl-CoA (CD1054 to CD1059) was constitutively expressed, since this operon was downregulated at 38 h in vitro...”
- Effect of an oxygen-tolerant bifurcating butyryl coenzyme A dehydrogenase/electron-transferring flavoprotein complex from Clostridium difficile on butyrate production in Escherichia coli
Aboulnaga, Journal of bacteriology 2013 - “...EC 1.3.99.2), comprising the dehydrogenase subunit (CD1054, bcd2), electron transfer flavoprotein subunit beta (CD1055, etfB2), electron transfer flavoprotein...”
- Global transcriptional control by glucose and carbon regulator CcpA in Clostridium difficile
Antunes, Nucleic acids research 2012 - “...succinate-semialdehyde dehydrogenase; 4hbd (CD2338), 4-hydroxybutyrate dehydrogenase; cat2 (CD2339), 4-hydroxybutyrate CoA transferase; abfD (CD2341), vinylacetyl-coa--isomerase; bcd2 (CD1054), butyryl-CoA dehydrogenase; etfBA (CD1055CD1056), electron transfer flavoproteins; ptb (CD0715, CD0112), phosphate butyryltransferase; buk (CD0113), butyrate kinase. After sugar uptake, the carbohydrates are metabolized through the central carbon metabolism to produce...”
- Comparative transcriptional analysis of clinically relevant heat stress response in Clostridium difficile strain 630
Ternan, PloS one 2012 - “...which converts acetyl-CoA and formate to CoA and pyruvate, during metabolism of propanoate and butanoate. CD1054 and CD1056, encoding butyryl-CoA dehydrogenase ( bcd2 ) and an electron transfer flavoprotein alpha-subunit ( etfA2 ), two enzymes of the butanoate metabolic pathway were also upregulated. The phosphotransferase (PTS)...”
- Proteomic and genomic characterization of highly infectious Clostridium difficile 630 spores
Lawley, Journal of bacteriology 2009 - “...A dehydrogenase enzymes and electron transfer proteins (CD1054 to CD1059) (18) (Fig. 5b). KEGG pathway analysis (http://www .genome.ad.jp/kegg) (see Table S1...”
5lnxD / P45857 Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
49% identity, 100% coverage
- Ligand: flavin-adenine dinucleotide (5lnxD)
CTK_C26200 acyl-CoA dehydrogenase from Clostridium tyrobutyricum
50% identity, 97% coverage
D2RL84 butanoyl-CoA dehydrogenase complex (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (subunit 1/2) (EC 1.3.8.1) from Acidaminococcus fermentans (see paper)
Acfer_1477 acyl-CoA dehydrogenase domain protein from Acidaminococcus fermentans DSM 20731
47% identity, 97% coverage
- Studies on the mechanism of electron bifurcation catalyzed by electron transferring flavoprotein (Etf) and butyryl-CoA dehydrogenase (Bcd) of Acidaminococcus fermentans
Chowdhury, The Journal of biological chemistry 2014 - “...protein (21). BcdAf is encoded by the Acfer_1477 gene (acyl-CoA dehydrogenase, 383 amino acids). Kinetic Characterization--Although EtfAf and BcdAf are stable...”
- Complete genome sequence of Acidaminococcus fermentans type strain (VR4)
Chang, Standards in genomic sciences 2010 - “...(NAD(P)(+)) (Acfer_1756) is encoded at the beginning of the gene cluster. Three acyl-CoA dehydrogenase genes (Acfer_1477, Acfer_1575 and Acfer_1583) were annotated at various locations, completing the pathway. Nevertheless, genes encoding 2-hydroxyglutarate dehydrogenase and Butyl-CoA:acetate CoA transferase have not yet been identified. Possibly these enzymes have additional...”
- “...glutaconyl-CoA decarboxylase subunit Acfer_1835 glutaconyl-CoA decarboxylase subunit r Acfer_1836 glutaconyl-CoA decarboxylase sodium pump, subunit r Acfer_1477 acyl-CoA dehydrogenase domain protein Acfer_1575 acyl-CoA dehydrogenase domain protein Acfer_1583 acyl-CoA dehydrogenase domain protein Enzymes of -lactamase and the related Acfer_0250 -lactamase domain-containing protein Acfer_0522 Zn-dependent hydrolase of the -lactamase...”
4l1fA / D2RL84 Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
47% identity, 98% coverage
- Ligands: flavin-adenine dinucleotide; coenzyme a persulfide; 1,3-propandiol (4l1fA)
CBY_3258 acyl-coa dehydrogenase, short-chain specific from Clostridium butyricum 5521
49% identity, 97% coverage
- Reduced catabolic protein expression in Clostridium butyricum DSM 10702 correlate with reduced 1,3-propanediol synthesis at high glycerol loading
Gungormusler-Yilmaz, AMB Express 2014 - “...0.06 0.04 0.30 CBY_3235 Glycerol dehydrogenase c 0.02 0.52 1.47 2.23 0.34 0.36 2.66 2.70 CBY_3258 acyl-coa dehydrogenase (short-chain specific) 0.13 0.41 0.39 0.20 0.16 0.64 1.51 1.05 CBY_3642 pyruvate:ferredoxin oxidoreductase 0.05 0.29 0.02 0.35 0.01 0.49 1.04 0.56 CBY_3690 dihydroxyacetone kinase.(L subunit) 0.57 0.75 1.75...”
- “...FeFe hydrogenase (CBY_2300), acetyl CoA acetyltransferase (CBY_1290), 3-hydroxybutyryl-CoA dehydrogenase (CBY_3045), 3-hydroxybutyryl-coa dehydratase (CBY_3041), acyl-CoA dehydrogenase (CBY_3258 and 3042), phosphate butyryltransferase (CBY_2919), butyrate kinase (CBY_2920), butanol dehydrogenase (CBY_3747 and 3751), phosphate acetyltransferase (CBY_0205), acetate kinase (CBY_0206), lactate dehydrogenase (CBY_0742, 2341 and 2757), and ethanol dehydrogenase (CBY_3753) (Figure...”
WP_069875591 acyl-CoA dehydrogenase from Fusibacter sp. 3D3
47% identity, 97% coverage
Cbei_2883 acyl-CoA dehydrogenase domain-containing protein from Clostridium beijerincki NCIMB 8052
49% identity, 97% coverage
ACADS_RAT / P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
P15651 short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) from Rattus norvegicus (see 2 papers)
47% identity, 91% coverage
- function: Short-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (PubMed:3968063). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl- CoA (PubMed:3968063). Among the different mitochondrial acyl-CoA dehydrogenases, short-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 4 to 6 carbons long primary chains (PubMed:3968063).
catalytic activity: a short-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a short-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:47196)
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
cofactor: FAD (Binds 1 FAD per subunit.)
subunit: Homotetramer. - Myocardial proteomic profile in pulmonary arterial hypertension.
Hołda, Scientific reports 2020 - “...subunit beta, mitochondrial 1.06 P00564 Ckm Creatine kinase M-type 1.08 P04797 Gapdh Glyceraldehyde-3-phosphate dehydrogenase 1.09 P15651 Acads Short-chain specific acyl-CoA dehydrogenase, mitochondrial 1.10 P21396 Maoa Amine oxidase [flavin-containing] A 1.13 P12075 Cox5b Cytochrome c oxidase subunit 5B, mitochondrial 1.13 P05545 Serpina3k Serine protease inhibitor A3K 1.15...”
- Leucine-Rich Diet Modulates the Metabolomic and Proteomic Profile of Skeletal Muscle during Cancer Cachexia.
Cruz, Cancers 2020 - “...W P49432 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial GN = Pdhb >5 WL W P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial GN = Acads 1.174 WL W P48721 Stress-70 protein, mitochondrial GN = Hspa9 >5 WL W Q920L2 Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial GN =...”
- Inflammation and apoptosis accelerate progression to irreversible atrophy in denervated intrinsic muscles of the hand compared with biceps: proteomic analysis of a rat model of obstetric brachial plexus palsy.
Yu, Neural regeneration research 2020 - “...acid metabolism 18 O35547 * , Q63151 * , P70584, Q9WVK3, P33124, G3V9U2, P14604, P17764, P15651, Q64428, Q5M9H2, Q9WVK7, Q60587, P18163, P18886, P08503, P07896, G3V7N5 < 0.001 Calcium signaling 16 P11275, P20651, A0A0G2K9C8, P13286, Q64578, A0A0G2JSR0, F1LLZ7, Q304F3, G3V731, A0A0G2K5J1, F1LQL1, P29117, Q9Z2L0, Q05962, Q62711, D3ZB81...”
- Nitric Oxide Donor NOC-18-Induced Changes of Mitochondrial Phosphoproteome in Rat Cardiac Ischemia Model.
Umbrasas, Medicina (Kaunas, Lithuania) 2019 - “...alpha somatic form mitochondrial (PDHA1) P26284 1.55 0.024 Short chain specific acyl CoAdehydrogenase mitochondrial (ACADS) P15651 1.58 0.027 Long chain specific acyl CoAdehydrogenase mitochondrial (ACADVL) P15650 1.59 0.027 Isovaleryl CoA dehydrogenase mitochondrial (IVD) P12007 1.59 0.030 Succinyl CoA ligase ADP GDP forming subunit alpha mitochondrial (SUCLG1)...”
- Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
Ayyar, Journal of proteomics 2017 - “...mitochondrial Fatty acid beta oxidation - greatest activity toward short branched chain acyl-CoA derivatives UP/DOWN P15651 Acads Short-chain specific acyl-CoA dehydrogenase (SCAD) Fatty acid beta oxidation - catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid UP/DOWN Q5PPL3 Nsdhl Sterol-4-alpha-carboxylate 3-dehydrogenase Cholesterol biosynthesis UP...”
- Methylene blue decreases mitochondrial lysine acetylation in the diabetic heart.
Berthiaume, Molecular and cellular biochemistry 2017 - “...specific acyl-CoA dehydrogenase (MCAD) P08503 K.VPAS K AFTGFIVEADTPGIHIGK.K 217 0.87 Short-chain specific acyl-CoA dehydrogenase (SCAD) P15651 R.HAFGAPLT K LQNIQFK.L 306 0.31 Trifunctional enzyme subunit alpha (HADHa) Q64428 K.DTTASAVAVGL K QGK.V 531 0.21 K.TS K DTTASAVAVGLK.Q 519 0.14 R.DSIFSNLIGQLDY K GFEK.A 436 0.47 R.FVDLYGAQ K VVDR.L 728...”
- Proteomic Expression Changes in Large Cerebral Arteries After Experimental Subarachnoid Hemorrhage in Rat Are Regulated by the MEK-ERK1/2 Pathway.
Müller, Journal of molecular neuroscience : MN 2017 - “...O-fucosyltransferase 2 0.92 P61983 14-3-3 protein gamma 0.91 P28661 Septin-4 0.89 P14046 Alpha-1-inhibitor 3 0.88 P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial 0.87 P19804 Nucleoside diphosphate kinase B 0.86 P85972 Vinculin 0.85 P15865 Histone H1.2 0.84 Q58FK9 Kynurenine--oxoglutarate transaminase 3 0.84 P62260 14-3-3 protein epsilon 0.84 Q5XI78...”
- Prediction of FAD binding sites in electron transport proteins according to efficient radial basis function networks and significant amino acid pairs.
Le, BMC bioinformatics 2016 - “...O54050 P41367 P97275 Q7WZ62 D0VWY5 O60341 P45954 Q2GBV9 Q7X2H8 O52582 P0A6U3 P47989 Q389T8 Q7ZA32 Q9RSY7 P15651 P49748 Q47PU3 Q8DMN3 Q9UBK8 P19920 P55789 Q52437 Q8X1D8 Q9UKU7 P07872 P09622 Q9HJI4 Q9HKS9 Q9HTK9 Sequence information Sequence information is one of the first features set in predicting the secondary structure...”
- More
Q6IMX3 short-chain acyl-CoA dehydrogenase from Rattus norvegicus
NP_071957 short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor from Rattus norvegicus
47% identity, 90% coverage
- The mitochondrial proteomic changes of rat hippocampus induced by 28-day simulated microgravity.
Ji, PloS one 2022 - “...Peroxiredoxin 3 1.67 0.003211 F1LNF7_RAT F1LNF7 Idh3a Isocitrate dehydrogenase [NAD] subunit, mitochondrial 1.67 0.005636 Q6IMX3_RAT Q6IMX3 Acads Acetyl-Coenzyme A dehydrogenase, short chain, isoform CRA_a 1.67 0.01089 A0A0G2JVM0_RAT A0A0G2JVM0 Aldh4a1 Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial 1.66 0.007541 D4A8N2_RAT D4A8N2 Fdx2 Ferredoxin 2 1.66 0.0146 A0A0G2JZA2_RAT A0A0G2JZA2 Grpel1 GrpE protein...”
- Comparative proteomic analysis of the aging soleus and extensor digitorum longus rat muscles using TMT labeling and mass spectrometry
Chaves, Journal of proteome research 2013 - “...soleus muscles Protein accession no. P value Log 2 fold change a DESCRIPTION Energy metabolism Q6IMX3 0.017 0.8 Acetyl-Coenzyme A dehydrogenase, short chain, isoform CRA_a P13221 < 0.001 0.8 Aspartate aminotransferase, cytoplasmic P13221 0.001 1.1 Aspartate aminotransferase, mitochondrial F1LP05 < 0.001 0.9 ATP synthase subunit alpha...”
- Mechanism of 3,4-methylenedioxymethamphetamine (MDMA, ecstasy)-mediated mitochondrial dysfunction in rat liver.
Moon, Proteomics 2008 - “...2 10 3-Ketoacyl-CoA thiolase P13437 7 Methylmalonate-semialdehyde dehydrogenase (ALDH6) Q02253 6 Acetyl-CoA dehydrogenase, short chain Q6IMX3 3 Glutamate dehydrogenase 1 (GDH) P10860 2 Long-chain specific acyl-CoA dehydrogenase P15650 2 11 3-Ketoacyl-CoA thiolase P13437 12 Methylmalonate-semialdehyde dehydrogenase (ALDH6) Q02253 8 Glutamate dehydrogenase 1 (GDH) P10860 4 Fumarate...”
- “...P13437 1 13 Probable oxidoreductase Q68FT3 4 3-Ketoacyl-CoA thiolase P13437 3 Acetyl-CoA dehydrogenase, short chain Q6IMX3 3 Protein disulfide-isomerase A6 precursor Q63081 3 3-Ketoacyl-CoA thiolase A, peroxisomal P21775 2 Peroxisomal delta3, delta2-enoyl-CoA isomerase Q5XIC0 2 14 Acetyl-CoA dehydrogenase, short chain Q6IMX3 4 3-Ketoacyl-CoA thiolase P13437 3...”
- Short-chain acyl-CoA dehydrogenase is a potential target for the treatment of vascular remodelling.
Zhong, Journal of hypertension 2023 (PubMed)- GeneRIF: Short-chain acyl-CoA dehydrogenase is a potential target for the treatment of vascular remodelling.
- Effects of short-chain acyl-CoA dehydrogenase on cardiomyocyte apoptosis.
Zeng, Journal of cellular and molecular medicine 2016 - GeneRIF: the role of SCAD in tert-butyl hydroperoxide (tBHP)-induced cardiomyocyte apoptosis, is reported.
- Effects of ERK1/2/PPARα/SCAD signal pathways on cardiomyocyte hypertrophy induced by insulin-like growth factor 1 and phenylephrine.
Huang, Life sciences 2015 (PubMed)- GeneRIF: the phosphorylation of ERK1/2 inhibited the expression and activity of SCAD through the PPARalpha signaling pathway, which induced the development of pathological cardiomyocyte hypertrophy.
- Changes in short-chain acyl-coA dehydrogenase during rat cardiac development and stress.
Huang, Journal of cellular and molecular medicine 2015 - GeneRIF: the down-regulated expression of SCAD in pathological cardiac hypertrophy may be responsible for 'the recapitulation of foetal energy metabolism'.
- Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
Battaile, The Journal of biological chemistry 2002 (PubMed)- GeneRIF: Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
CLNEO_21740 acryloyl-CoA reductase from Anaerotignum neopropionicum
47% identity, 98% coverage
CTK_C26360 acyl-CoA dehydrogenase from Clostridium tyrobutyricum
46% identity, 98% coverage
NP_031409 short-chain specific acyl-CoA dehydrogenase, mitochondrial precursor from Mus musculus
Q07417 Short-chain specific acyl-CoA dehydrogenase, mitochondrial from Mus musculus
47% identity, 91% coverage
- Aging-induced short-chain acyl-CoA dehydrogenase promotes age-related hepatic steatosis by suppressing lipophagy.
Deng, Aging cell 2024 - GeneRIF: Aging-induced short-chain acyl-CoA dehydrogenase promotes age-related hepatic steatosis by suppressing lipophagy.
- Brain transcriptional responses to high-fat diet in Acads-deficient mice reveal energy sensing pathways.
Kruger, PloS one 2012 - GeneRIF: Results suggest that the decreased beta-oxidation of short-chain fatty acids in Acads-deficient mice fed HF diet produces a state of energy deficiency in the brain.
- Brown adipose tissue function in short-chain acyl-CoA dehydrogenase deficient mice.
Skilling, Biochemical and biophysical research communications 2010 - GeneRIF: These results suggest that reduced brown adipose tissue function is not the major factor causing cold sensitivity in acyl-CoA dehydrogenase knockout strains.
- Mice bearing Acads mutation display altered postingestive but not 5-s orosensory response to dietary fat.
Smith, American journal of physiology. Regulatory, integrative and comparative physiology 2004 (PubMed)- GeneRIF: SCAD-deficient mice display altered postingestive responses to dietary fat, providing further evidence for metabolic control of feeding. Acads does not alter acute orosensory response to this fat stimulus.
- Misfolding, degradation, and aggregation of variant proteins. The molecular pathogenesis of short chain acyl-CoA dehydrogenase (SCAD) deficiency.
Pedersen, The Journal of biological chemistry 2003 (PubMed)- GeneRIF: some variants of SCAD proteins (R22W, G68C, W153R, and R359C) are severely misfolded, which may implicate a role in the pathogenesis of SCAD deficiency
- Branched-Chain Amino Acid Degradation Pathway was Inactivated in Colorectal Cancer: Results from a Proteomics Study
Lian, Journal of Cancer 2024 - “...0.65 Yes P54869 Hmgcs2 Hydroxymethylglutaryl-CoA synthase, mitochondrial 27.17 20 1.01 0.32 0.28 Down 0.016 Yes Q07417 Acads Short-chain specific acyl-CoA dehydrogenase, mitochondrial 19.42 7 1 0.46 0.45 Down 0.24 Yes Q61425 Hadh Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial 21.34 7 1.01 0.53 0.51 Down 0.25 Yes Q8BH95 Echs1...”
- A quantitative proteomic approach to evaluate the efficacy of carnosine in a murine model of chronic obstructive pulmonary disease (COPD).
D'Amato, Redox biology 2024 - “...Dcn 10 39,81 0,44 1,48 Q3UIJ9 Myocardial zonula adherens protein Myzap 11 53,90 0,48 1,51 Q07417 Short-chain specific acyl-CoA dehydrogenase, mitochondrial Acads 9 44,89 0,50 1,53 A0A0R4J139 Methionine-R-sulfoxide reductase B3, mitochondrial Msrb3 4 20,22 0,45 1,54 Q5SWZ5 Myosin phosphatase Rho-interacting protein Mprip 15 257,28 0,37 1,58...”
- Mitochondrial Sirtuin-3 (SIRT3) Prevents Doxorubicin-Induced Dilated Cardiomyopathy by Modulating Protein Acetylation and Oxidative Stress.
Tomczyk, Circulation. Heart failure 2022 - “...1.49 Aconitate hydratase Aco2 Q99KI0 AIIT k SFAR K689 1.33 Short-chain specific acyl-CoA dehydrogenase Acadsd Q07417 AAML k DNK K335 0.95 Malate dehydrogenase, cytoplasmic Mdh1 P14152 SQGTALE k YAK K118 0.69 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Sdhb Q9CQA3 WDPD k TGDKPR K53 0.58 Trifunctional enzyme subunit...”
- The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...Mitochondrial import receptor subunit TOM20 homolog Tomm20 0.013691041 P51174 Long-chain specific acyl-CoA dehydrogenase Acadl 0.014069291 Q07417 Short-chain specific acyl-CoA dehydrogenase Acads 0.014588163 Q9JIY5 Serine protease HTRA2, mitochondrial Htra2 0.01537337 Q8BGX2 Mitochondrial import membrane translocase (Tim29) Timm29 0.017629493 Q9WVA2 Mitochondrial import membrane translocase (Tim8A) Timm8a1 0.020053563 Q9D7B6...”
- ISG15 Is a Novel Regulator of Lipid Metabolism during Vaccinia Virus Infection.
Albert, Microbiology spectrum 2022 - “...P97742 Cpt1a Carnitine O -palmitoyltransferase 1, liver isoform 8.54 Q8BH95 Echs1 Enoyl-CoA hydratase, mitochondrial 8.31 Q07417 Acads Short-chain-specific acyl-CoA dehydrogenase, mitochondrial 7.62 P51174 Acadl Long-chain-specific acyl-CoA dehydrogenase, mitochondrial 6.74 Q8QZT1 Acat1 Acetyl-CoA acetyltransferase, mitochondrial 6.14 P42125 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial 6.00 Q9R0H0 Acox1 Peroxisomal...”
- Adipocyte-Derived Extracellular Vesicles: State of the Art.
Rome, International journal of molecular sciences 2021 - “...]. Gene Symbols Protein Accession Numbers Gene Names Acadl P51174 acyl-Coenzyme A dehydrogenase, long-chain Acads Q07417 acyl-Coenzyme A dehydrogenase, short chain Aco2 Q99KI0 aconitase 2, mitochondrial Acsl1 P41216 acyl-CoA synthetase long-chain family member 1 Adipoq Q60994 adiponectin, C1Q and collagen domain containing Agpat2 Q8K3K7 1-acylglycerol-3-phosphate O-acyltransferase...”
- PAX2 promotes epithelial ovarian cancer progression involving fatty acid metabolic reprogramming.
Feng, International journal of oncology 2020 - “...1 1.48 Up 0.0436 P50544 Acadvl Very long-chain specific acyl-CoA dehydrogenase, mitochondrial 1.48 Up 0.0435 Q07417 Acads Short-chain specific acyl-CoA dehydrogenase, mitochondrial 1.44 Up 0.0039 P45952 Acadm Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 1.35 Up 0.0346 O08756 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 1.27 Up 0.0096 Fatty acid activation...”
- Proteomic profiling of liver tissue from the mdx-4cv mouse model of Duchenne muscular dystrophy
Murphy, Clinical proteomics 2018 - “...short, branched, medium, long and very long chain specific acyl-CoA dehydrogenases (P51174, Q8K370, Q8JZN5, P45952, Q07417, P50544, Q9DBL1, Q80XL6) and 3-hydroxyacyl-CoA dehydrogenase (O08756), and (5) enzymes of ketone body metabolism, including the cytoplasmic HMGCS1 isoform (Q8JZK9) and mitochondrial HMGCS2 isoform (P54869) of hydroxyl-methylglutaryl-CoA synthase. Proteomic profiling...”
- More
acrC / G3KIM8 propionyl-CoA dehydrogenase from Anaerotignum propionicum (see paper)
ACRC_ANAPI / G3KIM8 Acryloyl-CoA reductase (NADH); Propionyl-CoA dehydrogenase; EC 1.3.1.95 from Anaerotignum propionicum (Clostridium propionicum) (see paper)
47% identity, 94% coverage
- function: Probable catalytic subunit of the acryloyl-CoA reductase complex involved in the pathway of L-alanine fermentation. Catalyzes the irreversible NADH-dependent formation of propionyl-CoA from acryloyl-CoA. It can also use 3-buten-2-one as substrate.
catalytic activity: propanoyl-CoA + NAD(+) = acryloyl-CoA + NADH + H(+) (RHEA:34471)
cofactor: FAD
subunit: Heterohexadecamer; tetramer of tetramers. Each tetramer is composed of 2 alpha (AcrC), a beta (AcrA) and a gamma (AcrB) subunit.
LOC118274443 short-chain specific acyl-CoA dehydrogenase, mitochondrial from Spodoptera frugiperda
48% identity, 88% coverage
CTC_RS10685 acyl-CoA dehydrogenase from Clostridium tetani E88
45% identity, 98% coverage
- Regulation of Clostridium tetani Neurotoxin Expression by Culture Conditions
Pennings, Toxins 2022 - “...tetX ( Figure 4 , brown cluster). Apart from tetX , these included acyl-CoA dehydrogenase (CTC_RS10685), amino acid permease (CTC_RS04695), ethanolamine utilization protein (CTC_RS11165), and five hypothetical proteins (CTC_RS05450, CTC_RS08030, CTC_RS08110, CTC_RS10695, CTC_RS13650). When adjacent clusters were included, we found a set of 20 DEGs for...”
7y0aC / P16219 Crystal structure of human short-chain acyl-coa dehydrogenase
47% identity, 97% coverage
- Ligand: flavin-adenine dinucleotide (7y0aC)
Dred_0402 acyl-CoA dehydrogenase domain protein from Desulfotomaculum reducens MI-1
44% identity, 98% coverage
ACADS / P16219 short-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.1) from Homo sapiens (see 11 papers)
ACADS_HUMAN / P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 4 papers)
NP_000008 short-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor from Homo sapiens
E5KSD5 short-chain acyl-CoA dehydrogenase from Homo sapiens
47% identity, 91% coverage
- function: Short-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (By similarity). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl- CoA (By similarity). Among the different mitochondrial acyl-CoA dehydrogenases, short-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 4 to 6 carbons long primary chains (PubMed:11134486, PubMed:21237683).
catalytic activity: a short-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a short-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:47196)
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
cofactor: FAD (Binds 1 FAD per subunit. {ECO:0000269|Ref.)10}
subunit: Homotetramer. - Short-chain acyl-CoA dehydrogenase is a potential target for the treatment of vascular remodelling.
Zhong, Journal of hypertension 2023 (PubMed)- GeneRIF: Short-chain acyl-CoA dehydrogenase is a potential target for the treatment of vascular remodelling.
- The minor C-allele of the rs2014355 variant in ACADS gene is associated with exercise-induced increase in HDL cholesterol levels in Taiwanese adults.
Yang, Medicine 2021 - GeneRIF: The minor C-allele of the rs2014355 variant in ACADS gene is associated with exercise-induced increase in HDL cholesterol levels in Taiwanese adults.
- Screening and follow-up results of fatty acid oxidative metabolism disorders in 608 818 newborns in Jining, Shandong province.
Yang, Zhejiang da xue xue bao. Yi xue ban = Journal of Zhejiang University. Medical sciences 2021 - GeneRIF: Screening and follow-up results of fatty acid oxidative metabolism disorders in 608 818 newborns in Jining, Shandong province.
- Integrated Analysis of Expression and Prognostic Values of Acyl-CoA Dehydrogenase short-chain in Colorectal Cancer.
Wu, International journal of medical sciences 2021 - GeneRIF: Integrated Analysis of Expression and Prognostic Values of Acyl-CoA Dehydrogenase short-chain in Colorectal Cancer.
- Effects of genetic variations in Acads gene on the risk of chronic obstructive pulmonary disease.
Yuan, IUBMB life 2020 (PubMed)- GeneRIF: Effects of genetic variations in Acads gene on the risk of chronic obstructive pulmonary disease.
- ACADS acts as a potential methylation biomarker associated with the proliferation and metastasis of hepatocellular carcinomas.
Chen, Aging 2019 - GeneRIF: ACADS acts as a potential methylation biomarker associated with the proliferation and metastasis of hepatocellular carcinomas.
- An unusually high frequency of SCAD deficiency caused by two pathogenic variants in the ACADS gene and its relationship to the ethnic structure in Slovakia.
Lisyová, BMC medical genetics 2018 - GeneRIF: Study discovered a high occurrence of two rare pathogenic variants-the deletion c.310_312delGAG and the substitution c.1138C>T, with allelic frequencies of 64% and 31%, respectively especially in the Roma ethnic group.
- Fluxomic evidence for impaired contribution of short-chain acyl-CoA dehydrogenase to mitochondrial palmitate β-oxidation in symptomatic patients with ACADS gene susceptibility variants.
Dessein, Clinica chimica acta; international journal of clinical chemistry 2017 (PubMed)- GeneRIF: a link between ACADS susceptibility variants and abnormal beta-oxidation consistent with known altered kinetics of these variants
- More
- Integrative analysis reveals marker genes for intestinal mucosa barrier repairing in clinical patients.
Zhao, iScience 2023 - “...12.85 1.96 Sulfurtransferase; Thiosulfate sulfurtransferase TST Q53EW8 14.02 1.00 Short-chain specific acyl-CoA dehydrogenase, mitochondrial ACADS E5KSD5 4.34E-08 Intestinal mucosal healing markers are associated with improved patients post-operational recovery outcomes To determine the clinical relevance of the 10 potential intestinal barrier repairing markers identified in the current...”
- Mining Autoimmune-Disorder-Linked Molecular-Mimicry Candidates in Clostridioides difficile and Prospects of Mimic-Based Vaccine Design: An In Silico Approach.
Alshamrani, Microorganisms 2023 - “...formyltransferase P31939 QWS55813.1 Q18A34 5 WQLVKELKEA SFKHVSPAGAAVG REVSDGIIAPGY KYTQSNSVCYAK GAGQQSRIHCTRLAG 0.73 1.23 20 Acyl-CoA dehydrogenase P16219 QWS55947.1 Q18AQ1 2 LIFEDCRIPK ITEIYEGTSE 0.72 0.99 21 Acetyl-CoA C-acetyltransferase Q9BWD1 QWS55952.1 Q18AR0 2 NASGINDGAA 0.70 0.75 22 Fe-S cluster assembly scaffold protein NifU Q9H1K1 QWS56138.1 Q18BE3 2 GCGSAIASSS 1.01...”
- “...Diabetes mellitus, Juvenile idiopathic arthritis - - - - C. neoformans [ 121 ] 18 P16219 Acyl-CoA dehydrogenase Allergic rhinitis, Ulcerative colitis, Crohns disease - - - - - 19 Q9BWD1 Acetyl-CoA C-acetyltransferase - - Parkinsons disease HBV, Viral carcinogenesis - - 20 Q9H1K1 Fe-S cluster...”
- Mitochondria-derived vesicles and their potential roles in kidney stone disease.
Chaiyarit, Journal of translational medicine 2023 - “...dehydrogenase/reductase 1) (retSDR1) (Retinol dehydrogenase 17) (Short chain dehydrogenase/reductase family 16C member 1) 204 ACADS P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial (SCAD) (EC 1.3.8.1) (Butyryl-CoA dehydrogenase) 205 SLC6A13 Q9NSD5 Sodium- and chloride-dependent GABA transporter 2 (GAT-2) (Solute carrier family 6 member 13) 206 SPATA2L Q8IUW3 Spermatogenesis-associated...”
- Muscle Proteomic and Transcriptomic Profiling of Healthy Aging and Metabolic Syndrome in Men.
Gueugneau, International journal of molecular sciences 2021 - “...1486 P05413 FABP3 Fatty acid-binding protein, heart 0.001 1.45 1.29 737 64 23 9 1856 P16219 ACADS Short-chain specific acyl-CoA dehydrogenase, mitochondrial 0.040 1.29 325 25 19 8 839 Q13011 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial 0.013 1.33 1.42 865 30 22 8 837 Q13011 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,...”
- Yersinia pseudotuberculosis YopJ Limits Macrophage Response by Downregulating COX-2-Mediated Biosynthesis of PGE2 in a MAPK/ERK-Dependent Manner.
Sheppe, Microbiology spectrum 2021 - “...factor 1 epsilon 1 O43324 0.004 3.333 Cytoplasm Translation regulator ACADS Acyl-CoA dehydrogenase short chain P16219 0.021 2.5 Cytoplasm Enzyme CAPRIN1 Cell cycle-associated protein 1 Q14444 0.013 2.5 Plasma membrane Other H1-10 H1.10 linker histone Q92522 0.043 2.5 Nucleus Other LUC7L3 LUC7 like 3 pre-mRNA splicing...”
- Electron transfer flavoprotein and its role in mitochondrial energy metabolism in health and disease.
Henriques, Gene 2021 - “...dehydrogenase ACADM P11310 Fatty acid oxidation C4- to C16-CoA SCAD Short-chain specific acyl-CoA dehydrogenase ACADS P16219 Fatty acid oxidation C4- to C6-CoA ACAD9 Complex I assembly factor ACAD9 ACAD9 Q9H845 Complex I assembly, fatty acid oxidation long-chain unsaturated acyl-CoAs ACAD10 Acyl-CoA dehydrogenase family member 10 ACAD10...”
- Identification of HO-1 as a novel biomarker for graft acute cellular rejection and prognosis prediction after liver transplantation
Jia, Annals of translational medicine 2020 - “...mitochondrial SDHB 0.740 P43155 Carnitine O-acetyltransferase CRAT 0.742 P10599 Isoform 2 of Thioredoxin TXN 0.746 P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial ACADS 0.748 Q9Y2Q3 Glutathione S-transferase kappa 1 GSTK1 0.749 Q9BUP3 Oxidoreductase HTATIP2 HTATIP2 0.749 P62266 40S ribosomal protein S23 RPS23 0.753 O75191 Xylulose kinase XYLB...”
- Discovery of Candidate Stool Biomarker Proteins for Biliary Atresia Using Proteome Analysis by Data-Independent Acquisition Mass Spectrometry.
Watanabe, Proteomes 2020 - “...disulfide-isomerase A6 PDIA6 6.8 Q9UJ70 N-acetyl-D-glucosamine kinase NAGK 6.3 O94788 Retinal dehydrogenase 2 ALDH1A2 6.2 P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial ACADS 6.1 O15143 Actin-related protein 2/3 complex subunit 1B ARPC1B 6.1 O95571 Persulfide dioxygenase ETHE1, mitochondrial ETHE1 5.9 P15531 Nucleoside diphosphate kinase A NME1 5.8...”
- Proteomic investigation of human skeletal muscle before and after 70 days of head down bed rest with or without exercise and testosterone countermeasures.
Dillon, PloS one 2019 - “...0.068 25.534 0.401 61.275 0.014 72.284 0.601 -11.301 metabolic Short-chain specific acyl-CoA dehydrogenase, mitochondrial ACADS P16219 6.30 38 44 95 FRAG 0.119 -20.021 0.011 -47.653 0.624 -4.929 0.590 2.441 0.353 10.737 0.211 21.749 transport Hemoglobin subunit alpha HBA1 P69905 5.24 13 15 152 FRAG 0.836 4.416...”
- “...0.091 ###### 0.450 -62.068 0.122 -50.316 0.154 -53.174 metabolic Short-chain specific acyl-CoA dehydrogenase, mitochondrial ACADS P16219 6.30 38 44 95 FRAG 0.417 -11.555 0.097 -22.539 0.323 9.613 0.631 2.673 0.602 7.540 0.620 -8.344 structural Keratin, type II cytoskeletal 6A KRT6A P02538 6.13 33 60 435 FRAG...”
- More
ACDS_CLOAB / P52042 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; SCAD; EC 1.3.8.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W) (see paper)
bcd butyryl-CoA dehydrogenase; EC 1.3.99.2 from Clostridium acetobutylicum (see paper)
CAC2711 Butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824
CA_C2711 acyl-CoA dehydrogenase from Clostridium acetobutylicum
46% identity, 97% coverage
- catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: a short-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a short-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:47196)
cofactor: FAD - Transcriptional analysis of micronutrient zinc-associated response for enhanced carbohydrate utilization and earlier solventogenesis in Clostridium acetobutylicum
Wu, Scientific reports 2015 - “...pyruvate to butyryl-CoA formation genes, thlA (CAC2873), crt (CAC2712), etfA (CAC2709), etfB (CAC2710), and bcd (CAC2711) were differentially upregulated by no more than 1.75-fold. Surprisingly, thlB (CAC0078) encoding acetyl-CoA acetyltransferase was 0.65-fold downregulated compared to 1.46-fold upregulation of the primary thiolase gene thlA in the presence...”
- Redox-responsive repressor Rex modulates alcohol production and oxidative stress tolerance in Clostridium acetobutylicum
Zhang, Journal of bacteriology 2014 - “...asrA asrB asrC CAP0035 CAC0267 CAC2873 CAC2712 CAC2711 CAC2710 CAC2709 CAC2708 CAC3076 CAC3075 CAC1025 CAC1024 CAC1023 CAC1512 CAC1513 CAC1514 CAC1515 164.75...”
- Meta-analysis and functional validation of nutritional requirements of solventogenic Clostridia growing under butanol stress conditions and coutilization of D-glucose and D-xylose
Heluane, Applied and environmental microbiology 2011 - “...P CAC2235 CAC2388 CAC2389 CAC2390 CAC2634 CAC2708 CAC2711 CAC2712 CAC3164 CAC3170 CAC3348 CAC3462 CAC3596 CAC3680 CAC3681 0.40506 1.51803 1.07553 1.7949 2.70695...”
- A proteomic and transcriptional view of acidogenic and solventogenic steady-state cells of Clostridium acetobutylicum in a chemostat culture
Janssen, Applied microbiology and biotechnology 2010 - “...0.6 T CAC2709 etfA Electron transfer flavoprotein alpha-subunit 2.3 2.0 5.4 2.4 3.0 1.6 C CAC2711 bcd Butyryl-CoA dehydrogenase 2.0 1.8 6.1 2.4 3.1 2.0 I CAC2712 crt Enoyl-CoA hydratase 2.1 1.8 7.2 2.9 3.5 2.5 I CAC2810 Glucoamylase family protein 2.7 2.2 10.1 4.9 5.0...”
- “...A ( thlA , CAC2873), crotonase ( crt , CAC2712), butyryl-CoA dehydrogenase ( bcd , CAC2711), and the subunit of the electron transfer flavoprotein ( etfA , CAC2709). Otherwise, 3-hydroxybutyryl-CoA dehydrogenase ( hbd , CAC2708) and the second subunit of the electron transfer flavoprotein ( etfB...”
- The role of PerR in O2-affected gene expression of Clostridium acetobutylicum
Hillmann, Journal of bacteriology 2009 - “...CAC2452 CAC2458 CAC2459 CAC2499 CAC2708 CAC2709 CAC2710 CAC2711 CAC2712 CAC2873 CAC3075 CAC3076 CAC3657 CAC3658 CAC3659 Arginine biosynthesis CAC0316 CAC0376...”
- Transcriptional program of early sporulation and stationary-phase events in Clostridium acetobutylicum
Alsaker, Journal of bacteriology 2005 - “...crt (CAC2712), etfA (CAC2709), etfB (CAC2710), and bcd (CAC2711) generally increased in stationary phase but not more than 1.9-fold. Two previous analyses of...”
- Comparative analysis of gene expression among low G+C gram-positive genomes
Karlin, Proceedings of the National Academy of Sciences of the United States of America 2004 - “...Table 2. (continued) E(g)* Gene Butyryl-CoA dehydrogenase (CAC2711) Pyruvate ferredoxin oxidoreductase (CAC2229, CPE2061) BACSU BACHA (0.56) (0.48) (0.41) -...”
- Transcriptional analysis of spo0A overexpression in Clostridium acetobutylicum and its effect on the cell's response to butanol stress
Alsaker, Journal of bacteriology 2004 - “...hbd (CAC2708, encoding -hydroxybutyrylCoA dehydrogenase), bcd (CAC2711, encoding butyryl-CoA dehydrogenase), thl (CAC2873, encoding thiolase), and buk (CAC3075,...”
- Looking for the mechanism of arsenate respiration of Fusibacter sp. strain 3D3, independent of ArrAB
Acosta-Grinok, Frontiers in microbiology 2022 - “...3 10 141 Bcd Electron bifurcating butyryl-CoA dehydrogenase (NAD + , ferredoxin) WP_069875591 Clostridium acetobutylicum P52042 0 EtfA-1 Electron transfer flavoprotein, subunit WP_069871749 Clostridium saccharobutylicum P53578 5 10 128 EtfB-1 Electron transfer flavoprotein, subunit WP_069871747 Clostridium amylolyticum A0A1M6NXL2 2 10 133 LdhD Lactate/Glycolate dehydrogenase, subunit LdhD/GlcD...”
- New perspectives on butyrate assimilation in Rhodospirillum rubrum S1H under photoheterotrophic conditions
De, BMC microbiology 2020 - “...rubrum genome, of the butyryl-CoA dehydrogenase reviewed in Clostridium acetobutylicum [ 19 ] (accession number P52042) or Megasphaera elsdenii [ 20 ] (accession number Q06319). As already described in Desulfosarcina cetonica [ 4 ] in the context of butyrate catabolism, crotonyl-CoA is proposed to be further...”
- Quantitative proteomic analysis of the influence of lignin on biofuel production by Clostridium acetobutylicum ATCC 824
Raut, Biotechnology for biofuels 2016 - “...] also proposed in Clostridium kluyveri [ 68 ]. Interestingly, we identified butyryl-CoA dehydrogenase (Bcd) (CA_C2711), electron transfer flavoprotein (subunit etfA (CA_C2709) and etfB (CA_C2710) and probable NADH/NADPH oxidoreductase (CA_C1958) in both conditions, suggesting the presence of extra energy conserving modules in this bacterium. Conclusions In...”
- A Quantitative System-Scale Characterization of the Metabolism of Clostridium acetobutylicum
Yoo, mBio 2015 - “...and electron fluxes. The previously uncharacterized butyryl coenzyme A (butyryl-CoA) dehydrogenase (BCD) encoded by bcd-etfB-etfA (CA_C2711, CA_C2710, and CA_C2709, respectively) ( 42 ) was biochemically characterized via homologous expression of the encoding operon in C.acetobutylicum and the purification of the enzyme complex ( Table2 ; see...”
- “...potentially catalyze this reaction: the BCD complex encoded by bcd , etfB , and etfA (CA_C2711, CA_C2710, and CA_C2709, respectively) which consumes 2moles of NADH and produces 1mole of reduced ferredoxin (see Fig.S1 in the supplemental material) and TER ( trans -2-enoyl-CoA reductase) encoded by CA_C0642,...”
- Fermentation of oxidized hexose derivatives by Clostridium acetobutylicum
Servinsky, Microbial cell factories 2014 - “...kinase, CA_C1743; 17) hydroxybutyryl-CoA dehydrogenase, CA_C2009, CA_C2708; 18) crotonase, CA_C2012, CA_C2016, CA_C2712; 19) butyryl-CoA dehydrogenase, CA_C2711; 20) phosphotransbutyrylase, CA_C3076; 21) butyrate kinase, CA_C1660, CA_C3075; 22) galacturonate symporter, CA_C0694; 23) galacturonate isomerase, CA_C0692 24) altronate oxidoreductase, CA_C0695; 25) altronate dehydratase, CA_C0696; 26) 2-keto-3-deoxygluconokinase, CA_C0395; 27) 2-keto-3-deoxygluconate 6-phosphate...”
- Converting carbon dioxide to butyrate with an engineered strain of Clostridium ljungdahlii
Ueki, mBio 2014 - “...The amplified genes were thl (NCBI GenBank; CA_C2873), crt (NCBI GenBank; CA_C2712), bcd (NCBI GenBank; CA_C2711), etfB (NCBI GenBank, CA_C2710), etfA (NCBI GenBank; CA_C2709), hbd (NCBI GenBank; CA_C2708), buk (NCBI GenBank; CA_C3075), and ptb (NCBI GenBank; CA_C3076). Primers used for the PCR are listed in TableS1...”
- Rapid construction of metabolic models for a family of Cyanobacteria using a multiple source annotation workflow
Mueller, BMC systems biology 2013 - “...the adhA gene in Synechocystis 6803. EC-gene relationships: 2.3.1.9: CA_C2873, 1.1.1.36: CA_C2708, 4.2.1.17: CA_C2712, 1.3.99.2: CA_C2711, 1.2.1.10: CA_P0035, 1.1.1.-: slr1192. The proposed workflow also served to complete unfinished pathways from i Cyt773. All five models are capable of converting galactose-1-phosphate to fructose-6-phosphate as in i Cyt773....”
Cbei_0322 acyl-CoA dehydrogenase domain-containing protein from Clostridium beijerincki NCIMB 8052
45% identity, 98% coverage
- Model-driven approach for the production of butyrate from CO2/H2 by a novel co-culture of C. autoethanogenum and C. beijerinckii
Benito-Vaquerizo, Frontiers in microbiology 2022 - “...dehydrogenase/electron-transferring flavoprotein complex (Bcd-EtfAB) producing reduced ferredoxin. Two complete clusters were identified in the genome: Cbei_0322 (Bcd), Cbei_0323 (EtfB), and Cbei_0324 (EtfA) or Cbei_2035 (Bcd), Cbei_2036 (EtfB) and Cbei_2037 (EtfA). An acyl-CoA dehydrogenase (Acd) showed 79.4% similarity with the Bcd subunit of C. acetobutylicum ATCC 824....”
- Sigma Factor Regulated Cellular Response in a Non-solvent Producing Clostridium beijerinckii Degenerated Strain: A Comparative Transcriptome Analysis
Zhang, Frontiers in microbiology 2017 - “...Cbei_2037) catalyzing acetoacetyl-CoA into 3-hydroxybutyryl-CoA; Enoyl-CoA hydratase (Cbei_2231, Cbei_2230) catalyzing 3-hydroxybutyryl-CoA into crotonyl-CoA; butyryl-CoA dehydrogenase (Cbei_0322, Cbei_2035, Cbei_2883) catalyzing crotonyl-CoA into butyryl-CoA ( Figures 3D and 4C ; Supplementary Table S5f ). Cellular Aging and Scavenging Ability of Reactive Oxygen Species To investigate the differences in...”
- Transcriptional analysis of degenerate strain Clostridium beijerinckii DG-8052 reveals a pleiotropic response to CaCO3-associated recovery of solvent production
Jiao, Scientific reports 2016 - “...sensitivity to CaCO 3. The transcription of 3-hydroxybutyryl-CoA dehydrogenase (Cbei_0325), 3-hydroxybutyryl-CoA (Cbei_0324) and butyryl-CoA dehydrogenase (Cbei_0322) was not changed significantly by the addition of CaCO 3 to the DG-8052 culture. It is reported that phosphoenolpyruvate (PEP), pyruvate, and acetyl-CoA form three main key nodes in the...”
Elgi_67150 acyl-CoA dehydrogenase from Paenibacillus elgii
48% identity, 98% coverage
- Data on annotation and analysis of genome sequence of Paenibacillus elgii YSY-1.2, a promising chitinase-producing, plant-growth-promoting, and biocontrol agent
Tran, Data in brief 2024 - “...Elgi_17100 Nitrate transporter NarK Elgi_46520 ACC biosynthesis Acyl-CoA dehydrogenase FadE Elgi_23140 Acyl-CoA dehydrogenase Elgi_47060, Elgi_54500, Elgi_67150 Acyl-CoA dehydrogenase family protein Elgi_51250 Acyl-CoA dehydrogenase AcdA Elgi_54520 Iron uptake Iron ABC transporter permease Elgi_01060, Elgi_13560, Elgi_13570, Elgi_14480, Elgi_14540, Elgi_15350, Elgi_16730, Elgi_25990, Elgi_26000, Elgi_27700, Elgi_29320, Elgi_29330, Elgi_33950, Elgi_46590, Elgi_47580,...”
FN0783 Acyl-CoA dehydrogenase from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
45% identity, 96% coverage
Swol_0268 Butyryl-CoA dehydrogenase from Syntrophomonas wolfei subsp. wolfei str. Goettingen
47% identity, 98% coverage
- Stimulating Effect of Trichococcus flocculiformis on a Coculture of Syntrophomonas wolfei and Methanospirillum hungatei
Doloman, Applied and environmental microbiology 2022 - “...a TRAP-type transport system (Swol_0331), electron transfer flavoprotein (Swol_0266) and butyryl coenzyme A (butyryl-CoA) dehydrogenase (Swol_0268) ( Fig. 4A ; see also Table S1). Proteins Swol_0266 and Swol_0268 are in the same operon, while their isoforms, produced from genes located at a different chromosomal location, were...”
- “...critical for the syntrophic growth butyrate conversion step ( 17 , 18 ). Butyryl-CoA dehydrogenase (Swol_0268) catalyzes conversion of butyryl-CoA to crotonyl-CoA and passes the electrons to electron-transfer flavoproteins (Swol_0266). The originally characterized butyryl-CoA dehydrogenase (Swol_2052) by Schmidt et al. ( 17 ) was also detected...”
- Dynamic acylome reveals metabolite driven modifications in Syntrophomonas wolfei
Fu, Frontiers in microbiology 2022 - “...K18 (Acetyl, Butyryl) AEALINIAHPDLRDELVKEAQK 1 Swol_1932 4 K3(Acetyl) YQKLLEEYK 1 Swol_1932 12 K2(Butyryl) SKLVTADEAAK 2 Swol_0268 179 K5(Acetyl); M7(Oxidation) SLGGKGMSAFIISK 2 Swol_0268 194 K6(Acetyl) DNPGLKVGQHFYK 2 Swol_0268 227 K6(Acetyl) EDLLGKEGQGLQIAMSSFDHGR 2 Swol_0268 273 K5(Acetyl) VQFGKPISK 2 Swol_0384 42 K4(Acetyl, Butyryl) DDIKPVLGPILK 2 Swol_0384 343 K6(Acetyl, Butyryl,...”
- Involvement of NADH:acceptor oxidoreductase and butyryl coenzyme A dehydrogenase in reversed electron transport during syntrophic butyrate oxidation by Syntrophomonas wolfei
Müller, Journal of bacteriology 2009 - “...genes for butyryl-CoA dehydrogenases (bcd), one of which (Swol_0268) was colocated in a putative bcd-etfBA operon in synteny to that in C. kluyveri, and...”
CBY_3042 acyl-coa dehydrogenase, short-chain specific from Clostridium butyricum 5521
CLP_3853 acyl-CoA dehydrogenase from Clostridium butyricum E4 str. BoNT E BL5262
46% identity, 98% coverage
- Reduced catabolic protein expression in Clostridium butyricum DSM 10702 correlate with reduced 1,3-propanediol synthesis at high glycerol loading
Gungormusler-Yilmaz, AMB Express 2014 - “...0.26 0.32 0.38 0.33 CBY_3041 3-hydroxybutyryl-CoA dehydratase 0.50 0.29 1.17 1.11 NQ NQ NQ NQ CBY_3042 acyl-coa dehydrogenase (short-chain specific) 0.20 0.25 0.90 0.60 0.06 0.06 0.96 0.94 CBY_3045 3-hydroxybutyryl-coa dehydrogenase 0.24 0.20 1.16 1.28 0.31 0.06 0.04 0.30 CBY_3235 Glycerol dehydrogenase c 0.02 0.52 1.47...”
- Type E Botulinum Neurotoxin-Producing Clostridium butyricum Strains Are Aerotolerant during Vegetative Growth
Camerini, mSystems 2019 - “...1.55 Carbohydrate metabolism 10 488644944 CLP_0793 Pyruvate formate-lyase-activating enzyme 1.85 Fe-S Carbohydrate metabolism 11 489505871 CLP_3853 Butyryl-CoA dehydrogenase 0.95 Carbohydrate metabolism: butyrate synthesis pathway 12 489506129 CLP_3852 Electron transfer flavoprotein, beta subunit 1.13 Electron transfer Carbohydrate metabolism: butyrate synthesis pathway 13 906848776 CLP_3850 3-Hydroxybutyryl-CoA dehydrogenase 1.24...”
- “...box with a red arrow indicating their downmodulation. (CLP_0793, pyruvate formate-lyase-activating enzyme; CLP_3850, 3-hydroxybutyryl-CoA dehydrogenase; CLP_3853, butyryl-CoA dehydrogenase; CLP_3852, electron transfer flavoprotein, beta subunit). Furthermore, the proteomics analysis showed that three enzymes of the butyrate metabolic pathway were downregulated under AE conditions, suggesting that oxygen induced...”
FNP_1467 acyl-CoA dehydrogenase from Fusobacterium polymorphum ATCC 10953
45% identity, 96% coverage
D4QEZ8 short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) from Homo sapiens (see paper)
47% identity, 91% coverage
- HSP60 Regulates Lipid Metabolism in Human Ovarian Cancer
Li, Oxidative medicine and cellular longevity 2021 - “...sapiens GN=ACOX1 PE=3 SV=1[A0A024R8L7_HUMAN] ACOX1 29.85 14 14 23 74.64 7.62 1.53 3.40 E 02 D4QEZ8 Short-chain acyl-CoA dehydrogenase OS=Homo sapiens GN=ACADS PE=2 SV=1[D4QEZ8_HUMAN] ACADS 27.67 8 8 19 44.33 7.72 1.33 6.43 E 06 P45954 Short/branched chain-specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1[ACDSB_HUMAN]...”
- “...sapiens GN=ACAA1 PE=1 SV=2[THIK_HUMAN] ACAA1 46.23 4 14 50 44.26 8.44 2.70 1.00 E 02 D4QEZ8 Short-chain acyl-CoA dehydrogenase OS=Homo sapiens GN=ACADS PE=2 SV=1[D4QEZ8_HUMAN] ACADS 27.67 8 8 19 44.33 7.72 1.33 6.43 E 06 P45954 Short/branched chain-specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1[ACDSB_HUMAN]...”
- The Fatty Acid β-Oxidation Pathway is Activated by Leucine Deprivation in HepG2 Cells: A Comparative Proteomics Study
Yan, Scientific reports 2017 - “...5.621 P30038 Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial ALDH4A1 5.152*|- 5.152 P00480 Ornithine carbamoyltransferase, mitochondrial OTC 4.747*|- 4.747 D4QEZ8 Short-chain acyl-CoA dehydrogenase ACADS 4.739*|- 4.739 Q9Y365 PCTP-like protein STARD10 4.659*|- 4.659 B2RBJ5 Alanine-glyoxylate aminotransferase 2 (AGXT2), nuclear gene encoding mitochondrial protein AGXT2 3.959*|- 3.959 P83111 Serine beta-lactamase-like protein LACTB,...”
- “...Ala, Asp and Glu metabolism P00480 Ornithine carbamoyltransferase, mitochondrial OTC 4.747* Arg and Pro metabolism D4QEZ8 Short-chain acyl-CoA dehydrogenase ACADS 4.739* Val, Leu and Ile degradation B2RBJ5 Alanine-glyoxylate aminotransferase 2 AGXT2 3.959* Gly, Ser and Thr metabolism; Ala, Asp and Glu metabolism P26440 Isovaleryl-CoA dehydrogenase, mitochondrial...”
Q9VDT1 Activator-recruited cofactor subunit 42 from Drosophila melanogaster
47% identity, 92% coverage
Cbei_2035 acyl-CoA dehydrogenase domain-containing protein from Clostridium beijerincki NCIMB 8052
45% identity, 98% coverage
NP_978856 acyl-CoA dehydrogenase from Bacillus cereus ATCC 10987
47% identity, 98% coverage
- Acyl-CoA dehydrogenases: Dynamic history of protein family evolution
Swigonová, Journal of molecular evolution 2009 - “...proteins with homology to SCAD ( Fig. 6b ) in Acidobacteria bacterium (ABF41370), Bacillus cereus (NP_978856), and Geobacillus kaustophilus (YP_147450). With the exception of the active site catalytic residue position and the residue equivalent to human IVD Y371, which is distant in the active site, other...”
DSY1568 hypothetical protein from Desulfitobacterium hafniense Y51
44% identity, 96% coverage
B5Y5R5 Short chain acyl-coenzyme A dehydrogenase from Phaeodactylum tricornutum (strain CCAP 1055/1)
47% identity, 86% coverage
CLNEO_29850 acyl-CoA dehydrogenase from Anaerotignum neopropionicum
44% identity, 97% coverage
TO73_1043 acyl-CoA dehydrogenase family protein from Thermus aquaticus Y51MC23
45% identity, 98% coverage
BA2547 acyl-CoA dehydrogenase from Bacillus anthracis str. Ames
47% identity, 98% coverage
BSU18260 acyl-CoA dehydrogenase, short-chain specific from Bacillus subtilis subsp. subtilis str. 168
47% identity, 98% coverage
- The program of gene transcription for a single differentiating cell type during sporulation in Bacillus subtilis
Eichenberger, PLoS biology 2004 - “...ylbJ (BSU15030), ylbO/gerR (BSU15090), yngE (BSU18210), yngF (BSU18220), yngG (BSU18230), yngH (BSU18240), yngI (BSU18250), yngJ (BSU18260), yoaB (BSU18540), yoaD (BSU18560), yodU (BSU19810), ypqA (BSU22240), ypqP (BSU21670), yqfT (BSU25120), yqhV (BSU24440), yrdK (BSU26680), yydB (BSU40220), yydC (BSU40210), yydD (BSU40200), yydG (BSU40170), yydH (BSU40160), yydI (BSU40150), and yydJ...”
ACADS_BOVIN / Q3ZBF6 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Bos taurus (Bovine) (see paper)
48% identity, 91% coverage
- function: Short-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats. The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA (By similarity). Among the different mitochondrial acyl-CoA dehydrogenases, short-chain specific acyl-CoA dehydrogenase acts specifically on acyl- CoAs with saturated 4 to 6 carbons long primary chains (PubMed:6712627).
catalytic activity: a short-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a short-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:47196)
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
cofactor: FAD (Binds 1 FAD per subunit.)
subunit: Homotetramer.
Dtox_1697 acyl-CoA dehydrogenase domain protein from Desulfotomaculum acetoxidans DSM 771
46% identity, 96% coverage
- Complete genome sequence of Desulfotomaculum acetoxidans type strain (5575)
Spring, Standards in genomic sciences 2009 - “...related homoacetogenic bacterium Moorella thermoacetica ( cooC/acsE ) [ 31 ]. A cluster of genes (Dtox_1697 to 1703) that is probably required for growth with butyrate as substrate could be also identified. It has been reported that acetate accumulates upon growth on butyrate and that acetate...”
CD630_03990, CDIF630erm_00527 putative isocaproyl-CoA dehydrogenase AcdB from Clostridioides difficile 630
CD0399 acyl-CoA dehydrogenase, short-chain specific from Clostridium difficile 630
46% identity, 99% coverage
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...OFF -10.52 OFF CD630_03980 CDIF630erm_00526 hadC Oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase subunit C -7.81 -4.86 -10.94 OFF CD630_03990 CDIF630erm_00527 acdB Acyl-CoA dehydrogenase -7.43 -4.27 -10.17 -4.76 CD630_04000 CDIF630erm_00528 etfB1 Electron transfer flavoprotein subunit beta -7.28 -3.90 -10.48 -4.50 CD630_04010 CDIF630erm_00529 etfA1 Electron transfer flavoprotein subunit alpha -7.50 -3.90...”
- “...-10.52 OFF CD630_03980 CDIF630erm_00526 hadC Oxygen-sensitive 2-hydroxyisocaproyl-CoA dehydratase subunit C -7.81 -4.86 -10.94 OFF CD630_03990 CDIF630erm_00527 acdB Acyl-CoA dehydrogenase -7.43 -4.27 -10.17 -4.76 CD630_04000 CDIF630erm_00528 etfB1 Electron transfer flavoprotein subunit beta -7.28 -3.90 -10.48 -4.50 CD630_04010 CDIF630erm_00529 etfA1 Electron transfer flavoprotein subunit alpha -7.50 -3.90 -10.39...”
- Global transcriptional control by glucose and carbon regulator CcpA in Clostridium difficile
Antunes, Nucleic acids research 2012 - “...expression of ldhA , hadA , hadI , acdB and etfB1 genes (CD0394, CD0395, CD0396, CD0399 and CD0400) required for the leucine reductive branch leading to the formation of isocaproate was 4-fold repressed by glucose by a CcpA-dependent mechanism ( Figure 7 ). We also identified...”
- “...ldhA (CD0394), 2-hydroxyisocaproate dehydrogenase; hadA (CD0395), 2-hydroxyisocaproate CoA transferase; hadI (CD0396), activator of dehydratase; acdB (CD0399), acyl-CoA dehydrogenase; gcvTPA (CD1657), bi-functional glycine dehydrogenase/aminomethyl transferase protein; gcvPB (CD1658), Glycine decarboxylase; CD1228, putative protease; CD3183, putative peptidase; CD2485, putative Xaa-Pro aminopeptidase; CD2347, putative Xaa-Pro dipeptidase; gcp (CD0152), putative...”
B7P7P2 Medium-chain acyl-CoA dehydrogenase, putative (Fragment) from Ixodes scapularis
46% identity, 91% coverage
Q1D5Y1 Acyl-CoA dehydrogenase from Myxococcus xanthus (strain DK1622)
46% identity, 97% coverage
- Proteome Analyses of Soil Bacteria Grown in the Presence of Potato Suberin, a Recalcitrant Biopolymer
Sidibé, Microbes and environments 2016 - “...0.03 I Q1D5Y4 3-hydroxybutyryl-CoA dehydratase 0.05 I Q1D8V2 acetyl-coenzyme A carboxylase carboxyl transferase 0.05 I Q1D5Y1 acyl-CoA dehydrogenase 0.04 I Q1D5W1 patatin-like phospholipase 0.01 E Q1D5V2 3-oxoacid CoA-transferase 0.07 I Q1D855 long-chain-fatty-acid-CoA ligase 0.02 I Q1D566 acyltransferase 0.02 I Q1CZW5 acyl-CoA dehydrogenase 0.02 0.02 I Q1D003...”
- “...I4WPU1 a , I4WM78 a , M4NHA9 a , I4W091 b Q1D3D6, Q1D4E4 b , Q1D5Y1 b , Q1CZW5, A0A0H4WWQ8 enoyl-CoA hydratase I4WR77 b , I4WPL0 Q1D5U2 b 3-hydroxyacyl-CoA dehydrogenase I4WIC4, I4VRU7 a Q1D5U1 b , Q1D233 b acetyl-CoA acetyltransferase I4WBZ6, I4WIC3 Q1D5VO, Q1D234 b ,...”
CBO3288 acyl-CoA dehydrogenase from Clostridium botulinum A str. ATCC 3502
46% identity, 99% coverage
- Transcriptomic analysis of (group I) Clostridium botulinum ATCC 3502 cold shock response
Dahlsten, PloS one 2014 - “...cbo3544 [ prsA ]), energy metabolism ( cbo1489 , cbo1498 , cbo3242 , cbo3244 , cbo3288 [ acdA ]), transcription or translation ( cbo2434 [ tsf ], cbo2939 [ dnaG ]), cobalamin biosynthesis ( cbo0410 , cbo0914-cbo0916 [ cobQ-cbiB-cobD ]), or cell wall synthesis ( cbo0791...”
U3J8W0 short-chain acyl-CoA dehydrogenase from Anas platyrhynchos platyrhynchos
48% identity, 96% coverage
- Dietary riboflavin supplementation improves meat quality, antioxidant capacity, fatty acid composition, lipidomic, volatilomic, and proteomic profiles of breast muscle in Pekin ducks
Tang, Food chemistry: X 2023 - “...acyl-CoA dehydrogenase ACADL 8.39 3.16E06 U3ITA9 Medium chain specific acyl-CoA dehydrogenase ACADM 9.28 6.71 E07 U3J8W0 Short chain acyl-CoA dehydrogenase ACADS 2.68 2.60 E03 U3I5L4 Long chain fatty acid CoA ligase 6 ACSL6 2.39 4.56 E07 U3IR48 Dihydrolipoyl dehydrogenase DLD 3.01 1.41 E03 R0K2W7 Glycerol-3-phosphate dehydrogenase...”
- Effect of riboflavin deficiency on intestinal morphology, jejunum mucosa proteomics, and cecal microbiota of Pekin ducks
Xu, Animal nutrition (Zhongguo xu mu shou yi xue hui) 2023 - “...dehydrogenase long chain ACADL 2.80 2.14E-07 U3ITA9 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial ACADM 1.85 5.84E-04 U3J8W0 Acyl-CoA dehydrogenase short chain ACADS 2.08 2.18E-05 U3J1J0 Acyl-CoA dehydrogenase family member 9 ACAD9 2.42 1.00E-04 R0LSV8 Electron transfer flavoprotein-ubiquinone oxidoreductase ETFDH 2.31 3.88E-05 U3IM27 Aldedh domain-containing protein ALDH2 2.17...”
- Maternal diet deficient in riboflavin induces embryonic death associated with alterations in the hepatic proteome of duck embryos
Tang, Nutrition & metabolism 2019 - “...2.90 4.26E-04 U3J7F4 Electron transfer flavoprotein alpha subunit ETFA 62.87 17 17 2.69 1.46E-02 FAD U3J8W0 Acyl-CoA dehydrogenase short chain ACADS 49.30 14 14 2.36 4.32E-03 FAD U3IFB0 2,4-dienoyl-CoA reductase 1 DECR1 39.20 9 9 2.32 2.32E-02 U3I806 Trifunctional enzyme subunit alpha, mitochondrial HADHA 53.42 39...”
TTC0779 No description from Thermus thermophilus HB27
45% identity, 98% coverage
- Transposon mutagenesis of the extremely thermophilic bacterium Thermus thermophilus HB27
Carr, Extremophiles : life under extreme conditions 2015 - “...UDP-N-acetylglucosamine 2-epimerase 1 JC1054 TTC0600 livF ; branched-chain amino acid transport ATP-binding protein 1 JC949 TTC0779 acyl-CoA dehydrogenase 1 JC1093 TTC0980 mannose-6-phosphate isomerase 2 e.g. JC915 TTC1005 serine protease-like protein 1 JC848 intergenic TTC1044-1045 between ccdA , cytochrome C-type biogenesis protein and cytochrome c 1 JC1099...”
SE37_11180 acyl-CoA dehydrogenase from Geobacter soli
44% identity, 98% coverage
- Genome sequence of a dissimilatory Fe(III)-reducing bacterium Geobacter soli type strain GSS01(T)
Yang, Standards in genomic sciences 2015 - “...of G. soli : acyl-CoA dehydrogenase (SE37_11155, 80% similarity to Gmet_1710 in G. metallireducens ; SE37_11180, 86% similarity to that of Geoalkalibacter subterraneus ), succinyl-CoA:acetate CoA-transferases (SE37_00360; SE37_11235, 83% similarity to Gbem_2843 in G. bemidjiensis ; SE37_13685), acyl-CoA thioesterases (SE37_09325, SE37_09950, SE37_10860, SE37_14445 and SE37_15385), enoyl-CoA...”
TTHA1144 acetyl-Coenzyme A dehydrogenase, medium chain from Thermus thermophilus HB8
45% identity, 91% coverage
- Identification and characterization of preferred DNA-binding sites for the Thermus thermophilus transcriptional regulator FadR
Lee, PloS one 2017 - “...0.0249 CTGTACTCGGTATAA +23 ~ TTHA1634 1089565 1089579 8.10e-08 0.0249 TTTGACCGAGTCTAA 52 Y TTHA1143 +42 Y TTHA1144 103944 103958 6.68e-07 0.135 TTGGACCTGGTAAAA 8 Y TTHA0103 724515 724529 6.99e-07 0.135 CTGGACTTGGTCTAA +909 N TTHA0758 ( P -value) Defined as the probability of a random sequence of the same...”
- “...receiver domain-containing protein 121.8/62.9 1.9 0.228 3 TTHA1141 cation-transporting ATPase 2421.4/854.7 2.8 5.46e-2 Y 1 TTHA1144 acetyl-coenzyme A dehydrogenase medium subunit 6247.9/1088.1 5.7 1.26e-3 2 TTHA1145 electron transfer flavoprotein subunit beta 6786.9/1190.5 5.7 2.26e-3 3 TTHA1146 electron transfer flavoprotein subunit alpha 4030.9/866.5 4.7 1.79e-3 Y 1...”
acdA / J7TF92 cinnamate reductase monomer (EC 1.3.8.15) from Clostridium sporogenes (strain ATCC 15579) (see 6 papers)
ACDA_CLOS1 / J7TF92 3-(aryl)acrylate reductase; EC 1.3.8.15 from Clostridium sporogenes (strain ATCC 15579) (see paper)
J7TF92 3-(aryl)acrylate reductase (EC 1.3.8.15) from Clostridium sporogenes (see paper)
CLOSPO_00312 hypothetical protein from Clostridium sporogenes ATCC 15579
46% identity, 99% coverage
- function: Essential for the reductive metabolism of L-phenylalanine, L- tyrosine and L-tryptophan (PubMed:29168502). Catalyzes the reduction of phenylacrylic acid to phenylpropionic acid, 4-hydroxy-phenylacrylic acid to 4-hydroxy-phenylpropionic acid, and indoleacrylic acid to indolepropionic acid (PubMed:29168502).
catalytic activity: 3-phenylpropanoate + oxidized [electron-transfer flavoprotein] + H(+) = (E)-cinnamate + reduced [electron-transfer flavoprotein] (RHEA:59996)
catalytic activity: phloretate + oxidized [electron-transfer flavoprotein] + H(+) = (E)-4-coumarate + reduced [electron-transfer flavoprotein] (RHEA:59992)
catalytic activity: indole-3-propanoate + oxidized [electron-transfer flavoprotein] + H(+) = (E)-3-(indol-3-yl)acrylate + reduced [electron-transfer flavoprotein] (RHEA:60104)
cofactor: FAD
disruption phenotype: Mutants are deficient in reductive metabolism of phenylalanine, tyrosine and tryptophan, and exhibit growth defects when cultured with amino acids as the sole carbon source. - Linking microbial genes to plasma and stool metabolites uncovers host-microbial interactions underlying ulcerative colitis disease course
Schirmer, Cell host & microbe 2024 (secret) - A gut bacterial pathway metabolizes aromatic amino acids into nine circulating metabolites
Dodd, Nature 2017 - “...action of acyl-CoA transferase (FldA, CLOSPO_00308). Finally, the arylacrylates are reduced by acyl-CoA dehydrogenase (AcdA, CLOSPO_00312) involving its two electron transport factors (EtfA-EtfB, CLOSPO_00313-314). For the oxidative pathway, phenylpyruvate and 4-OH-phenylpyruvate are first oxidatively decarboxylated by pyruvate:ferredoxin oxidoreductase A (PorA, CLOSPO_00147-149), followed by phosphate acyltransferase and...”
R0JG91 short-chain acyl-CoA dehydrogenase (Fragment) from Anas platyrhynchos
49% identity, 91% coverage
I4W091 Acyl-CoA dehydrogenase domain-containing protein from Rhodanobacter fulvus Jip2
47% identity, 96% coverage
- Proteome Analyses of Soil Bacteria Grown in the Presence of Potato Suberin, a Recalcitrant Biopolymer
Sidibé, Microbes and environments 2016 - “...YdiF, acetate-CoA transferase 0.13 I I4VY74 3-oxoacyl-ACP reductase 0.07 I I4VZY3 acetoacetyl-CoA reductase 0.06 E I4W091 acyl-CoA dehydrogenase domain-containing protein 0.04 I I4WAL3 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase 0.08 E I4WAL4 -ketoacyl-[ACP] synthase I 0.12 0.43 E I4WAZ2 acetoacetyl-CoA thiolase 0.66 0.66 E I4WB09 3-hydroxybutyryl-CoA dehydratase 0.13 I I4WB55...”
- “...I4WM94 a , I4WM95 a , I4WPU1 a , I4WM78 a , M4NHA9 a , I4W091 b Q1D3D6, Q1D4E4 b , Q1D5Y1 b , Q1CZW5, A0A0H4WWQ8 enoyl-CoA hydratase I4WR77 b , I4WPL0 Q1D5U2 b 3-hydroxyacyl-CoA dehydrogenase I4WIC4, I4VRU7 a Q1D5U1 b , Q1D233 b acetyl-CoA acetyltransferase...”
1ukwA / Q72JJ3 Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
45% identity, 98% coverage
- Ligand: flavin-adenine dinucleotide (1ukwA)
ANACAC_00253 hypothetical protein from Anaerostipes caccae DSM 14662
46% identity, 95% coverage
EHLA_0977 acyl-CoA dehydrogenase from Anaerobutyricum hallii
47% identity, 97% coverage
- Unravelling lactate-acetate and sugar conversion into butyrate by intestinal Anaerobutyricum and Anaerostipes species by comparative proteogenomics
Shetty, Environmental microbiology 2020 - “...between the two comparisons (including those encoded by genes with locus tags EHLA_0973, EHLA_0974, EHLA_0976, EHLA_0977, EHLA_0978, EHLA_0979) that were induced by growth on d , l lactate. Proteins with significantly higher abundance during growth on d , l lactate included lactate permease, lactate dehydrogenase, electron...”
Sfum_3931 acyl-CoA dehydrogenase domain protein from Syntrophobacter fumaroxidans MPOB
45% identity, 93% coverage
- Complete genome sequence of Syntrophobacter fumaroxidans strain (MPOB(T))
Plugge, Standards in genomic sciences 2012 - “...this gene cluster, as are genes for a putative hydroxylase (Sfum_3932) and an acyl-CoA dehydrogenase (Sfum_3931). Additionally, a gene annotated as an FAD-dependent oxidoreductase (Sfum_3927) and one encoding a 4Fe-4S ferredoxin-binding domain (Sfum_3926) are part of this gene cluster. Genes predicted to encode a sigma 54-dependent...”
CLOSPO_02759 hypothetical protein from Clostridium sporogenes ATCC 15579
44% identity, 99% coverage
bcd / A0A1G6BBN2 butanoyl-CoA dehydrogenase monomer from Eubacterium oxidoreducens (see paper)
45% identity, 97% coverage
Shewana3_2769 Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12) from Shewanella sp. ANA-3
46% identity, 97% coverage
- mutant phenotype: Specifically important for: L-Isoleucine. specificity for isoleucine indicates that 2-methylbutanoyl-CoA is a substrate
RBIBE_18460 acyl-CoA dehydrogenase family protein from Bacillus velezensis
47% identity, 98% coverage
- Complete genome sequence data of chitin-degrading Bacillus velezensis RB.IBE29
Tran, Data in brief 2023 - “...reductase RBIBE_02980 Nitrite reductase small subunit NirD RBIBE_02970 ACC biosynthesis Acyl-CoA dehydrogenase RBIBE_22770 Acyl-CoA dehydrogenase RBIBE_18460 Acyl-CoA dehydrogenase FadE RBIBE_30110 Acyl-CoA dehydrogenase family protein RBIBE_04320 Acyl-CoA synthetase RBIBE_09970 Iron uptake and siderophore production Iron ABC transporter permease RBIBE_01700 Iron ABC transporter permease RBIBE_35840 Iron ABC transporter...”
Q1CZW5 Acyl-CoA dehydrogenase from Myxococcus xanthus (strain DK1622)
43% identity, 94% coverage
- Proteome Analyses of Soil Bacteria Grown in the Presence of Potato Suberin, a Recalcitrant Biopolymer
Sidibé, Microbes and environments 2016 - “...E Q1D5V2 3-oxoacid CoA-transferase 0.07 I Q1D855 long-chain-fatty-acid-CoA ligase 0.02 I Q1D566 acyltransferase 0.02 I Q1CZW5 acyl-CoA dehydrogenase 0.02 0.02 I Q1D003 -ketothiolase 0.02 0.13 I A0A0H4WWQ8 acyl-CoA dehydrogenase 0.02 I a Data are the mean of two replicates. b E: extracellular; I: intracellular. c :...”
- “...I4WM78 a , M4NHA9 a , I4W091 b Q1D3D6, Q1D4E4 b , Q1D5Y1 b , Q1CZW5, A0A0H4WWQ8 enoyl-CoA hydratase I4WR77 b , I4WPL0 Q1D5U2 b 3-hydroxyacyl-CoA dehydrogenase I4WIC4, I4VRU7 a Q1D5U1 b , Q1D233 b acetyl-CoA acetyltransferase I4WBZ6, I4WIC3 Q1D5VO, Q1D234 b , BKT b ,...”
Elgi_54500 acyl-CoA dehydrogenase family protein from Paenibacillus elgii
45% identity, 99% coverage
- Data on annotation and analysis of genome sequence of Paenibacillus elgii YSY-1.2, a promising chitinase-producing, plant-growth-promoting, and biocontrol agent
Tran, Data in brief 2024 - “...transporter Elgi_17100 Nitrate transporter NarK Elgi_46520 ACC biosynthesis Acyl-CoA dehydrogenase FadE Elgi_23140 Acyl-CoA dehydrogenase Elgi_47060, Elgi_54500, Elgi_67150 Acyl-CoA dehydrogenase family protein Elgi_51250 Acyl-CoA dehydrogenase AcdA Elgi_54520 Iron uptake Iron ABC transporter permease Elgi_01060, Elgi_13560, Elgi_13570, Elgi_14480, Elgi_14540, Elgi_15350, Elgi_16730, Elgi_25990, Elgi_26000, Elgi_27700, Elgi_29320, Elgi_29330, Elgi_33950, Elgi_46590,...”
P79273 Short-chain specific acyl-CoA dehydrogenase, mitochondrial from Sus scrofa
46% identity, 91% coverage
- Evaluating nursery pig responses to in-feed sub-therapeutic antibiotics
Helm, PloS one 2019 - “...Ras-related protein Rab-14 Q52NJ6 -0.966 0.045 Phostensin Q767M0 1.124 0.043 Short-chain specific acyl-CoA dehydrogenase, mitochondrial P79273 0.564 0.041 Longissimus muscle Elongation factor 1-gamma (Fragment) Q29387 -0.793 0.001 Malate dehydrogenase, cytoplasmic P11708 -0.458 0.049 Liver 40S ribosomal protein S12 P46405 0.251 0.025 40S ribosomal protein S20 A1XQU9...”
- Reproducible ion-current-based approach for 24-plex comparison of the tissue proteomes of hibernating versus normal myocardium in swine models
Qu, Journal of proteome research 2014 - “...carnitine O -palmitoyltransferase1, muscle isoform 0.71 PCCB P79384 propionyl-CoAcarboxylasebetachain 0.76 ACADL P79274 long-chainspecificacyl-CoAdehydrogenase 0.75 ACADS P79273 short-chainspecificacyl-CoAdehydrogenase 0.76 ACADV P49748 verylong-chainspecificacyl-CoA dehydrogenase 0.79 Amino Acid Catabolism, Mitochondrial IVD P26440 isovaleryl-CoAdehydrogenase 0.55 MMSA Q02252 methylmalonate-semialdehyde dehydrogenase [acylating] 0.61 Out of 113 quantifiable proteins localizing to mitochondrion, 17...”
CPS_RS12125 acyl-CoA dehydrogenase family protein from Colwellia psychrerythraea 34H
46% identity, 97% coverage
CPE0097 acyl-CoA dehydrogenase from Clostridium perfringens str. 13
43% identity, 98% coverage
PGN_1172 acyl-CoA dehydrogenase short-chain specific from Porphyromonas gingivalis ATCC 33277
43% identity, 98% coverage
- Insights into Dynamic Polymicrobial Synergy Revealed by Time-Coursed RNA-Seq
Hendrickson, Frontiers in microbiology 2017 - “...TonB-dependent receptor 0.56 0.52 0.50 0.80 1.00 PGN_1111 formate-tetrahydrofolate ligase 0.56 0.01 0.79 0.65 0.70 PGN_1172 acyl-CoA dehydrogenase short-chain specific 0.95 0.89 0.64 0.63 0.64 PGN_1186 rprY , DNA-binding response regulator 0.85 0.37 0.10 0.12 0.71 PGN_1206 putative methylenetetrahydrofolate dehydrogenase 0.07 0.08 0.25 0.57 0.51 PGN_1221...”
PG1076 acyl-CoA dehydrogenase, short-chain specific from Porphyromonas gingivalis W83
43% identity, 98% coverage
- Protective role of the PG1036-PG1037-PG1038 operon in oxidative stress in Porphyromonas gingivalis W83
Henry, PloS one 2013 - “...PG1080 * 3-hydroxybutyryl-CoA dehydrogenase 30 kDa Fatty acid and phospholipid metabolism Oxidoreductase activity; Coenzyme binding PG1076 Butyryl-CoA dehydrogenase 42 kDa Fatty acid and phospholipid metabolism Acyl-CoA dehydrogenase activity; Oxidoreductase activity, acting on the CH-CH group of donors; FAD binding PG1069 Zinc-containing alcohol dehydrogenase 37 kDa Energy...”
- Response of Porphyromonas gingivalis to heme limitation in continuous culture
Dashper, Journal of bacteriology 2009 - “...7 PG0690h PG0691h PG0692 8 PG1067 9 PG1068 10 11 PG1075h PG1076 12 PG1078 13 14 PG1079h PG1081 15 PG1082 16 PG1232 17 PG1271 18 PG1417 19 PG1612 20 PG1614 21...”
- “...involved in glutamate catabolism, acyl-CoA dehydrogenase (PG1076) and the subunit of an electron transfer flavoprotein (PG1078), significantly increased...”
- Comparative transcriptomic analysis of Porphyromonas gingivalis biofilm and planktonic cells
Lo, BMC microbiology 2009 - “...branching point in this pathway between butyrate and propionate end-products. Three genes PG0690, PG1075 and PG1076 encoding 4-hydroxybutyrate CoA-transferase, the coenzyme A transferase beta subunit and acyl-CoA dehydrogenase (short-chain specific) respectively, that are in the pathway branch that produces butyrate, were down-regulated, as were a cluster...”
- Role of oxyR in the oral anaerobe Porphyromonas gingivalis
Diaz, Journal of bacteriology 2006 - “...PG1540 PG1124 PG0257 PG0888 PG1089 PG1960 PG0385 PG0707 PG1076 PG0037 PG0595 PG2117 PG1134 PG1108 PG0594 PG0193 PG1542 PG0434 Alkyl hydroperoxide reductase, C...”
HMPREF0389_00744 acyl-CoA dehydrogenase from Filifactor alocis ATCC 35896
46% identity, 98% coverage
- FACIN, a Double-Edged Sword of the Emerging Periodontal Pathogen Filifactor alocis: A Metabolic Enzyme Moonlighting as a Complement Inhibitor
Jusko, Journal of immunology (Baltimore, Md. : 1950) 2016 - “...HMPREF0389_01570 Acetylornithine aminotransferase 849/1.72 36(32) 44653 4 HMPREF0389_01649 NAD-specific glutamate dehydrogenase 145/0.22 4(4) 47231 5 HMPREF0389_00744 Butyryl-CoA dehydrogenase 665/1.15 18(17) 41459 5 HMPREF0389_00567 Glyceraldehyde-3-phosphate dehydrogenase 102/0.18 2(2) 37599 a Accession numbers and protein descriptions are from the NCBI- F. alocis genome project ( http://www.ncbi.nlm.nih.gov/genomeprj/30485 ) b...”
- Proteome variation among Filifactor alocis strains
Aruni, Proteomics 2012 - “...Nonsecretory 35. HMPREF0389_01465 Conserved hypothetical protein 41.5 29/0.13 4 C-7.5 EC-0.73 Hydrolase domain Nonsecretory 36. HMPREF0389_00744 Butryl coA dehydrogenase 41.25 11/0.07 2 C-7.5 EC-0.73 Acetyl coA DH1 and DH2 domain Nonsecretory 37. HMPREF0389_00745 Acetyl coA acetyl transfserase 40.9 51/0.07 9 C-7.2 EC-0.93 Thiolase 1,2,3 domain Nonsecretory...”
DDB_G0288647 acyl-CoA dehydrogenase from Dictyostelium discoideum AX4
44% identity, 89% coverage
SO1679 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) from Shewanella oneidensis MR-1
SO1679, SO_1679 methylbutyrl-CoA oxidoreductase from Shewanella oneidensis MR-1
45% identity, 97% coverage
- mutant phenotype: # Specifically important in carbon source L-Isoleucine; nitrogen source L-Isoleucine (EC 1.3.8.5). Similar to ACAD8_HUMAN (Isobutyryl-CoA dehydrogenase, mitochondrial).
- Evidence-based annotation of gene function in Shewanella oneidensis MR-1 using genome-wide fitness profiling across 121 conditions
Deutschbauer, PLoS genetics 2011 - “...oxidoreductase New SO_1670 200835 Fumarylacetoacetate hydrolase Confirmed Complementation SO_1677 200842 Acetyl-CoA/2-methyl-acetyl-CoA acetyltranferase Expanded Multiple mutants SO_1679 200844 Methylbutyrl-CoA oxidoreductase Confirmed Multiple mutants SO_1683 200848 Putative 2-methyl-3-hydroxybutyryl-CoA dehydrogenase New SO_1854 201016 Outer membrane protein required for motility and nitrate resistance New Multiple mutants SO_1913 201074 Chaperone for...”
- In vivo identification of the outer membrane protein OmcA-MtrC interaction network in Shewanella oneidensis MR-1 cells using novel hydrophobic chemical cross-linkers
Zhang, Journal of proteome research 2008 - “...SO0229 SO0217 SO4749 SO1142 SO4747 SO2638 SO0314 SO3032 SO1679 SOA0112 SO1521 SO3532 SO0021 SO0256 SO4030 SO1295 SO3440 SO1779 SO3542 C denotes cytoplasmic, and...”
- Empirical evaluation of a new method for calculating signal-to-noise ratio for microarray data analysis
He, Applied and environmental microbiology 2008 - “...prepared as previously described (12). Briefly, four genes (SO1679, SO1744, SO2680, and SO0848) were selected from the Shewanella oneidensis MR-1 genome. For...”
- Use of microarrays with different probe sizes for monitoring gene expression
He, Applied and environmental microbiology 2005 - “...targets or synthesized oligonucleotide targets of four loci (SO1679, SO1744, SO2680, and SO0848) were used for hybridization. Five picograms of PCR target per...”
- “...SO0017 SO1383 SO2743 SO4180 SO2320 SO3051 SO2697 SO4661 SO1679 SO2389 SO2953 SO2113 SO2654 SO1157 SO2930 SO1277 SO2886 b 70-mer gene arrays were used, the...”
- Empirical establishment of oligonucleotide probe design criteria
He, Applied and environmental microbiology 2005 - “...the software, PRIMEGENS (33) based on four genes (SO1679, SO1744, SO2680, and SO0848) from the Shewanella oneidensis MR-1 genome. The mismatch (MM) probes were...”
- “...probe signal intensity) was observed for target gene SO1679 at a probe-target identity of 90%, whereas at the same identity relatively strong signals...”
HVO_2716 acyl-CoA dehydrogenase from Haloferax volcanii DS2
47% identity, 98% coverage
Dred_1782 Butyryl-CoA dehydrogenase from Desulfotomaculum reducens MI-1
45% identity, 98% coverage
- Comparative Proteomic Analysis of Desulfotomaculum reducens MI-1: Insights into the Metabolic Versatility of a Gram-Positive Sulfate- and Metal-Reducing Bacterium
Otwell, Frontiers in microbiology 2016 - “...0.39 (0.01) 3.29 (<0.01) C Dred_1781 Enoyl-CoA hydratase/isomerase 2.12 (<0.01) 2.12 (<0.01) 4.07 (<0.01) C Dred_1782 butyryl-CoA dehydrogenase 0.62 (0.02) 0.17 1.84 (<0.01) C Dred_1783 Hypothetical protein (HdrD) 0.98 (<0.01) 0.87 (<0.01) 1.87 (<0.01) CM Dred_1784 Acetyl-CoA acetyltransferase 0.71 (<0.01) 0.41 3.49 (<0.01) C Protein identification...”
- “...17.2 on pyruvate, 20.8 on sulfate, and 8.0 on Fe(III)-oxide. Five proteins in this cluster (Dred_1782, Dred_1784, and Dred_1778-80) fall into the top 20 proteins across the Fe(III)-citrate proteome with respect to highest unique peptide counts. This result is surprising because these genes are predicted to...”
2dvlA / Q5SH14 Crystal structure of project tt0160 from thermus thermophilus hb8
50% identity, 99% coverage
- Ligand: flavin-adenine dinucleotide (2dvlA)
CLOAM1274 Acyl-CoA dehydrogenase from Candidatus Cloacamonas acidaminovorans
44% identity, 98% coverage
- A novel acyl-CoA beta-transaminase characterized from a metagenome
Perret, PloS one 2011 - “...bifurcation [21] , [22] . The genome of Candidatus Cloacamonas acidaminovorans contains good candidate genes (CLOAM1274, 1482, and 0104) coding for a butyryl-CoA dehydrogenase/electron-transferring-flavoprotein complex (Bcd/EtfAB). However, the formation of crotonyl-CoA from acetoacetyl-CoA or other metabolites remains enigmatic, because no genes coding for 3-hydroxybutyryl-CoA dehydrogenase (EC...”
Acfer_1583 acyl-CoA dehydrogenase domain protein from Acidaminococcus fermentans DSM 20731
45% identity, 99% coverage
- Complete genome sequence of Acidaminococcus fermentans type strain (VR4)
Chang, Standards in genomic sciences 2010 - “...encoded at the beginning of the gene cluster. Three acyl-CoA dehydrogenase genes (Acfer_1477, Acfer_1575 and Acfer_1583) were annotated at various locations, completing the pathway. Nevertheless, genes encoding 2-hydroxyglutarate dehydrogenase and Butyl-CoA:acetate CoA transferase have not yet been identified. Possibly these enzymes have additional functions in other...”
- “...decarboxylase sodium pump, subunit r Acfer_1477 acyl-CoA dehydrogenase domain protein Acfer_1575 acyl-CoA dehydrogenase domain protein Acfer_1583 acyl-CoA dehydrogenase domain protein Enzymes of -lactamase and the related Acfer_0250 -lactamase domain-containing protein Acfer_0522 Zn-dependent hydrolase of the -lactamase fold Acfer_0551 RNA-metabolizing metallo--lactamase Acfer_0879 -lactamase class A-like Acfer_1020 RNA-metabolizing...”
Theos_1509 acyl-CoA dehydrogenase family protein from Thermus oshimai JL-2
43% identity, 98% coverage
CARC_ACEWD / H6LGM6 Caffeyl-CoA reductase-Etf complex subunit CarC; Caffeoyl-CoA reductase CarC; NADH-dependent caffeyl-CoA reduction; EC 1.3.1.108 from Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) (see paper)
H6LGM6 caffeoyl-CoA reductase (subunit 3/3) (EC 1.3.1.108) from Acetobacterium woodii (see paper)
6fahD / H6LGM6 Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
Awo_c15720 caffeyl-CoA reductase-Etf complex subunit CarC from Acetobacterium woodii DSM 1030
44% identity, 98% coverage
- function: The Caffeyl-CoA reductase-Etf complex catalyzes the reduction of caffeyl-CoA to yield hydrocaffeyl-CoA. It couples the endergonic ferredoxin reduction with NADH as reductant to the exergonic reduction of caffeoyl-CoA with the same reductant. It uses the mechanism of electron bifurcation to overcome the steep energy barrier in ferredoxin reduction. Also reduces 4-coumaroyl-CoA and feruloyl-CoA.
catalytic activity: hydrocaffeoyl-CoA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 NAD(+) = (E)-caffeoyl-CoA + 2 oxidized [2Fe-2S]-[ferredoxin] + 2 NADH (RHEA:46956)
cofactor: FAD (Binds 1 or 2 FAD per subunit.)
subunit: Part of the homotrimeric caffeyl-CoA reductase-Etf complex composed of (R)-2-hydroxyisocaproyl-CoA dehydratase CarC, and the electron transfer flavoprotein (ETF) alpha (CarE) and beta (CarD) subunits. - Ligand: flavin-adenine dinucleotide (6fahD)
- A new metabolic trait in an acetogen: Mixed acid fermentation of fructose in a methylene-tetrahydrofolate reductase mutant of Acetobacterium woodii
Moon, Environmental microbiology reports 2023 - “...Propionate CoAtransferase CarA Caffeate metabolism 1041 54 4.27 Awo_c15710 FattyacylCoA synthase CarB 1188 46 4.69 Awo_c15720 AcylCoA dehydrogenase CarC 1006 59 4.09 Awo_c15730 Electron transfer flavoprotein beta subunit CarD 1220 52 4.55 Awo_c15740 Electron transfer flavoprotein alpha subunit apoprotein CarE 2209 125 4.14 Awo_c24340 Alanine or...”
GJQ69_08630 acyl-CoA dehydrogenase from Caproicibacterium lactatifermentans
44% identity, 97% coverage
KR505_02675 acyl-CoA dehydrogenase family protein from Eubacterium callanderi
42% identity, 98% coverage
- Gut Microbiota Eubacterium callanderi Exerts Anti-Colorectal Cancer Activity
Ryu, Microbiology spectrum 2022 - “...to butyric acid biosynthesis. But , butyryl-CoA:acetate CoA transferase (locus_tag, KR505_02670); Bcd , butyryl-CoA dehydrogenase (KR505_02675, KR505_10030); ETF , electron transfer flavoprotein subunit alpha (KR505_10020); ETF , electron transfer flavoprotein subunit beta (KR505_10025); Hbd , hydroxybutyryl dehydrogenase (KR505_10035); Cro , crotonase/enoyl-CoA hydratase (KR505_10040); Thl , acetyl-CoA...”
ACDS_MEGEL / Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
1bucA / Q06319 Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
GI|149886 butyryl-CoA dehydrogenase; EC 1.3.99.2 from Megasphaera elsdenii (see 2 papers)
44% identity, 96% coverage
- function: Has an optimum specificity for 4-carbon length fatty acyl- CoAs.
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: a short-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a short-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:47196)
cofactor: FAD
subunit: Homotetramer - Ligands: acetoacetyl-coenzyme a; flavin-adenine dinucleotide (1bucA)
- New perspectives on butyrate assimilation in Rhodospirillum rubrum S1H under photoheterotrophic conditions
De, BMC microbiology 2020 - “...acetobutylicum [ 19 ] (accession number P52042) or Megasphaera elsdenii [ 20 ] (accession number Q06319). As already described in Desulfosarcina cetonica [ 4 ] in the context of butyrate catabolism, crotonyl-CoA is proposed to be further transformed into acetyl-CoA (Fig. 2 ). It is first...”
- Characterization and overproduction of cell-associated cholesterol oxidase ChoD from Streptomyces lavendulae YAKB-15
Yamada, Scientific reports 2019 - “...PadR, Bacillus subtilis 96/28 P94443 5 ORF B 574 Acyl-CoA dehydrogenase Scad, Megasphaera elsdenii 33/27 Q06319 6 ORF C 226 Methyltransferase BQ2027_MB0092, Mycobacterium bovis 49/40 P65347 Enzyme kinetics of recombinant ChoD In order to characterize ChoD, we ordered a synthetic gene codon optimized for expression in...”
- Mycobacterium tuberculosis utilizes a unique heterotetrameric structure for dehydrogenation of the cholesterol side chain
Thomas, Biochemistry 2013 - “...GD (Q92947), VLCAD (P49748), ACAD9 (Q9H845), ACAD10 (Q6JQN1), ACAD11 (Q709F0), 1BUC (SCAD Megasphaera elsdenii , Q06319), 3NF4 ( Mycobacterium thermoresistibile , G7CDN2). Residues in green bind the isoalloxazine and ribityl diphosphate moieties of FAD, residues in blue bind adenosine of FAD, residues in purple bind CoA,...”
M892_24055 acyl-CoA dehydrogenase family protein from Vibrio campbellii ATCC BAA-1116
44% identity, 97% coverage
CG4860 uncharacterized protein from Drosophila melanogaster
44% identity, 89% coverage
- The MicroRNA miR-277 Controls Physiology and Pathology of the Adult Drosophila Midgut by Regulating the Expression of Fatty Acid β-Oxidation-Related Genes in Intestinal Stem Cells
Zipper, Metabolites 2022 - “...3 b). In detail, the reconstructed lineage towards pEC shows that FAO metabolic genes CG31075, CG4860, CG5599, CG9547, and whd diminish, while yip2 and CG3902 progressively increase ( Figure 3 b). Mtpalpha diminishes during the differentiation to then increase again in the terminally differentiated pEC (...”
- “...by high expression of the FAO genes CG5599, Mtpalpha , and yip2 and, respectively, CG3902, CG4860, CG9547, and whd in comparison to EB ( Figure 5 c). As an exception from miR-277 target genes showing clear expression differences among populations, CG31075 sticks out being high in...”
- Heritable shifts in redox metabolites during mitochondrial quiescence reprogramme progeny metabolism
Hocaoglu, Nature metabolism 2021 - “...Y ATP synthesis coupled proton transport ATP5ME CG8177 2.953726 3.75E-20 5.21E-18 Y bicarbonate transport SLC4A1 CG4860 2.023663 1.19E-11 7.01E-10 Y butyrate catabolic process ACADS AGBE 1.459516 7.63E-10 3.44E-08 Y carbohydrate metabolic process GBE1 CG2938 1.779595 3.50E-10 1.66E-08 Y carbohydrate metabolic process CASD1 CG10672 2.109713 4.03E-12 2.52E-10...”
- A second hybrid-binding domain modulates the activity of Drosophila ribonuclease H1
González, Journal of biochemistry 2020 - “...No No CG1236 CG1236 [Glyoxylate and hydroxypyruvate reductase], CG1236 GRHPR 2.6 Yes No No No CG4860 CG4860 [Short-chain acyl-CoA dehydrogenase], CG4860 ACADS 2.2 Yes No No No CG10194 CG10194, CG10194 NUDT19 2.2 Yes No No No CG5028 CG5028, [Isocitrate dehydrogenase (NAD(+))], isoform C, CG5028 IDH3G 2...”
- Rosy Beginnings: Studying Peroxisomes in Drosophila
Pridie, Frontiers in cell and developmental biology 2020 - “...PTS1 motif. Human Drosophila Function Function Loc ACAA1 CG9149 -Oxidation -Ketoacyl-CoA thiolase () B ACAD11 CG4860 -Oxidation Short-chain acyl-CoA dehydrogenase () B ACOX2 CG17544 -Oxidation Acyl-CoA oxidase (+) B ACSL1 CG3961 -Oxidation Long-chain-fatty-acidCoA ligase () B ACSL3/4 Acsl -Oxidation Acyl-CoA synthetase long-chain () B (+) H...”
- Natural Genetic Variation Screen in Drosophila Identifies Wnt Signaling, Mitochondrial Metabolism, and Redox Homeostasis Genes as Modifiers of Apoptosis
Palu, G3 (Bethesda, Md.) 2019 - “...additional 4 genes involved in mitochondrial -oxidation: wal ( ETFA ), Mcad ( ACADM ), CG4860 ( ACADS ), and CG7461 ( ACADVL ). The involvement of enzymes regulating redox homeostasis, and more specifically redox homeostasis in the mitochondria, is consistent with rpr -induced apoptosis. Both...”
- Evidence that microRNAs are part of the molecular toolkit regulating adult reproductive diapause in the mosquito, Culex pipiens
Meuti, PloS one 2018 - “...CG3902 CPIJ009148 miR-277 CG2118 CPIJ003841 miR-277 CG5044 CPIJ012030 miR-277 yip2 CPIJ002342 miR-277 CG6638 CPIJ014783 miR-277 CG4860 CPIJ011633 miR-277 CG1673 CPIJ015408 miR-277 CG6543 CPIJ006455 CPIJ014621 miR-277 CG8778 CPIJ016903 CPIJ006767 CPIJ019824 miR-277 CG3267 CPIJ009999 miR-277 CG10932 CPIJ019232 miR-277 CG12262 CPIJ008217 miR-305 CG30463 CPIJ005695 miR-124 Fatty acid elongation 8.03E-09...”
- “...miR-277 CG16935 CPIJ014619 CPIJ006453 miR-13b Fatty acid degradation 3.52E-06 CG3902 CPIJ009148 miR-277 yip2 CPIJ002342 miR-277 CG4860 CPIJ011633 miR-277 CG6543 CPIJ006455 CPIJ014621 miR-277 CG9547 CPIJ000375 miR-277 CG10932 CPIJ019232 miR-277 CG12262 CPIJ008217 miR-305-5p Propanoate metabolism 4.51E-06 CG17896 CPIJ009984 miR-277 CG5044 CPIJ012030 miR-277 CG6543 CPIJ006455 CPIJ014621 miR-277 ACC CPIJ005524...”
- Neuronal remodeling during metamorphosis is regulated by the alan shepard (shep) gene in Drosophila melanogaster
Chen, Genetics 2014 - “...BG00476 Shal K+ channel interacting protein (SKIP) jim CG4860 Trapped gene(s) BG00076 Transposon insertion First intron First exon of RA and RE; second intron...”
- Genome-wide P-element screen for Drosophila synaptogenesis mutants
Liebl, Journal of neurobiology 2006 - “...difference in transcript size: mael, CG8545, CG8351, and CG4860. This supports the idea that lethality in many Gene Disruption Project P-element mutants is due...”
- “...Overgrowth Overgrowth Overgrowth Other Overgrowth Overgrowth CG4860 sgl l(2)35Di Mrps6 Gyc76C CG8552 Cop Scim15 Hr39 Df(3R)E79 Df(3L)XDI98 Df(2L)osp29...”
Swol_0788 Butyryl-CoA dehydrogenase from Syntrophomonas wolfei subsp. wolfei str. Goettingen
42% identity, 98% coverage
- Stimulating Effect of Trichococcus flocculiformis on a Coculture of Syntrophomonas wolfei and Methanospirillum hungatei
Doloman, Applied and environmental microbiology 2022 - “...tri-culture conditions, in addition to the other butyryl-CoA dehydrogenases under bi- or triculture conditions (Swol_2052, Swol_0788, Swol_0488, and Swol_1841) (see Table S1). Increased butyrate oxidation by S. wolfei might be also partially influenced by the more active hydrogen scrubbing by the methanogens, which in turn might...”
- Involvement of NADH:acceptor oxidoreductase and butyryl coenzyme A dehydrogenase in reversed electron transport during syntrophic butyrate oxidation by Syntrophomonas wolfei
Müller, Journal of bacteriology 2009 - “...presumed operons with other butyryl-metabolic genes (e.g., Swol_0788, Swol_ 1483, and Swol_1933 [not shown]). The soluble protein frac- Downloaded from...”
TTHB022 putative acyl-CoA dehydrogenase from Thermus thermophilus HB8
44% identity, 98% coverage
CLNEO_26130 acyl-CoA dehydrogenase family protein from Anaerotignum neopropionicum
41% identity, 97% coverage
C5C8N7 Acyl-CoA dehydrogenase from Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Mlut_02820 acyl-CoA dehydrogenase family protein from Micrococcus luteus NCTC 2665
44% identity, 99% coverage
DR_1544 acyl-CoA dehydrogenase from Deinococcus radiodurans R1
43% identity, 88% coverage
SCO3051 acyl-CoA dehydrogenase from Streptomyces coelicolor A3(2)
Q7AKM9 Acyl-CoA dehydrogenase from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
42% identity, 97% coverage
- Unlocking a new target for streptomycetes strain improvement
Chen, Synthetic and systems biotechnology 2020 - “...mutants, TAG degradation was triggered by energetic stress. The expression of -oxidation enzymes such as SCO3051 (acyl-CoA dehydrogenase) and SCO5144 (enoyl-CoA hydratase) was elevated, generating a flux of acetyl-CoA toward the production of ACT. Conversely, wild type S. lividans , a weak producer of ACT, accumulated...”
- Comparative proteomic analysis of Streptomyces lividans Wild-Type and ppk mutant strains reveals the importance of storage lipids for antibiotic biosynthesis
Le, Applied and environmental microbiology 2013 - “...strain. (b) Lipid/fatty acid metabolism. An acyl-CoA dehydrogenase (SCO3051) that catalyzes the first step of the beta-oxidation of fatty acids, whose end...”
- “...protein (myoinositol catabolism protein IolB; putative 5-deoxy-glucuronate isomerase) SCO3051 SCO1565 Q7AKM9 Q8CJI8 42/5.3 39/6.2 103 225 26 44 Up Down 4 4...”
- Genome-wide analysis of the role of GlnR in Streptomyces venezuelae provides new insights into global nitrogen regulation in actinomycetes
Pullan, BMC genomics 2011 - “...AC Sven_1677 SCO2026 Glutamate synthase -1.1 GT A AC CTGCAC G AA A T Sven_5967 SCO3051 FadE acetyl CoA dehydrogenase -1.3 G AC AC CCCGAGT T A AC Sven_6632 SCO5685 Putative sugar hydrolase 1.4 GT T A AGTGAAC GT C AC Sven_0035 Secreted protein -1.2 GT...”
- Comparative proteomic analysis of Streptomyces lividans Wild-Type and ppk mutant strains reveals the importance of storage lipids for antibiotic biosynthesis
Le, Applied and environmental microbiology 2013 - “...catabolism protein IolB; putative 5-deoxy-glucuronate isomerase) SCO3051 SCO1565 Q7AKM9 Q8CJI8 42/5.3 39/6.2 103 225 26 44 Up Down 4 4 SCO6976 Q9KZH6 32/5.1 184...”
VPA1121 putative acyl-CoA dehydrogenase from Vibrio parahaemolyticus RIMD 2210633
44% identity, 97% coverage
- Fitness and transcriptomic analysis of pathogenic Vibrio parahaemolyticus in seawater at different shellfish harvesting temperatures
Liu, Microbiology spectrum 2023 - “...GCTTCAAGAAGAGCTACCAGCTACGGCGCGAATAGAGTGAGAGTAT 93 This study trh+_10&30 VP0474 Probable membrane transporter protein GGTGGAGTTGGTTTCTACGATGCCATACAGGTAACCCTGCTAGAAC 180 This study tdh+_10&30 VPA1121 Putative acyl-CoA dehydrogenase GGTGGCTATGGCTACATCAAAGGCTCTACGTCTTCCGTGAGTAAAC 136 This study tdh+_10&30 VPA1060 Putative two-component response regulatory proteins GCTCTTCAACCTTGGATTGACCTGTACGCGTGTTCCTCATCTAC 166 This study trh+_10&30tdh+_10&30 glgC VPA0833 Glucose-1-phosphate adenylyltransferase GAAAACCCACCTACTCTTCCAGACGTCATGGCTAGACGTTTCCAGT 129 This study trh+_10&30tdh+_10&30 ACKNOWLEDGMENTS This...”
SE37_11155 acyl-CoA dehydrogenase family protein from Geobacter soli
44% identity, 97% coverage
PA0746 probable acyl-CoA dehydrogenase from Pseudomonas aeruginosa PAO1
46% identity, 96% coverage
- The Pseudomonas aeruginosa RpoH (σ32) Regulon and Its Role in Essential Cellular Functions, Starvation Survival, and Antibiotic Tolerance
Williamson, International journal of molecular sciences 2023 - “...operon includes enzymes for fatty acid biosynthesis, including Enoyl-CoA hydratase/isomerase (PA0744 and PA0745), Acyl-CoA dehydrogenase (PA0746), and NAD-dependent aldehyde dehydrogenase (PA0747). The structure and function of PA0745 (DspI) were determined [ 70 ] and shown to be involved in the dehydration reaction cis-2-decenoic acid, a signaling...”
- “...PA0744 Enoyl-CoA hydratase/isomerase 8.3 3.0 10 4 PA0745 dspI Enoyl-CoA hydratase/isomerase 10.7 6.2 10 4 PA0746 Acyl-CoA dehydrogenase 10.5 1.8 10 3 PA0747 NAD-dependent aldehyde dehydrogenase 14.2 6.3 10 4 PA0763 mucA Anti-sigma factor 2.1 2.5 10 3 + PA0764 mucB Negative regulator for alginate biosynthesis...”
- The Small RNAs PA2952.1 and PrrH as Regulators of Virulence, Motility, and Iron Metabolism in Pseudomonas aeruginosa
Coleman, Applied and environmental microbiology 2021 (secret) - Mitochondrial targeting increases specific activity of a heterologous valine assimilation pathway in Saccharomyces cerevisiae
Solomon, Metabolic engineering communications 2016 - “...( Sambrook and Russell, 2001 ) and plasmids were maintained in E. coli XL1B. acd1 (PA0746), bkdA1 (PA2247), bkdA2 (PA2248), bkdB (PA2249), and lpdV (PA2250), encoding the acyl-CoA dehydrogenase and branched chain keto acid dehydrogenase complex, respectively, from Pseudomonas aeruginosa PA01, were PCR amplified from plasmid...”
- The pathogenicity island encoded PvrSR/RcsCB regulatory network controls biofilm formation and dispersal in Pseudomonas aeruginosa PA14
Mikkelsen, Molecular microbiology 2013 - “...Histidine phosphotransfer protein HptC PA0034 * 8.6 Probable two-component response regulator PA0267 6.8 Hypothetical protein PA0746 5.4 Probable acyl-CoA dehydrogenase PA1468 * 9.9 Hypothetical protein PA1571 4.5 Hypothetical protein PA1664 9.4 orfX OrfX PA2075 4.1 Hypothetical protein PA2111 6.5 Hypothetical protein PA2553 6.0 Probable acyl-CoA thiolase...”
- Bacterial cis-2-unsaturated fatty acids found in the cystic fibrosis airway modulate virulence and persistence of Pseudomonas aeruginosa
Twomey, The ISME journal 2012 - “...classa Fold changesb WT+DSF versus WT PA0744 PA0745 PA0746 PA0747 PA0806 PA1325 PA1326 PA1327 PA1467 PA1559 PA1560 PA1797 PA1889 PA2339 PA2966 PA3790 PA4138...”
- Genome-wide identification of Pseudomonas aeruginosa virulence-related genes using a Caenorhabditis elegans infection model
Feinbaum, PLoS pathogens 2012 - “...gene of what is most likely a 5 gene operon: PA0747 a probable aldehyde dehydrogenase, PA0746 a putative acyl-CoA dehydrogenase, PA0745, PA0744 another putative enoyl-CoA hydratase/isomerase, and PA0743 a probable 3-hydroxyisobutyrate dehydrogenase. B) Insertions in PA0745 exhibit a virulence-attenuated phenotype but mutants of PA0746, the only...”
- Pseudomonas aeruginosa twitching motility-mediated chemotaxis towards phospholipids and fatty acids: specificity and metabolic requirements
Miller, Journal of bacteriology 2008 - “...PA0358 PA0482 PA0506 PA0507 PA0508 PA0743 PA0744 PA0745 PA0746 PA0792 PA0795 PA0796 PA0797 PA0887 PA1137 PA1288 PA1736 PA1737 PA2011 PA2012 PA2013 PA2014 PA2015...”
- The Pseudomonas aeruginosa proteome during anaerobic growth
Wu, Journal of bacteriology 2005 - “...PA0100 PA0128 PA0139 PA0195 PA0399 PA0447* PA0534 PA0588 PA0746 PA0853 PA0854 PA0870 PA0871 PA0872 PA0916 PA0997* PA0998* PA0999* PA1002* PA1228 PA1529 PA1574...”
- More
Swit_0650 acyl-CoA dehydrogenase domain-containing protein from Sphingomonas wittichii RW1
44% identity, 98% coverage
- Proteomic profiling of the dioxin-degrading bacterium Sphingomonas wittichii RW1
Colquhoun, Journal of biomedicine & biotechnology 2012 - “...Average ratio c t -test d 821 148551036 Swit_5089 Fumarylacetoacetate hydrolase 1.99 0.063 470 148553574 Swit_0650 Acyl-CoA dehydrogenase domain 1.74 0.031 161 148550568 Swit_5129 TonB-dependent receptor 1.59 0.086 a Arbitrary identifier for spot location (see Figure 2 ). b NCBI gi number. c Using internal standard...”
PA14_54630 probable acyl-CoA dehydrogenase from Pseudomonas aeruginosa UCBPP-PA14
46% identity, 96% coverage
PSPA7_4774 acyl-CoA dehydrogenase from Pseudomonas aeruginosa PA7
46% identity, 96% coverage
SMb20753 putative acyl-CoA dehydrogenase protein from Sinorhizobium meliloti 1021
44% identity, 98% coverage
Smlt0265 putative acyl CoA dehydrogenase from Stenotrophomonas maltophilia K279a
47% identity, 96% coverage
CPS_RS02940 acyl-CoA dehydrogenase family protein from Colwellia psychrerythraea 34H
43% identity, 96% coverage
Rru_A1835 Butyryl-CoA dehydrogenase from Rhodospirillum rubrum ATCC 11170
Q2RTB0 Butyryl-CoA dehydrogenase from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
43% identity, 98% coverage
NGR_b20870 probable acyl-CoA dehydrogenase from Rhizobium sp. NGR234
44% identity, 97% coverage
CC1350 acyl-CoA dehydrogenase from Caulobacter crescentus CB15
42% identity, 98% coverage
Swol_0488 Butyryl-CoA dehydrogenase from Syntrophomonas wolfei subsp. wolfei str. Goettingen
43% identity, 98% coverage
- Dynamic acylome reveals metabolite driven modifications in Syntrophomonas wolfei
Fu, Frontiers in microbiology 2022 - “...steps in -oxidation and are as follows: acyl-CoA transferase (Swol_0309, 1014, 1147, 2128), acyl-CoA dehydrogenase (Swol_0488, 0788, 1841), enoyl-CoA hydratase (Swol_0790, 2031, 2129), 3- hydroxybutyryl-CoA dehydrogenase (Swol_0307, 0791, 1171), and acetyl-CoA acetyltransferase (Swol_0308, 0789). Our improved proteomic depth revealed additional -oxidation paralogs and led us to...”
- Stimulating Effect of Trichococcus flocculiformis on a Coculture of Syntrophomonas wolfei and Methanospirillum hungatei
Doloman, Applied and environmental microbiology 2022 - “...conditions, in addition to the other butyryl-CoA dehydrogenases under bi- or triculture conditions (Swol_2052, Swol_0788, Swol_0488, and Swol_1841) (see Table S1). Increased butyrate oxidation by S. wolfei might be also partially influenced by the more active hydrogen scrubbing by the methanogens, which in turn might be...”
NGR_b20870 isobutyryl-CoA dehydrogenase from Sinorhizobium fredii NGR234
44% identity, 97% coverage
U876_10345 acyl-CoA dehydrogenase family protein from Aeromonas hydrophila NJ-35
44% identity, 92% coverage
ACADSB / P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) from Homo sapiens (see 4 papers)
ACDSB_HUMAN / P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 from Homo sapiens (Human) (see 7 papers)
NP_001600 short/branched chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor from Homo sapiens
40% identity, 86% coverage
- function: Short and branched chain specific acyl-CoA dehydrogenase that catalyzes the removal of one hydrogen from C-2 and C-3 of the fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA (PubMed:10832746, PubMed:11013134, PubMed:21430231, PubMed:7698750). Among the different mitochondrial acyl-CoA dehydrogenases, acts specifically on short and branched chain acyl-CoA derivatives such as (S)-2-methylbutyryl-CoA as well as short straight chain acyl-CoAs such as butyryl-CoA (PubMed:10832746, PubMed:11013134, PubMed:21430231, PubMed:7698750). Plays an important role in the metabolism of L- isoleucine by catalyzing the dehydrogenation of 2-methylbutyryl-CoA, one of the steps of the L-isoleucine catabolic pathway (PubMed:10832746, PubMed:11013134). Can also act on valproyl-CoA, a metabolite of valproic acid, an antiepileptic drug (PubMed:8660691).
catalytic activity: 2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43780)
catalytic activity: (2S)-2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48256)
catalytic activity: (2R)-2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = ethylacryloyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:65296)
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: 2-methylpropanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylpropenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:44180)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: 2-methylhexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = 2-methylhexenoyl-CoA + reduced [electron- transfer flavoprotein] (RHEA:48272)
catalytic activity: valproyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-propylpent-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:65344)
cofactor: FAD
subunit: Homotetramer. - Lipid Metabolism Pathway Genes and Lung Cancer: ACADSB rs12220683G>C Is Associated with Better Survival Outcome in Patients with Non-Small Cell Lung Cancer.
Yoo, Oncology 2024 (PubMed)- GeneRIF: Lipid Metabolism Pathway Genes and Lung Cancer: ACADSB rs12220683G>C Is Associated with Better Survival Outcome in Patients with Non-Small Cell Lung Cancer.
- ACADSB regulates ferroptosis and affects the migration, invasion, and proliferation of colorectal cancer cells.
Lu, Cell biology international 2020 (PubMed)- GeneRIF: ACADSB regulates ferroptosis and affects the migration, invasion, and proliferation of colorectal cancer cells.
- Clinical, biochemical, and molecular spectrum of short/branched-chain acyl-CoA dehydrogenase deficiency: two new cases and review of literature.
Porta, Journal of pediatric endocrinology & metabolism : JPEM 2019 (PubMed)- GeneRIF: ACADSB mutation is associated with short/branched-chain acyl-CoA dehydrogenase deficiency.
- Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
Calvo, Science translational medicine 2012 - GeneRIF: Strong candidate gene for mitochondrial disease, based on recessive mutations detected in infantile patients
- Genome-wide association study of circulating vitamin D levels.
Ahn, Human molecular genetics 2010 - GeneRIF: Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
- Characterization of new ACADSB gene sequence mutations and clinical implications in patients with 2-methylbutyrylglycinuria identified by newborn screening.
Alfardan, Molecular genetics and metabolism 2010 - GeneRIF: These findings confirm that SBCAD deficiency can be identified through newborn screening by acylcarnitine analysis.
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
Hendrickson, PloS one 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Association of genetic polymorphisms of ACADSB and COMT with human hypertension.
Kamide, Journal of hypertension 2007 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- More
- Insight into the Molecular Signature of Skeletal Muscle Characterizing Lifelong Football Players
Orrù, International journal of environmental research and public health 2022 - “...protein OPA3 1.85 Q15124 Phosphoglucomutase-like protein 5 PGM5 1.85 Q02224 Centromere-associated protein E CENPE 1.85 P45954 Short/branched chain-specific acyl-CoA dehydrogenase, mitochondrial ACADSB 1.85 Q9H0P0 Cytosolic 5-nucleotidase 3 NT5C3A 1.76 P10809 60 kDa Heat shock protein, mitochondrial HSPD1 1.76 P56134 ATP synthase subunit f, mitochondrial ATP5J2 1.64...”
- HSP60 Regulates Lipid Metabolism in Human Ovarian Cancer
Li, Oxidative medicine and cellular longevity 2021 - “...sapiens GN=ACADS PE=2 SV=1[D4QEZ8_HUMAN] ACADS 27.67 8 8 19 44.33 7.72 1.33 6.43 E 06 P45954 Short/branched chain-specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1[ACDSB_HUMAN] ACADSB 25.93 8 8 15 47.46 6.99 1.29 1.06 E 02 Q08426 Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3[ECHP_HUMAN]...”
- “...sapiens GN=ACADS PE=2 SV=1[D4QEZ8_HUMAN] ACADS 27.67 8 8 19 44.33 7.72 1.33 6.43 E 06 P45954 Short/branched chain-specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1[ACDSB_HUMAN] ACDSB 25.93 8 8 15 47.46 6.99 1.29 1.06 E 02 A0A024R8L7 Acyl-coenzyme A oxidase OS=Homo sapiens GN=ACOX1 PE=3 SV=1[A0A024R8L7_HUMAN]...”
- Electron transfer flavoprotein and its role in mitochondrial energy metabolism in health and disease.
Henriques, Gene 2021 - “...dehydrogenase family member 11 ACAD11 Q709F0 n.d. C22-CoA SBCAD Short/branched chain specific acyl-CoA dehydrogenase ACADSB P45954 Amino acid catabolism, fatty acid oxidation 2-methylbutyryl-CoA, isobutyryl-CoA, 2-methylhexanoyl-CoA, C4-CoA and C8-CoA GCDH Glutaryl-CoA dehydrogenase GCDH Q92947 Amino acid catabolism glutaryl-CoA IBDH Isobutyryl-CoA dehydrogenase ACAD8 Q9UKU7 Amino acid catabolism 2-methylbutanoyl-CoA...”
- Identification of HO-1 as a novel biomarker for graft acute cellular rejection and prognosis prediction after liver transplantation
Jia, Annals of translational medicine 2020 - “...Alcohol dehydrogenase 1B ADH1B 0.543 Q96F10 Diamine acetyltransferase 2 SAT2 0.548 P36871 Phosphoglucomutase-1 PGM1 0.548 P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial ACADSB 0.549 P54840 Glycogen (starch) synthase, liver GYS2 0.557 O95563 Mitochondrial pyruvate carrier 2 MPC2 0.559 Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase GRHPR 0.561 P07108 Acyl-CoA-binding...”
- Proteomic Analysis of Renal Biomarkers of Kidney Allograft Fibrosis-A Study in Renal Transplant Patients.
Mortensen, International journal of molecular sciences 2020 - “...25.7 5.8 1.54 10 -4 4.11 10 -1 0 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial P45954 26.9 6.1 1.58 10 -4 4.20 10 -1 0 X-ray repair cross-complementing protein 6 P12956 40.2 9.1 1.63 10 -4 4.33 10 -1 0 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Q13011 37.2 8.5...”
- Transcriptome analysis of genes and pathways associated with metabolism in Scylla paramamosain under different light intensities during indoor overwintering.
Li, BMC genomics 2020 - “...Q16836 0.4400 0.0349 0.3574 0.0132 Fatty acid degradation (ko00071) Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial P45954 0.5031 0.0261 Aldehyde dehydrogenase family 9 member A1-A Q7ZVB2 0.4922 0.0255 Enoyl-CoA delta isomerase 2 Q9WUR2 0.4154 0.0024 Glutaryl-CoA dehydrogenase Q2KHZ9 0.5238 0.0112 Long-chain specific acyl-CoA dehydrogenase P51174 0.5771 0.0348...”
- Application of Bioactive Thermal Proteome Profiling to Decipher the Mechanism of Action of the Lipid Lowering 132-Hydroxy-pheophytin Isolated from a Marine Cyanobacteria.
Carrasco, Marine drugs 2019 - “...1 49.21 50.48 49.08 49.30 0.8192 P30038 Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial 42.97 44.66 42.77 43.22 0.9284 P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial 45.27 47.28 44.85 46.52 0.7475 P60709 * Actin, cytoplasmic 1 44.10 48.42 41.84 45.14 0.0455 Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 47.31 48.12 47.14 47.55...”
- Proteomic analyses identify prognostic biomarkers for pancreatic ductal adenocarcinoma.
Hu, Oncotarget 2018 - “...molecule Q96LJ7 DHRS1 7 1 0.007 0.24 1 0.017 0.37 Dehydrogenase/reductase SDR family member 1 P45954 ACADSB 9 3 0.017 0.15 2 0.026 0.38 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial Q96IU4 ABHD14B 10 9 0.007 0.31 2 0.013 0.46 Alpha/beta hydrolase domain-containing protein 14B Q6UXI9-6 NPNT...”
- More
3pfdC / G7CNE7 Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
44% identity, 98% coverage
- Ligand: dihydroflavine-adenine dinucleotide (3pfdC)
2jifA / P45954 Structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
40% identity, 98% coverage
- Ligands: flavin-adenine dinucleotide; coenzyme a persulfide (2jifA)
7szvA / A0A3E2MWC7 Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
43% identity, 100% coverage
- Ligand: dihydroflavine-adenine dinucleotide (7szvA)
F1SED0 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Sus scrofa
40% identity, 86% coverage
Gmet_1710 Acyl-CoA dehydrogenase-like from Geobacter metallireducens GS-15
44% identity, 96% coverage
- Genome sequence of a dissimilatory Fe(III)-reducing bacterium Geobacter soli type strain GSS01(T)
Yang, Standards in genomic sciences 2015 - “...are predicted from the genome of G. soli : acyl-CoA dehydrogenase (SE37_11155, 80% similarity to Gmet_1710 in G. metallireducens ; SE37_11180, 86% similarity to that of Geoalkalibacter subterraneus ), succinyl-CoA:acetate CoA-transferases (SE37_00360; SE37_11235, 83% similarity to Gbem_2843 in G. bemidjiensis ; SE37_13685), acyl-CoA thioesterases (SE37_09325, SE37_09950,...”
Q9VVU1 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Drosophila melanogaster
CG3902 uncharacterized protein from Drosophila melanogaster
42% identity, 89% coverage
- The Stearoyl-CoA Desaturase-1 (Desat1) in Drosophila cooperated with Myc to Induce Autophagy and Growth, a Potential New Link to Tumor Survival
Paiardi, Genes 2017 - “...+1.71 1.48 10 6 16 MECR Probable trans-2-enoyl-CoA reductase, mitochondrial +1.3 1.61 10 22 3 Q9VVU1 Acyl-CoA dehydrogenase activity CG3902 +1.4 1.21 10 19 14 Q9VDT1 Arc42 +1.44 1.24 10 36 7 Q9VCC6 fatty acyl-CoA synthase activity CG6178 +1.71 3.71 10 28 7 Q9W5W8 isomerase activity...”
- The protein-protein interaction network of eyestalk, Y-organ and hepatopancreas in Chinese mitten crab Eriocheir sinensis
Hao, BMC systems biology 2014 - “...16 proteins (Q8IQV6, Q7JXG9, Q8IR25, D3ZE26, Q9V3S7, Q9V3A8, Q7KMH9, Q7JPS2, Q9VVK8, Q9W1A7, Q7KN04, Q8SZY2, Q9VUP0, Q9VVU1, Q9VLK8, A1ZA45) were annotated as Hippo signaling cascade and 12 other proteins (Q8IQV6, Q7JXG9, Q8IR25, Q9V3S7, Q9V3A8, Q7KMH9, Q7JPS2, Q9VVK8, E1JII4, Q8SZY2, Q9VVU1, Q9VLK8) functioned as regulators of Hippo signaling...”
- High sugar diet-induced fatty acid oxidation potentiates cytokine-dependent cardiac ECM remodeling
Gera, The Journal of cell biology 2024 - “...PCs analyzed for each genotype. (D and E) Increase in the reporter YFP expression for CG3902 in the PCs of HSD-fed flies (E) as compared to those fed on ND (D). Phalloidin (red) marks the cardiac tube and the alary muscles. (F) Quantification of the mean...”
- “...and P ). Similar enrichment in the levels of reporter YFP expression for acyl-CoA dehydrogenase (CG3902) was also observed in the PCs of HSD-fed flies ( Fig. S3, DF ). Furthermore, compared with that observed for ND-fed flies, elevated levels of expression of the critical genes...”
- scRNA-seq Reveals Novel Genetic Pathways and Sex Chromosome Regulation in Tribolium Spermatogenesis
Robben, Genome biology and evolution 2024 - “...0.003 Fly Glut3 Elongating spermatid FBgn0015230 Fly tj Hub Cyst Cell FBgn0000964 TcasGA2-TC033194 0 Fly CG3902 Hub Cyst Cell FBgn0036824 TcasGA2-TC005596 0.007 Fly piwi Hub Cyst Cell FBgn0004872 TcasGA2-TC008711 0.09 Fly Amph Hub Cyst Cell FBgn0027356 TcasGA2-TC032117 0.24 Fly eya Cyst cell FBgn0000320 TcasGA2-TC008985 0.09 Fly...”
- Icaritin greatly attenuates β-amyloid-induced toxicity in vivo
Li, CNS neuroscience & therapeutics 2024 - “...shown in Figure 6N . The qRTPCR results verified that the expression of Egm, Echs1, CG3902, and CG8778 is consistent with that of the transcriptome data (Figure 6O ). The expression of CG9547 and Yip2 was unchanged under A arc expression, while Icaritin activated the expression...”
- Spenito-dependent metabolic sexual dimorphism intrinsic to fat storage cells
Diaz, Genetics 2023 - “...TGGACAAGATTCACG CCATTC 3 and 5 CGACCACCTGTAGTAGCCATC 3; CG3902, 5 CTCACCGACGATGAGAAAATGA 3 and 5 CACGGAGGGATCGA ATTTGTG 3; baldspot, 5 GTGGTCAGCACTTTATGCAAAAT 3...”
- “...(Thimgan et al. 2015), the short-chain 2-methylacyl-CoA dehydrogenase CG3902, the known or pre dicted fatty acid binding proteins fabp and CG4586, and the...”
- Emergent dynamics of adult stem cell lineages from single nucleus and single cell RNA-Seq of <i>Drosophila</i> testes
Raz, eLife 2023 - “...the same cell type in the UMAP and its corresponding IF image. ( E ) CG3902 mRNA expression projected on the UMAP. ( F ) Apical tip of testis expressing GFP protein trap of CG3902. ( G ) Akr1B mRNA expression projected on the UMAP. (...”
- “...cells (ScCC) ( Li et al., 2003 ; Zoller and Schulz, 2012 ). Complementing this, CG3902 mRNA was also detected in the same clusters as tj , and a CG3902 protein trap line revealed cytoplasmic protein accumulation up to early ScCC and no detectable protein thereafter...”
- Early-adult methionine restriction reduces methionine sulfoxide and extends lifespan in Drosophila
Kosakamoto, Nature communications 2023 - “...Glutathione S transferase E7 ( GstE7 ), CCHamide-2 ( CCHa2 ), and an unknown gene CG3902 (Fig. 4e, f ). CCHa2 is an appetite-regulating peptide that is known to promote systemic insulin signalling 41 . Thus, decreased expression of CCHa2 may lead to a pro-longevity state...”
- Chromatin and gene expression changes during female Drosophila germline stem cell development illuminate the biology of highly potent stem cells
Pang, eLife 2023 - “...expression shows other indications of increased lipid metabolism (see Figure 5B , metabolism of lipids). CG3902, encoding an Acyl-CoA dehydrogenase the first step in mitochondrial fatty acid beta-oxidation, is upregulated more than 400-fold. RNA levels increase for both Lpr1 (12-fold) and Lpr2 (87-fold). Hnf4 , encoding...”
- The MicroRNA miR-277 Controls Physiology and Pathology of the Adult Drosophila Midgut by Regulating the Expression of Fatty Acid β-Oxidation-Related Genes in Intestinal Stem Cells
Zipper, Metabolites 2022 - “...shows that FAO metabolic genes CG31075, CG4860, CG5599, CG9547, and whd diminish, while yip2 and CG3902 progressively increase ( Figure 3 b). Mtpalpha diminishes during the differentiation to then increase again in the terminally differentiated pEC ( Figure 3 b). In the reconstructed lineage towards anterior...”
- “...also show similar patterns to the pEC, with the exception of CG5599 which increases progressively, CG3902 which initially increases in the process of differentiation to then diminish in terminally differentiated mEC, and yip2 which increases initially and then diminishes. Although few FAO genes seem to be...”
- More
Q95U46 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Drosophila melanogaster
42% identity, 89% coverage
MSMEG_1821 acyl-CoA dehydrogenase from Mycobacterium smegmatis str. MC2 155
45% identity, 96% coverage
- Unveiling the Biosynthetic Pathway for Short Mycolic Acids in Nontuberculous Mycobacteria: Mycobacterium smegmatis MSMEG_4301 and Its Ortholog Mycobacterium abscessus MAB_1915 Are Essential for the Synthesis of α'-Mycolic Acids
Di, Microbiology spectrum 2022 - “...UNR21 and impact on the corresponding open reading frame (ORF) Gene Function Mutation Protein change MSMEG_1821 Acyl-CoA dehydrogenase g452a R151K MSMEG_1904 Acyl-CoA dehydrogenase g768a K256K MSMEG_2029 3-Ketoacyl-ACP/CoA reductase Insertion c31 Frameshift at AA11 MSMEG_2228 Short-chain dehydrogenase/reductase family c169t P57S MSMEG_3392 Acyl-CoA dehydrogenase domain protein Insertion c199,...”
- “...MSMEG_4301 and other candidate genes in mycobacterial species Gene Function Orthologs in other mycobacteria a MSMEG_1821 Acyl-CoA dehydrogenase M. marinum , M. fortuitum , M. ulcerans , M. avium , M. kansasii MSMEG_1904 Acyl-CoA dehydrogenase M. goodii , M. fortuitum , Mycobacterium sp. strain VKM, Mycobacterium...”
- Protein Composition of Mycobacterium smegmatis Differs Significantly Between Active Cells and Dormant Cells With Ovoid Morphology
Trutneva, Frontiers in microbiology 2018 - “...enzymes found in active cells, there are additional unique enzymes in the dormant cell proteome: MSMEG_1821, MSMEG_1813, MSMEG_6008, MSMEG_6391, MSMEG_2938, MSMEG_5184, and MSMEG_6511). Similarly, enzymes with proteolytic activity were found in both types of cells. However, proteolytic enzymes are more diverse and more represented in the...”
- Gene Expression, Bacteria Viability and Survivability Following Spray Drying of Mycobacterium smegmatis
Lauten, Materials (Basel, Switzerland) 2010 - “...a p-value < 0.01 level of significance. All but two of these genes, acyl-CoA dehrydrogenase (MSMEG_1821) and malonyl CoA-acyl carrier protein transacylase (MSMEG_4325), were upregulated in the multiply cycled bacteria. In the stationary phase comparison there were no genes differentially expressed at p-value < 0.05 level...”
- “...0.046 55% MSMEG_1794 dehydrogenase 0.6 9.4 0.020 81% MSMEG_1802 ChaB protein 0.8 9.2 0.033 89% MSMEG_1821 acyl-CoA dehydrogenase -0.6 9.4 0.017 79% MSMEG_1886 Fatty acid desaturase 0.9 9.9 0.012 88% MSMEG_1950 conserved hypothetical protein 1.0 10.2 0.004 98% MSMEG_1951 conserved domain protein 1.7 10.5 0.003 99%...”
AR1Y2_1117 acyl-CoA dehydrogenase family protein from Anaerostipes rhamnosivorans
40% identity, 97% coverage
- Conversion of dietary inositol into propionate and acetate by commensal Anaerostipes associates with host health
Bui, Nature communications 2021 - “...AR1Y2_1115), an enoyl-CoA dehydratase (AcaD encoded by AR1Y2_1116) and an acyl dehydrogenase (EcdH encoded by AR1Y2_1117) and acyl dehydrogenase complex (AcaD-Etf encoded by AR1Y2_1050-1052). CO 2 /H 2 or formate is also formed from a conversion of pyruvate to acetyl-CoA involved pyruvate-flavodoxin oxidoreductase (Por encoded by...”
- “...rhamnose. These included 3-oxoacid CoA transferase (OxcT encoded by AR1Y2_1115), acyl-CoA dehydrogenase (AcaD encoded by AR1Y2_1117), enoyl-CoA hydratase (EcdH encoded by AR1Y2_1116) and acryloyl-CoA dehydrogenase/Etf (AcaD-Etf encoded by AR1Y2_1050-1052 ) . Interestingly, oxcT, ecdH and acaD (AR1Y2_1115-1117) were located in a putative operon. The 3-oxoacid CoA...”
AzCIB_2912 acyl-CoA dehydrogenase family protein from Azoarcus sp. CIB
44% identity, 97% coverage
- Genetic characterization of the cyclohexane carboxylate degradation pathway in the denitrifying bacterium Aromatoleum sp. CIB
Sanz, Environmental microbiology 2022 - “...also present in the CIB genome. We have observed an induction of the aabC paralogue (AzCIB_2912) when Aromatoleum sp. CIBAzCIB_1938 was grown in CHC or benzoate (Figure S5 C), suggesting that cluster AzCIB_29122917, which is not significantly expressed in the wildtype strain growing with benzoate or...”
- “...standard deviations. Click here for additional data file. FIGURE S5 Expression of aab genes and AzCIB_2912 in Aromatoleum sp. CIB strains. Total RNA was isolated from Aromatoleum sp. CIB cells grown anaerobically in MC medium containing 3mM benzoate (Bz), 3mM CHC, or 3mM pimelate (Pim) as...”
A5U7U8 Acyl-CoA dehydrogenase FadE25 from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Rv3274c PROBABLE ACYL-CoA DEHYDROGENASE FADE25 from Mycobacterium tuberculosis H37Rv
MRA_3315 acyl-CoA dehydrogenase FadE25 from Mycobacterium tuberculosis H37Ra
44% identity, 96% coverage
- The Inhibitory Effect of GlmU Acetyltransferase Inhibitor TPSA on Mycobacterium tuberculosis May Be Affected Due to Its Methylation by Methyltransferase Rv0560c
Chen, Frontiers in cellular and infection microbiology 2019 - “...3-oxoacyl-(Acyl-carrier-protein) synthase 1 43.29 5.11 0.015 10 486 442 2.02 206 MRA_3315 ( fadE25 ) A5U7U8 Acyl-CoA dehydrogenase 41.70 5.21 0.019 16 132 35 2.70 203 MRA_0251 ( fabG-1 ) A5TYW8 3-ketoacyl-(Acyl-carrier-protein) reductase 46.83 6.04 <0.0001 13 432 389 4.93 197 MRA_0251 ( fabG-1 ) A5TYW8...”
- Ancient Bacterial Class Alphaproteobacteria Cytochrome P450 Monooxygenases Can Be Found in Other Bacterial Species
Nzuza, International journal of molecular sciences 2021 - “...pzu:PHZ_c0890 33 51 Acyl-CoA dehydrogenase fadE24 Rv3139 Acyl-CoA dehydrogenase pzu:PHZ_c2365 32 48 Acyl-CoA dehydrogenase fadE25 Rv3274c Acyl-CoA dehydrogenase FADE25 pzu:PHZ_c1680 40 60 Acyl-CoA dehydrogenase fadE26 Rv3504 Probable acyl-CoA dehydrogenase pzu:PHZ_c2336 33 50 Acyl-CoA dehydrogenase fadE27 Rv3505 Probable acyl-CoA dehydrogenase pzu:PHZ_c2406 28 45 Isovaleryl CoA dehydrogenase fadE28...”
- Rv0180c contributes to Mycobacterium tuberculosis cell shape and to infectivity in mice and macrophages
Payros, PLoS pathogens 2021 - “...the virulence of M . tuberculosis . This includes: three genes rv0244c ( fadE5 ), rv3274c ( fadE25 ) and rv3544c ( fadE28 ) encoding acyl-CoA dehydrogenases required for growth on cholesterol and predicted to be involved in cholesterol side-chain -oxidation and degradation [ 20 ,...”
- One-Year Old Dormant, "Non-culturable" Mycobacterium tuberculosis Preserves Significantly Diverse Protein Profile
Trutneva, Frontiers in cellular and infection microbiology 2020 - “...(alpha chain) RpoA Rv1308 Probable ATP synthase alpha chain AtpA Rv3846 Superoxide dismutase [FE] SodA Rv3274c Probable acyl-CoA dehydrogenase FadE25 Rv1630 30S ribosomal protein S1 RpsA Rv2780 Secreted L-alanine dehydrogenase Ald (40 kDa antigen) (TB43) Rv3914 Thioredoxin TrxC (TRX) (MPT46) Rv0667 DNA-directed RNA polymerase (beta chain)...”
- Comprehensive Comparative Analysis of Cholesterol Catabolic Genes/Proteins in Mycobacterial Species
van, International journal of molecular sciences 2019 - “...Rv3061c e acyl-CoA dehydrogenase fadE24 Rv3139 e acyl-CoA dehydrogenase fadE23 Rv3140 e acyl-CoA dehydrogenase fadE25 Rv3274c c acyl-CoA dehydrogenase FADE25 choD Rv3409c d cholesterol oxidase gcp Rv3419c c putative DNA-binding/iron metalloprotein/AP endonuclease Rv3421c c HP Rv3492c c CHP MCE associated protein Rv3493c c CHP MCE associated...”
- A chemical proteomics approach to profiling the ATP-binding proteome of Mycobacterium tuberculosis
Wolfe, Molecular & cellular proteomics : MCP 2013 - “...0.86 Integration host factor, MihF Rv1388 21 kDa (0.0001) 41.33 34.67 0.84 acyl-CoA dehydrogenase, FadE25 Rv3274c 42 kDa (0.3500) 2.00 1.67 0.83 DNA polymerase III chain, DnaN Rv0002 42 kDa (0.3500) 2.00 1.67 Pyridoxamine 5-phosphate oxidase, PdxH Rv2607 25 kDa (0.1100) 5.67 4.67 0.82 10-kDa chaperonin,...”
- Updating and curating metabolic pathways of TB
Slayden, Tuberculosis (Edinburgh, Scotland) 2013 - “..., 55 , 99 fadE18 Rv1933c acyl-CoA dehydrogenase E 54 , 55 , 99 fadE25 Rv3274c acyl-CoA dehydrogenase D fadE26 Rv3504 acyl-CoA dehydrogenase E fadE27 Rv3505 acyl-CoA dehydrogenase E fadE28 Rv3544c acyl-CoA dehydrogenase B, C, D, E, F 54 , 55 , 99 fadE29 Rv3543c acyl-CoA...”
- The Inhibitory Effect of GlmU Acetyltransferase Inhibitor TPSA on Mycobacterium tuberculosis May Be Affected Due to Its Methylation by Methyltransferase Rv0560c
Chen, Frontiers in cellular and infection microbiology 2019 - “...( kasA ) A5U4S7 3-oxoacyl-(Acyl-carrier-protein) synthase 1 43.29 5.11 0.015 10 486 442 2.02 206 MRA_3315 ( fadE25 ) A5U7U8 Acyl-CoA dehydrogenase 41.70 5.21 0.019 16 132 35 2.70 203 MRA_0251 ( fabG-1 ) A5TYW8 3-ketoacyl-(Acyl-carrier-protein) reductase 46.83 6.04 <0.0001 13 432 389 4.93 197 MRA_0251...”
blr3955 acyl-CoA dehydrogenase from Bradyrhizobium japonicum USDA 110
43% identity, 98% coverage
BOV_RS06310 isobutyryl-CoA dehydrogenase from Brucella ovis ATCC 25840
43% identity, 97% coverage
- Mining the Flavoproteome of Brucella ovis, the Brucellosis Causing Agent in Ovis aries
Minjárez-Sáenz, Microbiology spectrum 2022 - “...(100) Acyl-CoA_dh_M (PF02770) 122-217 Acyl-CoA_dh_1 (PF00441) 229-377 14 1.3.8.- b Acyl-CoA dehydrogenase Acyl-CoA_dh_N (PF02771) 12-123 BOV_RS06310 ABQ61585.1 FAD 1RX0 (57) Acyl-CoA_dh_M (PF02770) 127-221 Acyl-CoA_dh_1 (PF00441) 235-382 15 1.4.3.5 Pyridoxamine 5-phosphate oxidase Putative_PNPOx (PF01243) 29-113 BOV_RS02140 (pdxH) ABQ60142.1 FMN 1NDL (45) PNP_phzG_C (PF10590) 166-208 16 1.4.3.19 Glycine...”
AF2244 acyl-CoA dehydrogenase (acd-11) from Archaeoglobus fulgidus DSM 4304
42% identity, 93% coverage
- Assessment of the Carbon Monoxide Metabolism of the Hyperthermophilic Sulfate-Reducing Archaeon Archaeoglobus fulgidus VC-16 by Comparative Transcriptome Analyses
Hocking, Archaea (Vancouver, B.C.) 2015 - “...genes in the category fatty acid metabolism (I) encoding: enoyl-CoA hydratase (AF0963), acyl-CoA dehydrogenase (AF0964, AF2244), acetyl-CoA acetyltransferase (AF0967, AF2243), and acetyl-CoA synthetase (AF1287). Other upregulated transcripts encode enzymes involved in oxidation of uneven fatty acids/propionate metabolism, the putative methylmalonyl mutases (AF1288a, -b and AF2219). Finally,...”
2d29A / Q5SGZ2 Structural study on project id tt0172 from thermus thermophilus hb8
47% identity, 96% coverage
- Ligand: flavin-adenine dinucleotide (2d29A)
C9Z7Q3 Acyl-CoA dehydrogenase from Streptomyces scabiei (strain 87.22)
45% identity, 94% coverage
- Comparative secretome analysis of Streptomyces scabiei during growth in the presence or absence of potato suberin
Komeil, Proteome science 2014 - “...d Acetyl CoA acyl transferase 0.010.01 0.100.09 0.140.07 C9YYE5 SCAB_70541 Lipolytic enzyme 0.070.09 nd nd C9Z7Q3 SCAB_75771 d Acyl-CoA dehydrogenase 0.020.01 0.020.03 nd Degradation of aromatic compounds C9Z2P6 SCAB_57301 3-oxo-5.6-dehydrosuberyl-CoA semialdehyde dehydrogenase 0.130.17 nd nd Carbohydrate metabolism C9YSY4 SCAB_4561 Glycosyl hydrolase 0.000.00 0.020.02 0.000.00 C9YVM5 SCAB_5761...”
- “...have been detected only in the supernatant of CSM (C9YTK3, C9YYE5, C9YY49, C9ZD66, C9ZGV4, C9Z6Y2, C9Z7Q3 and C9Z776) or were more abundant in this medium (C9ZCR0, C9Z5Z2 and C9Z707). Four of these proteins, a protein from the esterase-lipase family (C9YTK3), a lipolytic enzyme (C9YYE5), a glycerophosphoryl...”
AzCIB_1942 acyl-CoA dehydrogenase family protein from Azoarcus sp. CIB
44% identity, 95% coverage
lpp0931 hypothetical protein from Legionella pneumophila str. Paris
42% identity, 96% coverage
C6369_RS06395 acyl-CoA dehydrogenase from Rhodococcus rhodochrous
43% identity, 97% coverage
- Catabolism of Alkylphenols in Rhodococcus via a Meta-Cleavage Pathway Associated With Genomic Islands
Levy-Booth, Frontiers in microbiology 2019 - “...acid degradation pathway (Jimenez-Diaz et al., 2017 ) encoded by butyryl-CoA dehydrogenase genes (locus tags: C6369_RS06395, C6369_RS20140, C6369_RS07820, C6369_RS05465), enoylCoA hydratase (C6369 _RS19405, C6369_RS19860), 3-hydroxybutyryl-CoA dehydrogenase (C6369_RS03325, C6369_RS06400), and acetyl-CoA acyltransferase (C6369_RS17095, C6369_RS15900, C6369_RS19850) ( Supplementary Figure 2 ). The catABC cluster encoding catechol 1,2-dioxygenase and...”
Acadsb / P70584 2-methyl branched chain acyl-CoA dehydrogenase subunit (EC 1.3.8.5) from Rattus norvegicus (see 2 papers)
ACDSB_RAT / P70584 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 from Rattus norvegicus (Rat) (see 3 papers)
39% identity, 86% coverage
- function: Short and branched chain specific acyl-CoA dehydrogenase that catalyzes the removal of one hydrogen from C-2 and C-3 of the fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA (PubMed:12855692, PubMed:6874697, PubMed:8660691). Among the different mitochondrial acyl-CoA dehydrogenases, acts specifically on short and branched chain acyl-CoA derivatives such as (S)-2-methylbutyryl-CoA as well as short straight chain acyl-CoAs such as butyryl-CoA (PubMed:12855692, PubMed:6874697, PubMed:8660691). Plays an important role in the metabolism of L-isoleucine by catalyzing the dehydrogenation of 2-methylbutyryl-CoA, one of the steps of the L- isoleucine catabolic pathway (By similarity). Can also act on valproyl- CoA, a metabolite of the valproic acid drug (PubMed:8660691).
catalytic activity: 2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43780)
catalytic activity: (2S)-2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48256)
catalytic activity: (2R)-2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = ethylacryloyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:65296)
catalytic activity: butanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-butenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:24004)
catalytic activity: 2-methylpropanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylpropenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:44180)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: valproyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-propylpent-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:65344)
cofactor: FAD
subunit: Homotetramer. - Hyperoside attenuates non-alcoholic fatty liver disease in rats via cholesterol metabolism and bile acid metabolism.
Wang, Journal of advanced research 2021 - “...Fatty acid degradation P23965 ECI1, DCI 14 14 1 48.1 Delta3-Delta2-enoyl-CoA isomerase [EC:5.3.3.8] 1.19 0.0145 P70584 ACADSB 15 15 15 51.2 Short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12] 1.36 0.0281 A1L128 Adh4 19 4 4 81.2 Alcohol dehydrogenase 4 [EC:1.1.1.1] 1.83 0.0005 Q7TQ90 Adh4 31 31 0 49.5...”
- Inflammation and apoptosis accelerate progression to irreversible atrophy in denervated intrinsic muscles of the hand compared with biceps: proteomic analysis of a rat model of obstetric brachial plexus palsy.
Yu, Neural regeneration research 2020 - “...12 P12785 * , A0A0G2K5G8 * , Q63151 * , P33124, P17764, Q9WVK7, Q9WVK3, P08503, P70584, P14604, Q5M9H2, Q63704 0.002 Pathways at 5 weeks Glycolysis/gluconeogenesis 29 G3V9W6 * , P25113 * , D3ZZN3, P07323, P30835, A0A0G2JZH8, Q6P9U7, E9PTN6, D4A5G8, Q9Z1N1, B1WBN9, P49432, E9PTV9, Q6P6R2, P08461, P27881,...”
- “...A0A0G2JZH8, A0A0G2K1W9, O88989 < 0.001 Fatty acid metabolism 18 O35547 * , Q63151 * , P70584, Q9WVK3, P33124, G3V9U2, P14604, P17764, P15651, Q64428, Q5M9H2, Q9WVK7, Q60587, P18163, P18886, P08503, P07896, G3V7N5 < 0.001 Calcium signaling 16 P11275, P20651, A0A0G2K9C8, P13286, Q64578, A0A0G2JSR0, F1LLZ7, Q304F3, G3V731, A0A0G2K5J1,...”
- Functional proteomic analysis of corticosteroid pharmacodynamics in rat liver: Relationship to hepatic stress, signaling, energy regulation, and drug metabolism.
Ayyar, Journal of proteomics 2017 - “...beta oxidation - catalyses the carboxylation reaction of propionyl CoA to form (S)-methylmalonyl CoA UP P70584 Acadsb Short/branched chain acyl-CoA dehydrogenase, mitochondrial Fatty acid beta oxidation - greatest activity toward short branched chain acyl-CoA derivatives UP/DOWN P15651 Acads Short-chain specific acyl-CoA dehydrogenase (SCAD) Fatty acid beta...”
- Differential permeabilization effects of Ca2+ and valinomycin on the inner and outer mitochondrial membranes as revealed by proteomics analysis of proteins released from mitochondria
Yamada, Molecular & cellular proteomics : MCP 2009 - “...Mt, Cy Cy, N IMS IM M M M Mt P04182 P00507 Q64602 P15650 P70584 P32551 Q63276 P12007 P08503 P17764 O09171 P15651 49 48 48 48 48 48 47 47 47 45 45 45 M M Mt M M...”
- A single acyl-CoA dehydrogenase is required for catabolism of isoleucine, valine and short-chain fatty acids in Aspergillus nidulans.
Maggio-Hall, Fungal genetics and biology : FG & B 2008
PA1631 probable acyl-CoA dehydrogenase from Pseudomonas aeruginosa PAO1
A4W92_RS03220 acyl-CoA dehydrogenase family protein from Pseudomonas aeruginosa
44% identity, 95% coverage
- An atlas of the binding specificities of transcription factors in Pseudomonas aeruginosa directs prediction of novel regulators in virulence
Wang, eLife 2021 - “...for the predicted binding of PhoB in the promoters of PA0136, PA2803, PA2548, PA0842, PA3940, PA1631, phoA , PA0730, PA2428, PA3250, ctpL , PA5473, aer , yrfI , aspA , PA1736, panB , PA1769, and PA3258. By contrast, the promoter fragment of triA is used as...”
- Static Growth Promotes PrrF and 2-Alkyl-4(1H)-Quinolone Regulation of Type VI Secretion Protein Expression in Pseudomonas aeruginosa
Brewer, Journal of bacteriology 2020 (secret) - Dissection of the cis-2-decenoic acid signaling network in Pseudomonas aeruginosa using microarray technique
Rahmani-Badi, Frontiers in microbiology 2015 - “...uppS, mdcA, atuC,PA0098, PA0182,PA0286, PA0493, PA0506-PA0508, PA0745-PA0746, PA0879, PA1020-PA1022, PA1187, PA1240, PA1470, PA1535, PA1576, PA1628-PA1629, PA1631, PA1827, PA1869, PA2550, PA2552, PA2815, PA2841, PA2887-PA2891, PA2893, PA3286, PA3426, PA3589, PA3591, PA3593, PA3924,PA4089, PA4330, PA4912, PA4979-PA4980, PA4995, PA5020, PA5524 Protein and Amino acid metabolism thrS, folC, glnA, gmk, tgt,...”
- Cloning and genetic characterization of dca genes required for beta-oxidation of straight-chain dicarboxylic acids in Acinetobacter sp. strain ADP1
Parke, Applied and environmental microbiology 2001 - “...dcaE (PA1629), dcaH (PA1628), dcaR (PA1630), and dcaA (PA1631). In Acinetobacter, dcaR is linked to dcaF and has been identified tentatively as one of...”
- “...in the aligned portion of the proteins. Only DcaA homolog PA1631 is very similar to its ADP1 homolog. In addition, the DcaA homolog PA3593 is 191 amino acids...”
- Insights into the Synergistic Antibacterial Activity of Silver Nitrate with Potassium Tellurite against Pseudomonas aeruginosa
Pormohammad, Microbiology spectrum 2023 - “...48 ). On the other hand, the parallel upregulation of acyl coenzyme A (acyl-CoA) dehydrogenase (A4W92_RS03220; see Table S3) (which catalyzes the first step in the -oxidation of fatty acids) might be an alternative pathway in the generation of acetyl-CoA to allow the operation of the...”
E9PE82 short-chain acyl-CoA dehydrogenase from Homo sapiens
42% identity, 92% coverage
- Haptoglobin Induces a Specific Proteomic Profile and a Mature-Associated Phenotype on Primary Human Monocyte-Derived Dendritic Cells.
Torres, International journal of molecular sciences 2022 - “...cytoskeleton BZW2 Q75MG1 Basic leucine zipper and W2 domain-containing protein 2 E Cadherin binding ACADS E9PE82 Short-chain specific acyl-CoA dehydrogenase, mitochondrial E i. Acyl-CoA; butiryl-CoA dehydrogenase activity, ii. Flavin adenine dinucleotide binding CRYAB E9PR44 Alpha-crystallin B chain E i. Amyloid-beta; identical protein; metal ion; microtubule; and...”
- Effect of Inulin on Proteome Changes Induced by Pathogenic Lipopolysaccharide in Human Colon
Guarino, PloS one 2017 - “...Homo sapiens GN = EIF5A PE = 1 SV = 3 - [I3L397_HUMAN] 0,5 1,0 E9PE82 Short-chain-specific acyl-CoA dehydrogenase, mitochondrial OS = Homo sapiens GN = ACADS PE = 1 SV = 1 - [E9PE82_HUMAN] 0,5 1,0 Q6P996-3 Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1...”
- Proteomics analyses for the global proteins in the brain tissues of different human prion diseases
Shi, Molecular & cellular proteomics : MCP 2015 - “...0.0180 21 P11766, F5GWH2, P42765, H0Y9U7, G3V1S9, Q92947, P49748, F5H0M0, P49189, P49419, P24752, C9JDE9, P30084, E9PE82, P40939, B4E2W0, P50416, B4DJE7, P05091, Q16836, P30837 5 Adipocytokine signaling pathway 0.02371 8 J3KPZ9, D7R525, F5GWH2, H0Y9U7, Q06124, G3V1S9, P42345, P50416 6 Butanoate metabolism a 0.02969 14 Q99259, P80404, P08559,...”
NP_001037672 acyl-coenzyme A dehydrogenase from Bombyx mori
40% identity, 88% coverage
PA14_43420 putative acyl-CoA dehydrogenase from Pseudomonas aeruginosa UCBPP-PA14
44% identity, 95% coverage
BMEI1923 ISOVALERYL-COA DEHYDROGENASE from Brucella melitensis 16M
41% identity, 97% coverage
- Transcriptomic Analysis of the Brucella melitensis Rev.1 Vaccine Strain in an Acidic Environment: Insights Into Virulence Attenuation
Salmon-Divon, Frontiers in microbiology 2019 - “...Overexpression/overexpression BMEI1211 Amino acid ABC transporter substrate-binding protein Overexpression/overexpression BMEI1390 ABC transporter substrate-binding protein Overexpression/overexpression BMEI1923 Isovaleryl-CoA dehydrogenase Overexpression/overexpression BMEII0203 ABC transporter substrate-binding protein Overexpression/overexpression BMEII0344 ABC transporter permease Overexpression/overexpression BMEII0550 Glycine/betaine ABC transporter substrate-binding protein Overexpression/overexpression BMEII0590 Sugar-binding periplasmic protein Overexpression/overexpression BMEII0633 Branched-chain amino acid...”
- Genomic analysis of the original Elberg Brucella melitensis Rev.1 vaccine strain reveals insights into virulence attenuation
Salmon-Divon, Virulence 2018 - “...strain 16M. Locus tag Definition Mutation Annotation BMEI0010 chromosome partitioning protein parb p.His277Arg Missense variant BMEI1923 isovaleryl-CoA dehydrogenase p.Pro273Ser Missense variant BMEII0268 succinyl-diaminopimelate desuccinylase p.Cys224Tyr Missense variant BMEII0435 D-ribose ABC transporter substrate-binding protein p.Ala45fs Frameshift variant BMEII1048 60 kDa chaperonin groEL p.Cys284Arg Missense variant Virulence associated...”
- Comparative proteomics analyses reveal the virB of B. melitensis affects expression of intracellular survival related proteins
Wang, PloS one 2009 - “...metabolism Q63 gi|17988859 BMEII0514 fabG 3-ketoacyl-(acyl-carrier-protein) reductase 27/31 5.44/5.52 0.59 IQR C 3.2 Q73 gi|17988206 BMEI1923 caiA isovaleryl-CoA dehydrogenase 42/42 5.36/5.33 0.53 I U 2.2 Q44 gi|17986323 BMEI0039 accA acetyl-CoA carboxylase carboxyltransferase subunit alpha 35/34 6.14/6.62 0.70 I C 2.1 Q9 gi|17988206 BMEI1923 caiA isovaleryl CoA...”
- Molecular targets for rapid identification of Brucella spp
Ratushna, BMC microbiology 2006 - “...abortus 9-941 both contain the ORFs identical to BMEI1747, BMEII1071, BMEI 1746, and BMEI1896, BMEI1919-21, BMEI1923, BMEII0826, BMEII0850, and BMEI1662, which were shown to be completely or partially missing from either B. suis S100 or B. abortus S2308 or both respectively [ 17 ]. Supporting previous...”
- Comparative proteome analysis of Brucella melitensis vaccine strain Rev 1 and a virulent strain, 16M
Eschenbrenner, Journal of bacteriology 2002 - “...BMEI0251 BMEI0124 BMEI0536 BMEII0844 BMEI0755 BMEII0983 BMEII0435 BMEI1923 BMEI1923 BMEII0607 BMEI1708 5.16 5.39 5.28 5.11 5.34 4.98 4.77 5.41 5.31 5.40...”
- “...Isovaleryl-CoA dehydrogenase Putative binding protein YDDS precursor BMEI1923 BMEII0203 4.93 4.70 5.36 4.92 42.4 58.6 42.1 57.3 3.7 3.1 Transaldolase Lipoamide...”
DDB_G0282967 acyl-CoA dehydrogenase from Dictyostelium discoideum AX4
39% identity, 90% coverage
SCLAV_0665 acyl-CoA dehydrogenase family protein from Streptomyces clavuligerus
45% identity, 95% coverage
- Comparative Transcriptome Analysis of Streptomyces Clavuligerus in Response to Favorable and Restrictive Nutritional Conditions
Pinilla, Antibiotics (Basel, Switzerland) 2019 - “...via argH (argininosuccinate lyase), whose expression also increased in SB-M. TCA-cycle-associated genes e.g., acyl-CoA dehydrogenase (SCLAV_0665), malate dehydrogenase (SCLAV_3742) and central metabolism-associated genes e.g., those coding for pyruvate dehydrogenase (SCLAV_1401) and aldehyde dehydrogenase (SCLAV_5677), were differentially expressed. Arginine metabolism has also been extensively studied in S....”
- “...1.108 10 2 Carbon metabolism SCLAV_5677 Aldehyde dehydrogenase 5.151 9.470 10 12 3.370 10 9 SCLAV_0665 Acyl-CoA dehydrogenase 2.943 2.290 10 4 6.964 10 3 SCLAV_3742 Malate dehydrogenase 2.146 1.345 10 3 2.800 10 2 SCLAV_1401 Pyruvate dehydrogenase E1 component 2.107 1.630 10 3 3.202 10...”
PGA1_c10280 Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) from Phaeobacter inhibens DSM 17395
41% identity, 96% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (RXN0-2301) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Sfum_1371 Butyryl-CoA dehydrogenase from Syntrophobacter fumaroxidans MPOB
42% identity, 96% coverage
- Comparative proteome analysis of propionate degradation by Syntrophobacter fumaroxidans in pure culture and in coculture with methanogens
Sedano-Núñez, Environmental microbiology 2018 - “...or crotonate, complexes similar to Bcd/Etf have been predicted from the genome. The acylCoA subunit (Sfum_1371) of one of these complexes was abundant in all conditions, while the Etf subunits (Sfum_1372 and Sfum_1373) were detected in lower levels, and the beta subunit was not detected at...”
- “...Sfum_0107 was abundant in all conditions at similar levels than the acylCoA subunit from gene Sfum_1371. (Supporting Information Fig. S2) Two additional paralogs coding for AcylCoA/Etf complexes were found in the genome (Sfum_368688 and Sfum_39293931), but not detected in our proteomic analysis. Finally, NfnAB (Sfum_21502151), another...”
Q9DBL1 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Mus musculus
NP_080102 short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Mus musculus
38% identity, 86% coverage
- Proteomic Assessment of C57BL/6 Hippocampi after Non-Selective Pharmacological Inhibition of Nitric Oxide Synthase Activity: Implications of Seizure-like Neuronal Hyperexcitability Followed by Tauopathy
Hendrickx, Biomedicines 2022 - “...0.0266 O35737 Hnrnph1 Heterogeneous nuclear ribonucleoprotein H 0.833 0.0266 P16858 Gapdh Glyceraldehyde-3-phosphate dehydrogenase 0.961 0.0333 Q9DBL1 Acadsb Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial 0.916 0.0333 P60710 Actb Actin, cytoplasmic 1 0.907 0.0394 biomedicines-10-01772-t003_Table 3 Table 3 Top 10 most significant MGI Mammalian Phenotype terms for the...”
- Effects of Hyperoxia and Hyperoxic Oscillations on the Proteome of Murine Lung Microvascular Endothelium
Tiboldi, Antioxidants (Basel, Switzerland) 2022 - “...1 Q3U1W3 Adam9 0.00134 1 . 308 91,848 MOUSE Disintegrin and metalloproteinase domain-containing protein 9 Q9DBL1 Acadsb 0.01594 1 . 349 47,874.5 MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial Q03145 Epha2 0.01586 1 . 402 108,853.2 MOUSE Ephrin type-A receptor 2 O70439 Stx7 0.02471 1 ....”
- ISG15 Is a Novel Regulator of Lipid Metabolism during Vaccinia Virus Infection.
Albert, Microbiology spectrum 2022 - “...5.03 P52825 Cpt2 Carnitine O -palmitoyltransferase 2, mitochondrial 4.69 Q60759 Gcdh Glutaryl-CoA dehydrogenase, mitochondrial 4.47 Q9DBL1 Acadsb Short/branched-chain-specific acyl-CoA dehydrogenase, mitochondrial 4.41 Q9Z2Z6 Slc25a20 Mitochondrial carnitine/acylcarnitine carrier protein 4.14 P41216 Acsl1 Long-chain fatty acid-CoA ligase 1 3.38 P32020 Scp2 Sterol carrier protein 2 3.24 Q9D1I5 Mcee...”
- “...Q9CQ62 Decr1 2,4-Dienoyl-CoA reductase ([3E]-enoyl-CoA-producing), mitochondrial 4.23 P50544 Acadvl Very long-chain-specific acyl-CoA dehydrogenase, mitochondrial 3.55 Q9DBL1 Acadsb Short/branched-chain-specific acyl-CoA dehydrogenase, mitochondrial 3.04 Q60759 Gcdh Glutaryl-CoA dehydrogenase, mitochondrial 3.02 Q8K370 Acad10 Acyl-CoA dehydrogenase family member 10 2.12 Q8CAY6 Acat2 Acetyl-CoA acetyltransferase, cytosolic 2.61 P97742 Cpt1a Carnitine O...”
- Effects of microgravity exposure and fructo-oligosaccharide ingestion on the proteome of soleus and extensor digitorum longus muscles in developing mice.
Ohira, NPJ microgravity 2021 - “...=1.6E1 Acadm (P45952) * FC=0.53, P =1.5E3 * FC=0.61, P =2.8E4 FC=0.94, P =2.3E1 Acadsb (Q9DBL1) * FC=0.70, P =5.9E3 FC=0.83, P =6.4E2 FC=0.90, P =2.8E1 Acadvl (P50544) * FC=0.69, P =3.4E4 * FC=0.78, P =4.1E3 FC=0.93, P =1.7E1 Acox1 (Q9R0H0) * FC=0.15, P =8.0E4 *...”
- Proteomic profiling of liver tissue from the mdx-4cv mouse model of Duchenne muscular dystrophy
Murphy, Clinical proteomics 2018 - “...medium, long and very long chain specific acyl-CoA dehydrogenases (P51174, Q8K370, Q8JZN5, P45952, Q07417, P50544, Q9DBL1, Q80XL6) and 3-hydroxyacyl-CoA dehydrogenase (O08756), and (5) enzymes of ketone body metabolism, including the cytoplasmic HMGCS1 isoform (Q8JZK9) and mitochondrial HMGCS2 isoform (P54869) of hydroxyl-methylglutaryl-CoA synthase. Proteomic profiling of liver...”
- Subproteomic profiling of sarcolemma from dystrophic mdx-4cv skeletal muscle.
Murphy, Data in brief 2018 - “...1.5 6.12E-03 1.9 P47955 Rplp1 60S acidic ribosomal protein P1 1 1 3.1 1.05E-04 1.8 Q9DBL1 Acadsb Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial 1 1 93.0 6.83E-03 1.8 Q9CQY5 Magt1 Magnesium transporter protein 1 1 1 66.1 9.76E-03 1.8 Q9D6Y9 Gbe1 1,4-alpha-glucan-branching enzyme 1 1 1.7...”
- A new non-canonical pathway of Gα(q) protein regulating mitochondrial dynamics and bioenergetics
Benincá, Cellular signalling 2014 - “...6.73 117.94 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus GN=Idh3a PE=1 SV=1 - [IDH3A_MOUSE] Q9DBL1 49.77 34 21 432 47.8 7.87 115.01 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadsb PE=1 SV=1 - [ACDSB_MOUSE] Q07417 59.22 34 24 412 44.9 8.79 106.53 Short-chain specific...”
- Postconditioning leads to an increase in protein S-nitrosylation
Tong, American journal of physiology. Heart and circulatory physiology 2014 - “...Succinyl-CoA ligase subunit P03899 Q91ZA3 Q9DBL1 Q9CZB0 Q8K2B3 Q8BWF0 Q9WUM5 Q9Z2I9 Voltage-dependent anion-selective channel-1 Voltage-dependent...”
- More
- LncMyoD Promotes Skeletal Myogenesis and Regulates Skeletal Muscle Fiber-Type Composition by Sponging miR-370-3p.
Zhang, Genes 2021 - GeneRIF: LncMyoD Promotes Skeletal Myogenesis and Regulates Skeletal Muscle Fiber-Type Composition by Sponging miR-370-3p.
- Molecular processes during fat cell development revealed by gene expression profiling and functional annotation
Hackl, Genome biology 2005 - “...(Acadm) NP_031408 153 6/9 Isovaleryl-CoA dehydrogenase (Acad) Mm.6635 510 6 Acyl-CoA dehydrogenase, short/branched chain (Acadsb) NP_080102 220 9 Triglyceride metabolism Adipose triglyceride lipase (Pnpla2/Atgl) NP_080078 157 6 CoA biosynthesis Pantothenate kinase 3 NP_666074 140 6 Anaplerotic processes Pyruvate carboxylase NP_032823 149 6 Branched chain amino acid...”
Q0NXR6 Isobutyryl-CoA dehydrogenase, mitochondrial from Bos taurus
NP_001069019 isobutyryl-CoA dehydrogenase, mitochondrial precursor from Bos taurus
41% identity, 89% coverage
Tfu_1647 / Q47PD7 5-carboxy-2-pentenoyl-CoA reductase from Thermobifida fusca (strain YX) (see 2 papers)
Tfu_1647 acyl-CoA dehydrogenase from Thermobifida fusca YX
43% identity, 97% coverage
- Repurposing of waste PET by microbial biotransformation to functionalized materials for additive manufacturing
Kolitha, Journal of industrial microbiology & biotechnology 2023 - “...Mad123146) expressing five-step reverse adipate-degradation pathway (RADP) identified in Thermobifida fusca , including overexpression of Tfu_1647 by pTrc99A and deletion of succinate-CoA ligase to promote accumulation of succinyl-CoA Fed-batch fermentation Nylon-6, 6 production by polymerization Zhao et al. ( 2018 ) cis,cis -Muconic acid (MA) PET...”
- Microbial cell factories for bio-based biodegradable plastics production
Han, iScience 2022 - “...titer of up to 68 g/L from glycerol. 10 Overexpression of the key rate-limiting enzyme Tfu_1647 has been shown to be very important for the efficient production of adipic acid. Strategies such as elimination of by-product pathways and succinyl-CoA consumption pathways have also been used to...”
- Reverse β-oxidation pathways for efficient chemical production
Tarasava, Journal of industrial microbiology & biotechnology 2022 - “...PaaF, tdTER Acot8 Cheong et al. ( 2016 ) Glycerol Glutarate 36.5mmol/l Tfu_0875 Tfu_2399, Tfu_0067, Tfu_1647 Tfu_2576-7 Zhao et al. ( 2018 ) Glycerol C6C10 dicarboxylic acids 0.5g/l BktB BktB, FadB and egTer YdiI, AlkBGT, ChnD, and ChnE Clomburg et al. ( 2015 ) -Hydroxyacids Glycerol...”
- Implementation of Synthetic Pathways to Foster Microbe-Based Production of Non-Naturally Occurring Carboxylic Acids and Derivatives
Vila-Santa, Journal of fungi (Basel, Switzerland) 2021 - “...2,3-Dehydroadipyl-CoA hydratase (3); 4 .2.1.17 T. fusca Tfu_0067 Adipyl-CoA dehydrogenase (4) ; 1.1.1.35 T. fusca Tfu_1647 Adipyl-CoA thioesterase (5) T. fusca Tfu_2577 and 2576 3.83 mg/L [ 32 ] Reverse -oxidation followed by -reduction * E. coli 3-ketoacyl-CoA thiolase (6) 2.3.1.16 C. necator BktB Trans-enoyl-CoA reductase...”
- Biosynthesis of adipic acid in metabolically engineered Saccharomyces cerevisiae
Zhang, Journal of microbiology (Seoul, Korea) 2020 (PubMed)- “...by co-expressing genes of Tfu_ 0875, Tfu_2399, Tfu_0067, Tfu_1647, Tfu_2576, and Tfu_ 2576. The AA titer combined with biomass, cofactors and other by-products...”
- “...dehydrogenase (Tfu_0067), 5-carboxy-2-pentenoyl-CoA reductase (Tfu_1647), and adipyl-CoA synthetase (Tfu_2576-7), respectively (Fig. 1). Subsequently,...”
- Site-directed mutation to improve the enzymatic activity of 5-carboxy-2-pentenoyl-CoA reductase for enhancing adipic acid biosynthesis
Yang, Enzyme and microbial technology 2019 (PubMed)- “...6 genes: Tfu_0875, Tfu_2399, Tfu_0067, Tfu_1647, Tfu_2576 and Tfu_2577, which encodes -ketothiolase, 3-hydroxyacyl-CoA dehydrogenase, 3-hydroxyadipyl-CoA...”
- “...respectively. Of the genes in this pathway, Tfu_1647 is the limited step. Here, we constructed a homology model of 5-carboxy-2-pentenoyl-CoA reductase...”
- Metabolic engineering of Escherichia coli for producing adipic acid through the reverse adipate-degradation pathway
Zhao, Metabolic engineering 2018 (PubMed)- “...that the step catalyzed by 5-Carboxy-2-pentenoyl-CoA reductase (Tfu_1647) as the rate-limiting step of the RADP. Overexpression of Tfu_1647 by pTrc99A carried...”
- “...3-hydroxyadipyl-CoA dehydrogenase (Tfu_0067), 5-Carboxy-2-pentenoyl-CoA reductase (Tfu_1647), and adipyl-CoA synthetase (Tfu_2576-7). The ldhA , atoB , and...”
- Engineering Escherichia coli for Glutarate Production as the C5 Platform Backbone
Zhao, Applied and environmental microbiology 2018 - “...by expressing five enzymes (Tfu_0875, Tfu_2399, Tfu_0067, Tfu_1647, and Tfu_2576-7) for glutarate production (Fig. 1). The glutarate was detected, and 0.5...”
- “...3-hydroxyadipyl-CoA dehydrogenase (Tfu_0067), 5-carboxy-2-pentenoyl-CoA reductase (Tfu_1647), and adipyl-CoA synthetase (Tfu_2576-7). The arcA, ldhA, atoB,...”
- More
7w0jE / A0A4D5XMK4 Acyl-coa dehydrogenase, tfu_1647
43% identity, 98% coverage
- Ligand: [[(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2r,3s,4s)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate (7w0jE)
H16_B1371 Acyl-CoA dehydrogenase, short-chain specific from Ralstonia eutropha H16
42% identity, 95% coverage
CPI83_20015 acyl-CoA dehydrogenase family protein from Rhodococcus sp. H-CA8f
43% identity, 96% coverage
LOC118276297 short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Spodoptera frugiperda
39% identity, 89% coverage
- Genome-Wide Identification and Expression Profiling of Candidate Sex Pheromone Biosynthesis Genes in the Fall Armyworm (Spodoptera frugiperda)
Qu, Insects 2022 - “...99.02 SfruACD2 LOC118264809 410 NC_049715.1 14,866,408 14,875,265 acyl-CoA dehydrogenase QZC92122.1 Dioryctria abietella 0.0 72.68 SfruACD3 LOC118276297 418 NC_049731.1 13,012,363 13,027,495 short/branched-chain specific acyl-CoA dehydrogenase, mitochondrial XP_022827910.1 Spodoptera litura 0.0 99.28 SfruACD4 LOC118265626 422 NC_049710.1 13,581,976 13,599,130 putative medium-chain specific acyl-CoA dehydrogenase AID66670.1 Agrotis segetum 0.0 96.45...”
C6369_RS07820 acyl-CoA dehydrogenase family protein from Rhodococcus rhodochrous
43% identity, 97% coverage
- Catabolism of Alkylphenols in Rhodococcus via a Meta-Cleavage Pathway Associated With Genomic Islands
Levy-Booth, Frontiers in microbiology 2019 - “...pathway (Jimenez-Diaz et al., 2017 ) encoded by butyryl-CoA dehydrogenase genes (locus tags: C6369_RS06395, C6369_RS20140, C6369_RS07820, C6369_RS05465), enoylCoA hydratase (C6369 _RS19405, C6369_RS19860), 3-hydroxybutyryl-CoA dehydrogenase (C6369_RS03325, C6369_RS06400), and acetyl-CoA acyltransferase (C6369_RS17095, C6369_RS15900, C6369_RS19850) ( Supplementary Figure 2 ). The catABC cluster encoding catechol 1,2-dioxygenase and other enzymes...”
ML0737 putative acyl-CoA dehydrogenase from Mycobacterium leprae TN
43% identity, 96% coverage
- Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
Dargham, FEBS open bio 2023 - “...Nonessential MSMEG_1743 MAB_2148 MMAR_1315 MUL_2565 RjosMsmeg Rv0154c fadE2 AcylCoA dehydrogenase Nonessential MSMEG_0102 MAB_0255 MMAR_0374 MUL_4790 ML0737 RopRjos Rv0895 Triacylglycerol synthase Nonessential MSMEG_6322 MAB_4544c MMAR_5271 MUL_2057 ML1244 RopRjos Rv3391 acrA1 Multifunctional enzyme with acylCoAreductase activity Nonessential MSMEG_1623 MAB_3710 MMAR_1153 MUL_0918 ML0862 RopRjos Rv0400c fadE7 AcylCoA dehydrogenase Nonessential...”
- Lipid Droplets and Mycobacterium leprae Infection
Elamin, Journal of pathogens 2012 - “...fadD26 (ML2358, fatty acid-CoA-ligase), fadD29 (ML0132, probable fatty-acid-CoA synthetase), fadD28 (ML0138, possible fatty-acid-CoA synthase), fadE25 (ML0737, probable acyl-CoA dehydrogenase), and fadE5 (ML2563, acyl-CoA dehydrogenase) [ 91 , 92 ]. Combing observations from leprosy lesions, this gives strong evidence that host lipids provide the main carbon and...”
D3YTT4 Acyl-Coenzyme A dehydrogenase family, member 8 from Mus musculus
40% identity, 90% coverage
MSMEG_4715 acyl-CoA dehydrogenase from Mycobacterium smegmatis str. MC2 155
43% identity, 97% coverage
NP_080138 isobutyryl-CoA dehydrogenase, mitochondrial precursor from Mus musculus
40% identity, 90% coverage
Q9D7B6 Isobutyryl-CoA dehydrogenase, mitochondrial from Mus musculus
40% identity, 90% coverage
- The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...Mitochondrial import membrane translocase (Tim29) Timm29 0.017629493 Q9WVA2 Mitochondrial import membrane translocase (Tim8A) Timm8a1 0.020053563 Q9D7B6 Isobutyryl-CoA dehydrogenase, mitochondrial Acad8 0.022488468 O08600 Endonuclease G, mitochondrial Endog 0.02435898 P47738 Aldehyde dehydrogenase, mitochondrial Aldh2 0.025395545 O35857 Mitochondrial import membrane translocase (Tim44) Timm44 0.025846245 Q6PE15 Mycophenolic acid acyl-glucuronide esterase...”
- Tandem mass tag-based quantitative proteomic analysis of effects of multiple sevoflurane exposures on the cerebral cortex of neonatal and adult mice.
Feng, Frontiers in neurology 2022 - Palm Oil-Rich Diet Affects Murine Liver Proteome and S-Palmitoylome
Ziemlińska, International journal of molecular sciences 2021 - “...acid degradation Q9D2G2 * Dlst 2-oxoglutarate dehydrogenase complex component E2, mitochondrial 0.34 1.23 1.32 0.95 Q9D7B6 Acad8 Isobutyryl-CoA dehydrogenase, mitochondrial 0.37 1.01 4.09 0.92 Q8BH00 Aldh8a1 Aldehyde dehydrogenase family 8 member A1 0.46 1.26 0.77 0.99 Q8BWF0 * Aldh5a1 Succinate-semialdehyde dehydrogenase, mitochondrial 0.47 1.13 0.73 1.11...”
- Proteomics and bioinformatics analysis of mouse hypothalamic neurogenesis with or without EPHX2 gene deletion.
Zhong, International journal of clinical and experimental pathology 2015 - A new non-canonical pathway of Gα(q) protein regulating mitochondrial dynamics and bioenergetics
Benincá, Cellular signalling 2014 - “...370 40.7 7.43 34.80 Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 - [PPID_MOUSE] Q9D7B6 28.57 14 12 413 45.0 8.13 34.16 Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acad8 PE=2 SV=2 - [ACAD8_MOUSE] Q3URS9 34.24 11 9 406 45.1 8.09 33.59 Coiled-coil domain-containing protein 51 OS=Mus...”
- Renal proteome in mice with different susceptibilities to fluorosis
Carvalho, PloS one 2013 - “...mice 563 Transaldolase 37.5/5.975 37.4/6.6 5/151 Q93092 Metabolism 564 Isobutyryl-CoA dehydrogenase, mitochondrial 40.5/6.905 42.8/7.2 6/202 Q9D7B6 Metabolism 565 Short-chain specific acyl-CoA dehydrogenase, mitochondrial 41/6.805 42.2/6.3 9/396 Q07417 Metabolism 567 Cystathionine gamma-lyase 43.5/7.99 43.6/7.6 5/163 Q8VCN5 Metabolism 568 Hydroxymethylglutaryl-CoA synthase, cytoplasmic 56/5.7 57.6/5.65 2/62 Q8JZK9 Metabolism 586...”
An01g12960 uncharacterized protein from Aspergillus niger
40% identity, 85% coverage
D2UXG9 Isovaleryl-CoA dehydrogenase, mitochondrial from Naegleria gruberi
39% identity, 92% coverage
W5PUC2 short-chain acyl-CoA dehydrogenase from Ovis aries
42% identity, 91% coverage
BR0020 isovaleryl-CoA dehydrogenase from Brucella suis 1330
41% identity, 97% coverage
SPO2793 isovaleryl-CoA dehydrogenase from Ruegeria pomeroyi DSS-3
41% identity, 96% coverage
- Diel investments in metabolite production and consumption in a model microbial system
Uchimiya, The ISME journal 2022 - “...acid derivative Betaine SPO3186 opuD Glycine-betaine transporter 1.6 (n.s.) [ 25 ] Amino Acid Leucine SPO2793 ivD isovaleryl-CoA dehydrogenase 2.6 SPO2789 mccA methylcrotonyl-CoA carboxylase, alpha subunit 3.1 SPO2790 mccB methylcrotonyl-CoA carboxylase, beta subunit 3.4 SPO0390 glutamate/leucine/phenylalanine/valine dehydrogenase 1.2 (n.s.) Amino acid derivative Ectoine/ 5-hydroxyectoine SPO1146 uehB...”
ACADM_DROME / Q9VSA3 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; EC 1.3.8.7 from Drosophila melanogaster (Fruit fly) (see paper)
NP_648149 Medium-chain acyl-CoA dehydrogenase from Drosophila melanogaster
41% identity, 89% coverage
- function: Medium-chain specific acyl-CoA dehydrogenase that catalyzes the first step of mitochondrial fatty acid beta-oxidation, an aerobic process that breaks down fatty acids into acetyl-CoA and allows the production of energy from fats (PubMed:29563254). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA (By similarity). Electron transfer flavoprotein (ETF) is the electron acceptor that transfers electrons to the main mitochondrial respiratory chain via ETF- ubiquinone oxidoreductase (ETF dehydrogenase) (By similarity). May contribute to Pink1-mediated regulation of fatty acid and amino acid metabolism, through a mechanism that is independent of its acyl-CoA dehydrogenase activity (PubMed:29563254).
catalytic activity: a medium-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a medium-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:14477)
cofactor: FAD
subunit: Homotetramer.
disruption phenotype: Defects in fatty acid oxidation results in a significant increase in the medium-chain acylcarnitines C6, C8, and C10, which is further elevated under starvation conditions. - Phosphorylation of MCAD selectively rescues PINK1 deficiencies in behavior and metabolism.
Course, Molecular biology of the cell 2018 - GeneRIF: PINK1 mediates the phosphorylation of MCAD, a mitochondrial matrix protein critical to fatty acid metabolism.
- Pterostilbene Promotes Mean Lifespan in Both Male and Female Drosophila Melanogaster Modulating Different Proteins in the Two Sexes
Beghelli, Oxidative medicine and cellular longevity 2022 - “...Q7K4Q9 Hmgs 3-hydroxy-3-methylglutaryl coenzyme A synthase 54 30 19 51.1 6.32 112 1.52 0.022 2389 Q9VSA3 CG12262 Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial 47 64 24 45.8 7.94 207 1.51 0.015 2600 M9PF46 Prps Ribe-phphate diphphokinase 58 34 22 40.9 7.91 120 1.57 0.028 2812 P22465...”
- Lipid metabolic perturbation is an early-onset phenotype in adult spinster mutants: a Drosophila model for lysosomal storage disorders
Hebbar, Molecular biology of the cell 2017 - “...P11997 Larval serum protein 1 gamma chain CG6821 15 O18404 3-Hydroxyacyl-CoA dehydrogenase type-2 CG7113 16 Q9VSA3 Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial CG12262 17 P02844 Vitellogenin-2 CG2979 18 Q94511 NADH-ubiquinone oxidoreductase, 75kDa subunit CG2286 19 Q7KN94 Walrus, isoform A/FAD binding CG8996 20 Q95U46 GH07925p/flavin adenine dinucleotide...”
BAB2_0214 Acyl-CoA dehydrogenase:Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central domain:Acyl-CoA dehydrogenase, N-te... from Brucella melitensis biovar Abortus 2308
43% identity, 95% coverage
- Molecular control of gene expression by Brucella BaaR, an IclR-type transcriptional repressor
Herrou, The Journal of biological chemistry 2018 - “...to WT (Fig. 3A). These four genes, bab2_0213, bab2_0214, bab2_0216, and bab2_0217, are contiguous and adjacent to baaR (bab2_0215). Genes bab2_0213, bab2_0214,...”
- “...ADP1 is involved in cis,cis-muconic acid uptake (39). bab2_0214 is annotated as an acyl-CoA dehydrogenase; this family of flavoJ. Biol. Chem. (2018) 293(19)...”
2a1tC / P11310 Structure of the human mcad:etf e165betaa complex (see paper)
40% identity, 95% coverage
- Ligand: flavin-adenine dinucleotide (2a1tC)
B7Z9I1 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial from Homo sapiens
40% identity, 96% coverage
SCO1428 acyl-CoA dehydrogenase from Streptomyces coelicolor A3(2)
44% identity, 96% coverage
- Coelimycin Synthesis Activatory Proteins Are Key Regulators of Specialized Metabolism and Precursor Flux in Streptomyces coelicolor A3(2)
Bednarz, Frontiers in microbiology 2021 - “...(FabD), SCO2388 (FabH), SCO2390 (FabF), SCO4681, SCO6468, SCO6564 (FabH2), SCO6717 and degradation group members were: SCO1428, SCO1705, SCO1750, SCO4006, SCO6195 (MACS1), SCO6196 (FadD1), SCO6966, and SCO6968 ( Kanehisa et al., 2016 ). The first step of lipid degradation is the synthesis of fatty acyl-CoA. We have...”
BOV_RS00090 isovaleryl-CoA dehydrogenase from Brucella ovis ATCC 25840
41% identity, 95% coverage
- Mining the Flavoproteome of Brucella ovis, the Brucellosis Causing Agent in Ovis aries
Minjárez-Sáenz, Microbiology spectrum 2022 - “...(PF02770) 160-268 Acyl-CoA_dh_1 (PF00441) 288-457 Acyl-CoA_dh_C (PF12806) 470-585 13 1.3.8.4 Isovaleryl-CoA dehydrogenase Acyl-CoA_dh_N (PF02771) 7-118 BOV_RS00090 (ivd) ABQ60382.1 FAD 4KTO (83) 4O5M (100) Acyl-CoA_dh_M (PF02770) 122-217 Acyl-CoA_dh_1 (PF00441) 229-377 14 1.3.8.- b Acyl-CoA dehydrogenase Acyl-CoA_dh_N (PF02771) 12-123 BOV_RS06310 ABQ61585.1 FAD 1RX0 (57) Acyl-CoA_dh_M (PF02770) 127-221 Acyl-CoA_dh_1...”
ACADM / P11310 mitochondrial medium-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.7) from Homo sapiens (see 16 papers)
ACADM_HUMAN / P11310 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; Medium chain acyl-CoA dehydrogenase; MCADH; EC 1.3.8.7 from Homo sapiens (Human) (see 25 papers)
P11310 medium-chain acyl-CoA dehydrogenase (EC 1.3.8.7) from Homo sapiens (see 3 papers)
40% identity, 88% coverage
- function: Medium-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (PubMed:1970566, PubMed:21237683, PubMed:2251268, PubMed:8823175). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA (PubMed:2251268). Electron transfer flavoprotein (ETF) is the electron acceptor that transfers electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase) (PubMed:15159392, PubMed:25416781). Among the different mitochondrial acyl-CoA dehydrogenases, medium-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 6 to 12 carbons long primary chains (PubMed:1970566, PubMed:21237683, PubMed:2251268, PubMed:8823175).
catalytic activity: a medium-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a medium-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:14477)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: octanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-octenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48180)
catalytic activity: decanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-decenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48176)
catalytic activity: dodecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-dodecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47296)
catalytic activity: tetradecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-tetradecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47316)
catalytic activity: oxidized [electron-transfer flavoprotein] + hexadecanoyl-CoA + H(+) = (2E)-hexadecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43448)
cofactor: FAD
subunit: Homotetramer (PubMed:8823176, Ref.23). Interacts with the heterodimeric electron transfer flavoprotein ETF. - Dihydrotestosterone Augments the Angiogenic and Migratory Potential of Human Endothelial Progenitor Cells by an Androgen Receptor-Dependent Mechanism.
Popa, International journal of molecular sciences 2024 - “...esterase 0.446 1.73 10 3 P15374 Ubiquitin carboxyl-terminal hydrolase isozyme L3 0.464 1.44 10 3 P11310 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 0.356 2.66 10 2 P82909 28S ribosomal protein S36, mitochondrial 0.712 9.52 10 3 P23142 Fibulin-1 0.401 1.05 10 1 Q07960 rho GTPase-activating protein 1...”
- Cortical lipid metabolic pathway alteration of early Alzheimer's disease and candidate drugs screen.
Wang, European journal of medical research 2024 - “...TMEM126B, mitochondrial 0.997 10 Q7L0Y3 TRMT10C tRNA methyltransferase 10 homolog C 0.994 Down-regulated network 1 P11310 ACADM Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 0.996 2 Q0VD83 APOB Apolipoprotein B-100 0.996 3 P02649 APOE Apolipoprotein E 0.996 4 Q92851 CASP10 Caspase-10 0.999 5 O15519 CASP8 Caspase-8 0.999 6...”
- Differential Proteomic Analysis of Human Sperm: A Systematic Review to Identify Candidate Targets to Monitor Sperm Quality.
Corda, The world journal of men's health 2024 - “...26 54 ]; GZS [ 53 ]; Severe OAT [ 38 ] - - - P11310 ACADM Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 4 LM [ 34 ]; AZS [ 26 55 ]; Severe OAT [ 38 ] - - Cell differentiation P20155 SPINK2 Serine protease inhibitor...”
- Proteomic Dynamics of Multidrug Resistance Mechanisms in Lucena 1 Cell Line.
Beraldo-Neto, Cells 2024 - “...protein 1 subunit zeta-2 P78540 93.28 6 6 Arginase-2, mitochondrial P35609 93.05 9 0 Alpha-actinin-2 P11310 92.23 8 7 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial P62834 92.19 10 2 Ras-related protein Rap-1A cells-13-01427-t002_Table 2 Table 2 Comparative proteomic analysis of tubulins found in K562 and Lucena 1...”
- Extracellular vesicles from the trematodes Fasciola hepatica and Dicrocoelium dendriticum trigger different responses in human THP-1 macrophages.
Sánchez-López, Journal of extracellular vesicles 2023 - “...0.03239 1.90 S100 calciumbinding protein A11 P31949 0,03536 1.58 Mediumchain specific acylCoA dehydrogenase, mitochondrial (MCAD) P11310 0.03119 0.66 Tcomplex protein 1 subunit alpha (TCP1alpha) P17987 0.03156 0.48 Microsomal glutathione Stransferase 3 O14880 0.02118 0.34 26S proteasome nonATPase regulatory subunit 6 (PSMD6) Q15008 0.03545 0.34 Mitochondrial import...”
- Personalised modelling of clinical heterogeneity between medium-chain acyl-CoA dehydrogenase patients.
Odendaal, BMC biology 2023 - “...[ 10 ]. The deficient enzyme in MCADD, medium-chain acyl-CoA dehydrogenase (MCAD; EC: 1.3.8.7; UniProtKB: P11310) is one of a triad of enzymes in human cells (together with short- and very-long-chain acyl-CoA dehydrogenases, SCAD and VLCAD, respectively) that catalyse the first step of the mFAO. These...”
- Compendium of causative genes and their encoded proteins for common monogenic disorders.
Apgar, Protein science : a publication of the Protein Society 2022 - Preliminary Comparison of Endoscopic Brush and Net Catheters as the Sampling Tool to Analyze the Intestinal Mucus in the Rectum with Ulcerative Colitis Patients.
Nakamura, Digestion 2022 - More
NP_001120800 medium-chain specific acyl-CoA dehydrogenase, mitochondrial isoform b precursor from Homo sapiens
40% identity, 87% coverage
- Free carnitine concentrations and biochemical parameters in medium-chain acyl-CoA dehydrogenase deficiency: Genotype-phenotype correlation.
Weiss, Clinical genetics 2023 (PubMed)- GeneRIF: Free carnitine concentrations and biochemical parameters in medium-chain acyl-CoA dehydrogenase deficiency: Genotype-phenotype correlation.
- Functional and structural impact of 10 ACADM missense mutations on human medium chain acyl-Coa dehydrogenase.
Madeira, Biochimica et biophysica acta. Molecular basis of disease 2023 (PubMed)- GeneRIF: Functional and structural impact of 10 ACADM missense mutations on human medium chain acyl-Coa dehydrogenase.
- [Analysis of clinical characteristics and ACADM gene variants in four children with Medium chain acyl-CoA dehydrogenase deficiency].
Xiao, Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2023 (PubMed)- GeneRIF: [Analysis of clinical characteristics and ACADM gene variants in four children with Medium chain acyl-CoA dehydrogenase deficiency].
- Role of PPAR-related genes in chronic heart failure: evidence from large populations.
Ke, BMC cardiovascular disorders 2023 - GeneRIF: Role of PPAR-related genes in chronic heart failure: evidence from large populations.
- Genotype and residual enzyme activity in medium-chain acyl-CoA dehydrogenase (MCAD) deficiency: Are predictions possible?
Tucci, Journal of inherited metabolic disease 2021 (PubMed)- GeneRIF: Genotype and residual enzyme activity in medium-chain acyl-CoA dehydrogenase (MCAD) deficiency: Are predictions possible?
- Suppression of ACADM-Mediated Fatty Acid Oxidation Promotes Hepatocellular Carcinoma via Aberrant CAV1/SREBP1 Signaling.
Ma, Cancer research 2021 (PubMed)- GeneRIF: Suppression of ACADM-Mediated Fatty Acid Oxidation Promotes Hepatocellular Carcinoma via Aberrant CAV1/SREBP1 Signaling.
- Medium-Chain Acyl-CoA Dehydrogenase Protects Mitochondria from Lipid Peroxidation in Glioblastoma.
Puca, Cancer discovery 2021 - GeneRIF: Medium-Chain Acyl-CoA Dehydrogenase Protects Mitochondria from Lipid Peroxidation in Glioblastoma.
- Screening and follow-up results of fatty acid oxidative metabolism disorders in 608 818 newborns in Jining, Shandong province.
Yang, Zhejiang da xue xue bao. Yi xue ban = Journal of Zhejiang University. Medical sciences 2021 - GeneRIF: Screening and follow-up results of fatty acid oxidative metabolism disorders in 608 818 newborns in Jining, Shandong province.
- More
GAH_02050 acyl-CoA dehydrogenase family protein from Geoglobus ahangari
40% identity, 98% coverage
- The complete genome sequence and emendation of the hyperthermophilic, obligate iron-reducing archaeon "Geoglobus ahangari" strain 234(T)
Manzella, Standards in genomic sciences 2015 - “...are putatively encoded by 11 genes (GAH_00179, GAH_00421, GAH_00484, GAH_00591, GAH_01331, GAH_01442, GAH_01601, GAH_01810, and GAH_02050). A water molecule is then added to trans-2-enoyl-CoA to form (3S)-3-hydroxyacyl-CoA in a reaction catalyzed by an enoyl-CoA hydratase, which in G. ahangari could be encoded by 4 genes (GAH_00487,...”
1rx0A / Q9UKU7 Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
40% identity, 97% coverage
- Ligand: flavin-adenine dinucleotide (1rx0A)
SYN_00480 acyl-CoA dehydrogenase, short-chain specific from Syntrophus aciditrophicus SB
SYN_RS09650 glutaryl-CoA dehydrogenase Acd from Syntrophus aciditrophicus SB
41% identity, 96% coverage
SLCG_5215 acyl-CoA dehydrogenase family protein from Streptomyces lincolnensis
41% identity, 96% coverage
- PAS domain containing regulator SLCG_7083 involved in morphological development and glucose utilization in Streptomyces lincolnensis
Lin, Microbial cell factories 2023 - “...118.03 -1.51 0.017798 cyclitol dehydrogenase 84/90 Streptomyces griseofuscus , WP_125212155.1 1.1.1.- Lipid transport and metabolism SLCG_5215 213.11 825.51 1.95 0.040887 short-chain acyl-CoA dehydrogenase 96/98 Streptomyces hokutonensis , WP_019065764.1 1.3.99.12 SLCG_5739 241.29 698.13 1.53 0.043582 acetyl-CoA acetyltransferase 98/99 Streptomyces canus , WP_062042393.1 2.3.1.9 SLCG_7149 203.80 547.39 1.43...”
- “...They encode proteins involved in fatty acids oxidative catabolic pathway, including a short-chain acyl-CoA dehydrogenase (SLCG_5215), two acetyl-CoA acetyltransferases (SLCG_5739 and SLCG_7151), an acyl-CoA transferases (SLCG_7149), a long-chain specific acyl-CoA dehydrogenase (SLCG_7150), a fatty acid oxidative multifunctional enzyme (SLCG_7152). In particular, four of them ( SLCG_7149...”
ACAD8_HUMAN / Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial; IBDH; Activator-recruited cofactor 42 kDa component; ARC42; Acyl-CoA dehydrogenase family member 8; ACAD-8; EC 1.3.8.5 from Homo sapiens (Human) (see 7 papers)
40% identity, 90% coverage
- function: Isobutyryl-CoA dehydrogenase which catalyzes the conversion of 2-methylpropanoyl-CoA to (2E)-2-methylpropenoyl-CoA in the valine catabolic pathway (PubMed:11013134, PubMed:12359132, PubMed:16857760). To a lesser extent, also able to catalyze the oxidation of (2S)-2- methylbutanoyl-CoA (PubMed:11013134, PubMed:12359132).
catalytic activity: 2-methylpropanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylpropenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:44180)
catalytic activity: (2S)-2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48256)
catalytic activity: propanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = acryloyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:31287)
cofactor: FAD
subunit: Homotetramer, formed by a dimer of dimers (PubMed:11013134, PubMed:14752098). May be part of the large multiprotein complex ARC/DRIP (PubMed:10235267). - Network pharmacology, computational biology integrated surface plasmon resonance technology reveals the mechanism of ellagic acid against rotavirus
Zheng, Scientific reports 2024 - “...33 CGAS Q8N884 Cyclic GMP-AMP synthase 34 HSPA1A P0DMV8 Heat shock protein A1A 35 ACAD8 Q9UKU7 Acyl-CoA dehydrogenase 8 PPI network 35 intersection targets were imported into the STRING database to obtain the proteinprotein interaction network diagram (Fig. 2 A). The tsv files of intersection targets...”
- Insight into the Molecular Signature of Skeletal Muscle Characterizing Lifelong Football Players
Orrù, International journal of environmental research and public health 2022 - “...P62899 60S ribosomal protein L31 RPL31 1.48 Q99733 Nucleosome assembly protein 1-like 4 NAP1L4 1.48 Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial ACAD8 1.48 P15088 Mast cell carboxypeptidase A CPA3 1.48 Q96A26 Protein FAM162A FAM162A 1.48 Q15555 Microtubule-associated protein RP/EB family member 2 MAPRE2 1.48 P21817 Ryanodine receptor 1...”
- Biological substrate modification suppresses ventricular arrhythmias in a porcine model of chronic ischaemic cardiomyopathy.
Dawkins, European heart journal 2022 - Quantitative proteomics reveals protein dysregulation during T cell activation in multiple sclerosis patients compared to healthy controls.
Cappelletti, Clinical proteomics 2022 - “...Glucosamine-6-phosphate isomerase 2 GNPDA2 2.21E09 6.31E06 1.851 25.017 0.660 26.798 0.817 64 12 0.156 0.384 Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial ACAD8 6.47E09 1.23E05 1.028 26.741 0.283 25.805 0.501 37 11 0.174 0.331 Q92828 Coronin-2A CORO2A 4.86E08 6.93E05 2.265 23.155 1.130 20.378 0.964 6 3 0.192 0.366 A8MW92...”
- Electron transfer flavoprotein and its role in mitochondrial energy metabolism in health and disease.
Henriques, Gene 2021 - “...and C8-CoA GCDH Glutaryl-CoA dehydrogenase GCDH Q92947 Amino acid catabolism glutaryl-CoA IBDH Isobutyryl-CoA dehydrogenase ACAD8 Q9UKU7 Amino acid catabolism 2-methylbutanoyl-CoA IVD Isovaleryl-CoA dehydrogenase IVD P26440 Amino acid catabolism isovaleryl-CoA and 3-methylbutanoyl-CoA SARDH Sarcosine dehydrogenase SARDH Q9UL12 Choline metabolism sarcosine DMGDH Dimethylglycine dehydrogenase DMGDH Q9UI17 Choline metabolism...”
- Identification of Candidate Protein Markers in Skeletal Muscle of Laminin-211-Deficient CMD Type 1A-Patients
Kölbel, Frontiers in neurology 2019 - “...Mito-chondria 0.43 1.20 Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) Q9UKU7 4/4 0.05 Isobutyryl-CoA dehydrogenase, ( ACAD8 ) Mito-chondria 0.43 1.21 Plays a role in transcriptional coactivation within the ARC complex P13798 8/8 0.00 Acylamino-acid-releasing enzyme ( APEH ) Cytoplasm 0.43...”
- High-throughput proteomic analysis of FFPE tissue samples facilitates tumor stratification.
Zhu, Molecular oncology 2019 - “...Besides, other significantly regulated proteins, including P07288 (KLK3), Q00796 (SORD), P21333 (FLNA), P09936 (UCHL1), and Q9UKU7 (ACAD8), were also identified to show diverse functions by IPA ( Table S4 ). These proteins were enriched in nine networks by IPA, as shown in Fig. S10 . The...”
- Proteomic analysis reveals dysregulated cell signaling in ejaculated spermatozoa from infertile men.
Samanta, Asian journal of andrology 2019 - “...7.3 10.0 13.0 Actin-like protein 7A Q9Y615 49 2.0 8.0 15.3 42.0 Isobutyryl-CoA dehydrogenase, mitochondrial Q9UKU7 45 2.0 7.0 12.7 15.7 Alpha-aminoadipic semialdehyde synthase, mitochondrial Q9UDR5 102 2.3 1.0 3.7 15.7 Izumo sperm-egg fusion protein 1 precursor Q8IYV9 39 2.7 19.7 23.0 50.0 Mitochondrial-processing peptidase subunit...”
- More
acdH / Q9XCG5 acyl-CoA dehydrogenase subunit (EC 1.3.8.4; EC 1.3.8.5) from Streptomyces avermitilis (see 3 papers)
SAVERM_5275 acyl-CoA dehydrogenase family protein from Streptomyces avermitilis MA-4680 = NBRC 14893
42% identity, 96% coverage
- Origin of the 3-methylglutaryl moiety in caprazamycin biosynthesis
Bär, Microbial cell factories 2022 - “...by acdH ( sco2779 ) and for S. avermitilis ATCC 31272 encoded by fadE4 ( SAVERM_5275 ) [ 34 ]. Next, a 3-methylcrotonyl-CoA carboxylase complex consisting of subunits and (LiuD and LiuB) generates 3-methylglutaconyl-CoA by transfer of acetyl-CoA onto 3-methylcrotonyl-CoA. The identification of a similar -subunit...”
G7CDN2 Acyl-CoA dehydrogenase domain-containing protein from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
41% identity, 99% coverage
MAP2312c FadE19 from Mycobacterium avium subsp. paratuberculosis str. k10
42% identity, 96% coverage
- Recent Trends in System-Scale Integrative Approaches for Discovering Protective Antigens Against Mycobacterial Pathogens
Rana, Frontiers in genetics 2018 - “...design novel and more efficient vaccines against TB ( Monterrubio-Lpez, 2015 ). Eight proteins (MAP2698c, MAP2312c, MAP3651c, MAP2872c, MAP3523c, MAP0187c and the hypothetical proteins MAP3567 and MAP1168c) were also identified with highly immunogenic epitopes in the MAP as potential vaccine candidates for studying antibody and cell-mediated...”
- In silico identification of epitopes in Mycobacterium avium subsp. paratuberculosis proteins that were upregulated under stress conditions
Gurung, Clinical and vaccine immunology : CVI 2012 - “...epitopes, eight proteins (MAP2698c [encoded by desA2], MAP2312c [encoded by fadE19], MAP3651c [encoded by fadE3_2], MAP2872c [encoded by fabG5_2], MAP3523c...”
- “...Table 3. Five proteins (MAP2698c, MAP3567, MAP3651c, MAP3523c, and MAP2312c) were found to carry the largest numbers of MHC class I T cell epitopes of...”
SO3561_09667 acyl-CoA dehydrogenase family protein from Streptomyces olivochromogenes
42% identity, 96% coverage
LOC409712 short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Apis mellifera
39% identity, 89% coverage
XP_658428 protein scdA from Aspergillus nidulans FGSC A4
40% identity, 85% coverage
scdA acyl-CoA dehydrogenase, putative (AFU_orthologue; AFUA_1G14850) from Emericella nidulans (see paper)
40% identity, 85% coverage
- CharProtDB Description: Putative mitochondrial acyl-coA dehydrogenase involved in short-chain fatty acid beta-oxidation; required for growth on short-chain fatty acids; Source:AspGD
Rv2500c POSSIBLE ACYL-CoA DEHYDROGENASE FADE19 (MMGC) from Mycobacterium tuberculosis H37Rv
41% identity, 95% coverage
E3JUV4 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial from Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)
41% identity, 86% coverage
SCO2779 acyl-CoA dehydrogenase from Streptomyces coelicolor A3(2)
41% identity, 96% coverage
- Origin of the 3-methylglutaryl moiety in caprazamycin biosynthesis
Bär, Microbial cell factories 2022 - “...facilitating this step have also been reported for S. coelicolor J802 encoded by acdH ( sco2779 ) and for S. avermitilis ATCC 31272 encoded by fadE4 ( SAVERM_5275 ) [ 34 ]. Next, a 3-methylcrotonyl-CoA carboxylase complex consisting of subunits and (LiuD and LiuB) generates 3-methylglutaconyl-CoA...”
- “...( liuR ). BLAST analysis of S. coelicolor M1154 revealed genes homologue to liuA ( sco2779 ), liuB ( sco2776 ), liuD ( sco2777 ) and liuE ( sco2778 ) (Additional file 1 : Fig. S6). No homologue was found for liuC in this cluster though,...”
- A Novel Two-Component System, Encoded by the sco5282/sco5283 Genes, Affects Streptomyces coelicolor Morphology in Liquid Culture
Arroyo-Pérez, Frontiers in microbiology 2019 - “...I 1.85E-15 1.16E-01 0.00E+00 SCO2778 Hydroxymethylglutaryl-CoA lyase 1.96 Amino acid degradation I 2.54E-13 2.75E-01 1.06E-03 SCO2779 Acyl-CoA dehydrogenase 2.08 Amino acid degradation I 6.17E-15 1.50E-01 0.00E+00 SCO4800 Isobutiryl-CoA mutase 1.16 Amino acid degradation I 4.36E-05 2.09E-04 2.03E-03 SCO5398 Methylmalonyl-CoA epimerase 1.38 Amino acid degradation I 5.03E-07...”
- Deciphering the regulon of Streptomyces coelicolor AbrC3, a positive response regulator of antibiotic production
Rico, Applied and environmental microbiology 2014 - “...also significantly downregulated. The acdH gene (SCO2779), encoding an acyl-coenzyme A (acyl-CoA) dehydrogenase involved in branched-amino-acid catabolism in...”
- “...3). These included the downregulated genes acdH (SCO2779), encoding acyl-CoA dehydrogenase; absR1 (SCO6992), encoding an activator of secondary metabolism; afsS...”
- The ROK family regulator Rok7B7 pleiotropically affects xylose utilization, carbon catabolite repression, and antibiotic production in streptomyces coelicolor
Świątek, Journal of bacteriology 2013 - “...amino acids (SCO2008 to SCO2012 and SCO2776 to SCO2779) and an enolase (SCO7638) were 2- to 3-fold enhanced in the mutant. Furthermore, the solute...”
Q3SZB4 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial from Bos taurus
40% identity, 88% coverage
- Effect of 2-Cys Peroxiredoxins Inhibition on Redox Modifications of Bull Sperm Proteins.
Mostek-Majewska, International journal of molecular sciences 2021 - “...mutase 2 PGAM2 Q32KV0 NP_001033200.1 28838/8.99 203/2 3 488 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial ACADM Q3SZB4 NP_001068703.1 46943/8.31 505/4 7 542 Zona pellucida binding protein ZPBP F1N369 40313/9.14 312/2 15 559 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial PDHB P11966 39443/6.21 271/3 6 612 F-actin-capping protein...”
- Immunoproteomic Identification of Noncarbohydrate Antigens Eliciting Graft-Specific Adaptive Immune Responses in Patients with Bovine Pericardial Bioprosthetic Heart Valves.
Gates, Proteomics. Clinical applications 2019 - “...60S ribosomal protein L23a RL23A Q24JY1 [ 26 ] Medium-chain specific acyl-CoA dehydrogenase, mitochondrial ACADM Q3SZB4 Apolipoprotein B-100 APOB E1BNR0 [ 27 , 28 , 35 ] ARSB protein ARSB A6QLZ3 [ 29 ] Proteasome subunit beta type 3 PSMB3 P33672 Epoxide hydrolase 1 EPHX1 Q3ZCJ6...”
- Adaptation of phenylalanine and tyrosine catabolic pathway to hibernation in bats.
Pan, PloS one 2013 - “...- 38 Q64I00 Glutamate dehydrogenase 2, mitochondrial g 61385.85/8.63 124 99.00 1.28* 39 40 Q64I00 Q3SZB4 Glutamate dehydrogenase2, mitochondrial g Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 61385.85/8.63 43586.83/7.02 212 8 99.00 16.14 1.11* 1.19 41 Q5EA20 4-hydroxyphenylpyruvate dioxygenase 44832.04/6.25 26 48.22 1.47** 42 P25708 NADH dehydrogenase [ubiquinone]...”
MBCD_SOLTU / Q9FS88 2-methylacyl-CoA dehydrogenase, mitochondrial; 2-methylbutanoyl-CoA dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; 2MBCD; Isovaleryl-CoA dehydrogenase 1; St-IVD1; EC 1.3.8.5 from Solanum tuberosum (Potato) (see 2 papers)
40% identity, 91% coverage
- function: Short/branched-chain acyl-CoA dehydrogenase (SBCAD). Uses 2- methylbutanoyl-CoA as substrate. Minor activity with the straight-chain substrates, butanoyl-CoA, valeryl-CoA, hexanoyl-CoA, and octanoyl-CoA but no activity with isovaleryl-CoA.
catalytic activity: 2-methylbutanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-2-methylbut-2-enoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43780)
cofactor: FAD
subunit: Homotetramer.
SCLAV_1946 acyl-CoA dehydrogenase family protein from Streptomyces clavuligerus
40% identity, 96% coverage
ivd1 / CAC08233.1 isovaleryl-CoA dehydrogenase from Solanum tuberosum (see paper)
40% identity, 91% coverage
ACADM_MOUSE / P45952 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Mus musculus (Mouse) (see paper)
NP_031408 medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor from Mus musculus
40% identity, 88% coverage
- function: Medium-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (PubMed:16121256). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl- CoA (PubMed:16121256). Electron transfer flavoprotein (ETF) is the electron acceptor that transfers electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase) (By similarity). Among the different mitochondrial acyl-CoA dehydrogenases, medium-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 6 to 12 carbons long primary chains (PubMed:16121256).
catalytic activity: a medium-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a medium-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:14477)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: octanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-octenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48180)
catalytic activity: decanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-decenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48176)
catalytic activity: dodecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-dodecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47296)
catalytic activity: tetradecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-tetradecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47316)
catalytic activity: oxidized [electron-transfer flavoprotein] + hexadecanoyl-CoA + H(+) = (2E)-hexadecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43448)
cofactor: FAD
subunit: Homotetramer. Interacts with the heterodimeric electron transfer flavoprotein ETF.
disruption phenotype: Mice lacking Mcad show increased neonatal mortality (PubMed:16121256). They display hypothermia and cold intolerance upon fasting (PubMed:16121256). Their serum and bile acylcarnitine profile is also different from wild-type mice, with an elevation of serum decenoylcarnitine compared to wild-type mice (PubMed:16121256). They also display hepatic steatosis following fast periods (PubMed:16121256). They develop significantly elevated concentrations of urinary adipic, suberic, and sebacic acids and hexanoylglycine (PubMed:16121256). - Quantitative Proteomics of Th-MYCN Transgenic Mice Reveals Aurora Kinase Inhibitor Altered Metabolic Pathways and Enhanced ACADM To Suppress Neuroblastoma Progression.
Hsieh, Journal of proteome research 2019 (PubMed)- GeneRIF: Quantitative Proteomics of Th-MYCN Transgenic Mice Reveals Aurora Kinase Inhibitor Altered Metabolic Pathways and Enhanced ACADM To Suppress Neuroblastoma Progression.
- Transcriptome analysis suggests a compensatory role of the cofactors coenzyme A and NAD+ in medium-chain acyl-CoA dehydrogenase knockout mice.
Martines, Scientific reports 2019 - GeneRIF: Transcriptome analysis suggests a compensatory role of the cofactors coenzyme A and NAD(+) in medium-chain acyl-CoA dehydrogenase knockout mice.
- A high-fat diet increases adiposity but maintains mitochondrial oxidative enzymes without affecting development of heart failure with pressure overload.
Chess, American journal of physiology. Heart and circulatory physiology 2009 - GeneRIF: A high-fat diet increases adiposity but maintains mitochondrial oxidative enzymes (MCAD/citrate synthase) without affecting development of heart failure with pressure overload.
- Disturbed hepatic carbohydrate management during high metabolic demand in medium-chain acyl-CoA dehydrogenase (MCAD)-deficient mice.
Herrema, Hepatology (Baltimore, Md.) 2008 (PubMed)- GeneRIF: MCAD deficiency in mice leads to specific changes in hepatic carbohydrate management on exposure to metabolic stress.
- Molecular processes during fat cell development revealed by gene expression profiling and functional annotation
Hackl, Genome biology 2005 - “...NP_032535 14 6 -Oxidation Acetyl-CoA dehydrogenase (Acad) NP_780533 61 6 Acetyl-CoA dehydrogenase, medium chain (Acadm) NP_031408 153 6/9 Isovaleryl-CoA dehydrogenase (Acad) Mm.6635 510 6 Acyl-CoA dehydrogenase, short/branched chain (Acadsb) NP_080102 220 9 Triglyceride metabolism Adipose triglyceride lipase (Pnpla2/Atgl) NP_080078 157 6 CoA biosynthesis Pantothenate kinase 3...”
- Suppression of estrogen-related receptor alpha and medium-chain acyl-coenzyme A dehydrogenase in the acute-phase response.
Kim, Journal of lipid research 2005 (PubMed)- GeneRIF: MCAD is reduced in liver, heart & kidney in lipopolysaccharide-induced acute phase response; binding liver nuclear extracts to ERRalpha response element found in promoter region of MCAD was decreased during APR, suggesting less transcription of MCAD
- Medium-chain acyl-CoA dehydrogenase deficiency in gene-targeted mice.
Tolwani, PLoS genetics 2005 - GeneRIF: The MCAD-/- mice developed an organic aciduria and fatty liver, and showed profound cold intolerance at 4 degrees C with prior fasting.
- Adipose-specific overexpression of human AGPAT2 in mice causes increased adiposity and mild hepatic dysfunction.
Agarwal, iScience 2024 - “...[3556] 189 37 1.00 1.33 274 40 1.00 3.27 174 31 1.00 1.90 $ Mcad P45952 QEPGLGFSFELTEQQK [3146] 158 26 1.00 0.80 212 29 1.00 1.21 661 35 1.00 1.12 Vlcad P50544 EATQAVLDKPETLSSDASTR [4463] 155 38 1.00 0.99 116 36 1.00 1.20 927 48 1.00 1.23...”
- Prenylcysteine Oxidase 1 Is a Key Regulator of Adipogenesis
Banfi, Antioxidants (Basel, Switzerland) 2023 - “...= Dbi O88492 3 0.019 1.86 NEG Perilipin-4 OS = Mus musculus GN = Plin4 P45952 3 0.006 1.81 NEG Medium-chain specific acyl-CoA dehydrogenase_ mitochondrial OS = Mus musculus GN = Acadm Q8BMS1 13 0.007 1.80 NEG Trifunctional enzyme subunit alpha_ mitochondrial OS = Mus musculus...”
- Proteomic Analysis of Protective Effects of Dl-3-n-Butylphthalide against mpp + -Induced Toxicity via downregulating P53 pathway in N2A Cells
Zhao, Proteome science 2023 - “...A2 2.33E-05 P46656 Fdx1 \Adrenodoxin, mitochondrial \"" 0.033399 P46414 Cdkn1b Cyclin-dependent kinase inhibitor 1B 0.001209 P45952 Acadm \Medium-chain specific acyl-CoA dehydrogenase, mitochondrial \"" 0.000374 P43276 Hist1h1b Histone H1.5 0.026301 P43275 Hist1h1a Histone H1.1 4.39E-05 P43135 Nr2f2 COUP transcription factor 2 0.005166 P40240 Cd9 CD9 antigen 0.00748...”
- Regulated adipose tissue-specific expression of human AGPAT2 in lipodystrophic Agpat2-null mice results in regeneration of adipose tissue.
Agarwal, iScience 2023 - “...EIENLILNDPDFQHEDYNFLTR [3556] 189 37 1.00 0.43$ 274 40 1.00 1.99 174 31 1.00 0.95 Mcad P45952 QEPGLGFSFELTEQQK [3146] 158 26 1.00 0.20 212 29 1.00 0.84 661 35 1.00 0.28$ Vlcad P50544 EATQAVLDKPETLSSDASTR [4463] 155 38 1.00 0.30* 116 36 1.00 1.00 927 48 1.00 0.41*...”
- ISG15 Is a Novel Regulator of Lipid Metabolism during Vaccinia Virus Infection.
Albert, Microbiology spectrum 2022 - “...Eci1 Enoyl-CoA delta isomerase 1, mitochondrial 6.00 Q9R0H0 Acox1 Peroxisomal acyl-coenzyme A oxidase 1 5.34 P45952 Acadm Medium-chain-specific acyl-CoA dehydrogenase, mitochondrial 5.03 P52825 Cpt2 Carnitine O -palmitoyltransferase 2, mitochondrial 4.69 Q60759 Gcdh Glutaryl-CoA dehydrogenase, mitochondrial 4.47 Q9DBL1 Acadsb Short/branched-chain-specific acyl-CoA dehydrogenase, mitochondrial 4.41 Q9Z2Z6 Slc25a20 Mitochondrial...”
- Proteomic Analysis of Cardiac Adaptation to Exercise by High Resolution Mass Spectrometry
Al-Menhali, Frontiers in molecular biosciences 2021 - “...Slc8a1 32.9 5.2 0.0168 A0A0R4J0P1 Acyl-coenzyme A dehydrogenase family, member 8 Acad8 43.2 2.9 0.0165 P45952 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial Acadm 160.0 5.1 0.0170 Q924X2 Carnitine O-palmitoyltransferase 1, muscle isoform Cpt1b 46.2 3.9 0.0189 P17710 Hexokinase-1 Hk1 33.7 5.5 0.0198 P51881 ADP/ATP translocase 2 Slc25a5...”
- The Proteomic Signature of Intestinal Acute Rejection in the Mouse.
Oltean, Metabolites 2021 - “...0.75 Oxidoreductase Cellular function and maintenance P35700 Prdx1 Peroxiredoxin-1 0.74 Peroxidase Cellular function and maintenance P45952 Acadm Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 0.74 Oxidoreductase Lipid metabolism P24270 Cat Catalase 0.74 Catalase Cellular function and maintenance Q60598 Cttn Src substrate cortactin 0.72 Unknown Cell structure Q80XN0 Bdh1...”
- Celastrol inhibits intestinal lipid absorption by reprofiling the gut microbiota to attenuate high-fat diet-induced obesity.
Hua, iScience 2021 - “...) 0.334806 0.0063 P41216 Long-chain fatty acid CoA ligase 1 ( Acsl1 ) 0.82888 0.0351 P45952 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial ( Acadm ) 0.814053 0.0038 P52825 Carnitine O-palmitoyltransferase 2, mitochondrial ( Cpt2 ) 0.788776 0.0138 O35488 Very-long-chain acyl-CoA synthetase ( Slc27a2 ) 0.715861 0.0489 Q921H8...”
- More
W5PHF2 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Ovis aries
38% identity, 85% coverage
G3V796 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial from Rattus norvegicus
NP_058682 medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor from Rattus norvegicus
39% identity, 88% coverage
- The mitochondrial proteomic changes of rat hippocampus induced by 28-day simulated microgravity.
Ji, PloS one 2022 - “...isoform CRA_b 1.61 0.001023 A0A0A0MXW1_RAT A0A0A0MXW1 Bckdhb 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 1.61 0.006284 G3V796_RAT G3V796 Acadm Acetyl-Coenzyme A dehydrogenase, medium chain 1.61 0.0034 A0A0G2K5F1_RAT A0A0G2K5F1 Macrod1 ADP-ribose glycohydrolase MACROD1 1.61 0.018189 IDH3B_RAT Q68FX0 Idh3B Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial 1.60 0.002549 G3V7I5_RAT G3V7I5 Aldh1b1...”
- Quantitative Proteomics Analysis for the Identification of Differential Protein Expression in Calf Muscles between Young and Old SD Rats Using Mass Spectrometry
Kim, ACS omega 2021 - “...apolipoproteinE A0A0G2K151 8.9 plectin A0A0G2K1J5 8.9 hydroxyacyl-coenzymeA dehydrogenase, mitochondrial Q9WVK7 9.3 acetyl-coenzymeA dehydrogenase, medium chain G3V796 9.4 NADH dehydrogenase [ubiquinone]1 subcomplex subunit10, mitochondrial A0A1W2Q6F8 9.6 prolargin Q9EQP5 11 cathepsinD P24268 11 carnitine O -palmitoyltransferase2, mitochondrial P18886 11 nicotinamide nucleotide transhydrogenase Q5BJZ3 13 a The DE genes...”
- “...networks were found, with 31 proteins (UniProt: F1LN88, Q5BJZ3, P56574, Q5XI78, G3V6H5, P97532, P18886, Q9WVK7, G3V796, Q920L2, B2RZ24, Q641Y2, Q68FT, P18163, P42123, Q64428, Q60587, Q5M9H2, P08461, Q66HF1, P85834, A2RRU1, P15650, G3V936, P13803, Q68FU3, Q5BK63, Q5RJN0, D4A0T0, Q68FR9, and P17764) presented the highest degree of connectivity, as...”
- Comparative proteomic analysis of the aging soleus and extensor digitorum longus rat muscles using TMT labeling and mass spectrometry
Chaves, Journal of proteome research 2013 - “...no. P value Log 2 fold change a DESCRIPTION Energy metabolism Q52KS1 <0.001 0.6 6-phosphofructokinase G3V796 0.005 0.4 Acetyl-Coenzyme A dehydrogenase, medium chain Q9ER34 0.014 0.9 Aconitate hydratase, mitochondrial P10760 0.009 1.4 Adenosylhomocysteinase F1LN88 < 0.001 1.6 Aldehyde dehydrogenase, mitochondrial Q63041 < 0.001 0.8 Alpha-1-macroglobulin P04764...”
- piRNA-63076 contributes to pulmonary arterial smooth muscle cell proliferation through acyl-CoA dehydrogenase.
Ma, Journal of cellular and molecular medicine 2020 - GeneRIF: piRNA-63076 contributes to pulmonary arterial smooth muscle cell proliferation through acyl-CoA dehydrogenase.
- Interactions between the consumption of a high-fat diet and fasting in the regulation of fatty acid oxidation enzyme gene expression: an evaluation of potential mechanisms.
Frier, American journal of physiology. Regulatory, integrative and comparative physiology 2011 (PubMed)- GeneRIF: High fat diets increase the expression of fatty acid oxidation enzymes such as UCP3,PDK4, and MCAD concomitant with elevated plasma fatty acid levels and the induction of PGC-1 beta, but independent of changes in AMPK, p38, and PKA signaling.
- Medium-chain fatty acids accumulating in MCAD deficiency elicit lipid and protein oxidative damage and decrease non-enzymatic antioxidant defenses in rat brain.
Schuck, Neurochemistry international 2009 (PubMed)- GeneRIF: Our present data show that the medium-chain fatty acids that most accumulate in MCAD deficiency cause oxidative stress in rat brain
- Evidence that the major metabolites accumulating in medium-chain acyl-CoA dehydrogenase deficiency disturb mitochondrial energy homeostasis in rat brain.
Schuck, Brain research 2009 (PubMed)- GeneRIF: these data suggest that octanoic and decanoic acids impair brain mitochondrial energy homeostasis that could underlie at least in part the neuropathology of MCAD deficiency
- Mutation of Tyr375 to Lys375 allows medium-chain acyl-CoA dehydrogenase to acquire acyl-CoA oxidase activity.
Zeng, Biochimica et biophysica acta 2007 (PubMed)- GeneRIF: The mutation of this residue to Lys375 allows molecular oxygen to enter into the catalytic site serving as the electron acceptor for the reduced FAD cofactor.
- Intrinsic isomerase activity of medium-chain acyl-CoA dehydrogenase.
Zeng, Biochemistry 2005 (PubMed)- GeneRIF: The isomerase activity of medium-chain acyl-CoA dehydrogenase is probably a spontaneous process driven by thermodynamic equilibrium with the formation of a conjugated structure after deprotonation of substrate alpha proton.
- Expression and purification of His-tagged rat mitochondrial medium-chain acyl-CoA dehydrogenase wild-type and Arg256 mutant proteins.
Zeng, Protein expression and purification 2004 (PubMed)- GeneRIF: expression of rat mitochondrial medium-chain acyl-CoA dehydrogenase wild-type and Arg256 mutant proteins
ACADM_RAT / P08503 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 88% coverage
- function: Medium-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (PubMed:3968063). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl- CoA (PubMed:3968063). Electron transfer flavoprotein (ETF) is the electron acceptor that transfers electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase) (By similarity). Among the different mitochondrial acyl-CoA dehydrogenases, medium-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 6 to 12 carbons long primary chains (PubMed:3968063).
catalytic activity: a medium-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a medium-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:14477)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: octanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-octenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48180)
catalytic activity: decanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-decenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48176)
catalytic activity: dodecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-dodecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47296)
catalytic activity: tetradecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-tetradecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47316)
catalytic activity: oxidized [electron-transfer flavoprotein] + hexadecanoyl-CoA + H(+) = (2E)-hexadecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43448)
cofactor: FAD
subunit: Homotetramer (PubMed:3813556, PubMed:3968063). Interacts with the heterodimeric electron transfer flavoprotein ETF (By similarity). - Comparative Proteomics Analysis of Growth-Primed Adult Dorsal Root Ganglia Reveals Key Molecular Mediators for Peripheral Nerve Regeneration
Bautista, eNeuro 2023 - “...adhesion 15 Ras-related protein Rab-2A P05712 Rab2a Protein transport 16 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial P08503 Acadm Lipid metabolism 17 Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 P11507 Atp2a2 Calcium homeostasis 18 cAMP-dependent protein kinase Type II- regulatory subunit P12369 Prkar2b Regulation of protein kinase activity 19 Neural...”
- Extracellular vesicles released by steatotic hepatocytes alter adipocyte metabolism
Mleczko, Journal of extracellular biology 2022 - “...Q62667 1.54 2.02E03 Major vault protein PBLD_RAT Q68G31 1.55 3.84E02 Phenazine biosynthesislike domaincontaining protein ACADM_RAT P08503 1.58 1.39E02 Mediumchain specific acylCoA dehydrogenase, mitochondrial H17B6_RAT O54753 1.61 1.53E03 17betahydroxysteroid dehydrogenase type 6 EIF3E_RAT Q6418 1.62 9.03E03 Eukaryotic translation initiation factor 3 subunit E SBP1_RAT Q8VIF7 1.64 4.77E02...”
- Brown Adipose Tissue Sheds Extracellular Vesicles That Carry Potential Biomarkers of Metabolic and Thermogenesis Activity Which Are Affected by High Fat Diet Intervention.
Camino, International journal of molecular sciences 2022 - “...ACLY_RAT P16638 ATP-citrate synthase 0.010 2.34 CPT2_RAT P18886 Carnitine O-palmitoyltransferase 2, mitochondrial 0.008 2.31 ACADM_RAT P08503 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 0.047 2.13 THIL_RAT P17764 Acetyl-CoA acetyltransferase, mitochondrial 0.006 2.12 PYC_RAT P52873 Pyruvate carboxylase, mitochondrial 0.003 2.10 IDH3A_RAT Q99NA5 Isocitrate dehydrogenase [NAD] subunit Alpha, mitochondrial 0.027...”
- Diverse Roles of Mitochondria in Renal Injury from Environmental Toxicants and Therapeutic Drugs.
Lash, International journal of molecular sciences 2021 - “...Q64565 Alanine-glyoxylate aminotransferase 2 (beta-alanine-pyruvate aminotransferase) 2.13 0.15 Q02253 Methylmalonate-semialdehyde dehydrogenase (malonate-semialdehyde dehydrogenase) 1.32 0.31 P08503 Medium-chain specific acyl-CoA dehydrogenase 2.62 0.35 Q64428 Trifunctional enzyme subunit alpha (3-hydroxyacyl-CoA dehydrogenase) 0.70 0.22 P10860 Glutamate dehydrogenase 1 1.94 0.41 Anion Transport (Transmembrane Transport) Q9Z2L0 Voltage-dependent anion-selective channel protein...”
- Striated muscle-specific serine/threonine-protein kinase beta segregates with high versus low responsiveness to endurance exercise training
Kusić, Physiological genomics 2020 (secret) - Myocardial proteomic profile in pulmonary arterial hypertension.
Hołda, Scientific reports 2020 - “...of pyruvate dehydrog. complex, mit 1.12 P48500 Tpi1 Triosephosphate isomerase 1.07 P11530 Dmd Dystrophin 1.12 P08503 Acadm Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 1.07 O88989 Mdh1 Malate dehydrogenase, cytoplasmic 1.13 P06685 Atp1a1 Sodium/potassium-transporting ATPase subunit alpha-1 1.08 P20788 Uqcrfs1 Cytochrome b-c1 complex subunit Rieske, mitochondrial 1.13 P16036...”
- Inflammation and apoptosis accelerate progression to irreversible atrophy in denervated intrinsic muscles of the hand compared with biceps: proteomic analysis of a rat model of obstetric brachial plexus palsy.
Yu, Neural regeneration research 2020 - “...metabolism 12 P12785 * , A0A0G2K5G8 * , Q63151 * , P33124, P17764, Q9WVK7, Q9WVK3, P08503, P70584, P14604, Q5M9H2, Q63704 0.002 Pathways at 5 weeks Glycolysis/gluconeogenesis 29 G3V9W6 * , P25113 * , D3ZZN3, P07323, P30835, A0A0G2JZH8, Q6P9U7, E9PTN6, D4A5G8, Q9Z1N1, B1WBN9, P49432, E9PTV9, Q6P6R2, P08461,...”
- “...* , P70584, Q9WVK3, P33124, G3V9U2, P14604, P17764, P15651, Q64428, Q5M9H2, Q9WVK7, Q60587, P18163, P18886, P08503, P07896, G3V7N5 < 0.001 Calcium signaling 16 P11275, P20651, A0A0G2K9C8, P13286, Q64578, A0A0G2JSR0, F1LLZ7, Q304F3, G3V731, A0A0G2K5J1, F1LQL1, P29117, Q9Z2L0, Q05962, Q62711, D3ZB81 < 0.001 PPAR signaling 9 O35547 *...”
- Leucine-Rich Diet Modulates the Metabolomic and Proteomic Profile of Skeletal Muscle during Cancer Cachexia.
Cruz, Cancers 2020 - “...= Acadl 1.182 WL W P04636 Malate dehydrogenase, mitochondrial GN = Mdh2 1.922 WL W P08503 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial GN = Acadm >5 WL W Q66HF1 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial GN = Ndufs1 >5 WL W Q9R063 Peroxiredoxin-5, mitochondrial GN = Prdx5...”
- More
3mddA / P41367 Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
39% identity, 96% coverage
- Ligand: flavin-adenine dinucleotide (3mddA)
LIC_10970 acyl-CoA dehydrogenase family protein from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
42% identity, 88% coverage
Shewana3_1672 Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) from Shewanella sp. ANA-3
40% identity, 95% coverage
- mutant phenotype: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (RXN0-2301) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
ACADM_PIG / P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Sus scrofa (Pig) (see 3 papers)
P41367 medium-chain acyl-CoA dehydrogenase (EC 1.3.8.7) from Sus scrofa (see paper)
39% identity, 88% coverage
- function: Medium-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats (PubMed:3233192). The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl- CoA (PubMed:3233192). Electron transfer flavoprotein (ETF) is the electron acceptor that transfers electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase) (By similarity). Among the different mitochondrial acyl-CoA dehydrogenases, medium-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 6 to 12 carbons long primary chains (By similarity).
catalytic activity: a medium-chain 2,3-saturated fatty acyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = a medium-chain (2E)-enoyl- CoA + reduced [electron-transfer flavoprotein] (RHEA:14477)
catalytic activity: pentanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-pentenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43456)
catalytic activity: hexanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-hexenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43464)
catalytic activity: octanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-octenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48180)
catalytic activity: decanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-decenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:48176)
catalytic activity: dodecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-dodecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47296)
catalytic activity: tetradecanoyl-CoA + oxidized [electron-transfer flavoprotein] + H(+) = (2E)-tetradecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:47316)
catalytic activity: oxidized [electron-transfer flavoprotein] + hexadecanoyl-CoA + H(+) = (2E)-hexadecenoyl-CoA + reduced [electron-transfer flavoprotein] (RHEA:43448)
cofactor: FAD
subunit: Homotetramer (PubMed:12966080). Interacts with the heterodimeric electron transfer flavoprotein ETF (By similarity). - Label-Free Quantitative Analysis of Pig Liver Proteome after Hepatitis E Virus Infection
Martino, Viruses 2024 - “...dehydrogenase, mitochondrial 10 63.15 0.0006 1.89 A0A4X1UTH9 IVD isovaleryl-CoA dehydrogenase, mitochondrial 10 62.96 0.0032 2.02 P41367 ACADM medium-chain specific acyl-CoA dehydrogenase, mitochondrial 10 47.06 0.0003 2.85 A0A8W4F721 ALDH4A1 delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial 10 42.48 0.0035 1.93 1 accession number in the UniProt database; 2 matching peptides for...”
- Proteomic and metabolomic profiling of aged pork loin chops reveals molecular phenotypes linked to pork tenderness
Johnson, Journal of animal science 2024 - “...0.013 Glycerol-3-phosphate dehydrogenase [NAD(+)] A0A287BDV9 GPD1 84 20 0.218 <0.001 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial P41367 ACADM 35 10 0.297 0.032 Mitochondrial aldehyde dehydrogenase 2 B2ZF47 ALDH2 53 19 0.185 0.043 Myosin light chain kinase 2, skeletal/cardiac muscle A0A4X1STF9 MYLK2 22 10 0.297 0.004 Perilipin 4...”
- iTRAQ-based proteomic analysis reveals key proteins affecting muscle growth and lipid deposition in pigs.
Wang, Scientific reports 2017 - “...LMNB1 F1RKM0 Uncharacterized protein 1.69 0.07 ACAA2 D0G0B3 Acetyl-coenzyme A acyltransferase 2 1.68 0.13 ACADM P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial 1.41 0.01 ACOT13 F1RUE0 Uncharacterized protein 1.41 0.00 UQCRC1 F1SKM0 Uncharacterized protein 1.40 0.00 GPD2 M3TYQ8 Glycerol-3-phosphate dehydrogenase 1.39 0.03 GLRX P12309 Glutaredoxin-1 1.38 0.01...”
- “...P-value in PRM F1SKM0 UQCRC1 1.40 0.0006 3.26 0.0008 I3LP02 ACAT1 1.34 0.0025 3.60 0.0005 P41367 ACADM 1.41 0.0127 3.80 0.0091 A9X3T3 PECI 1.32 0.0194 4.23 0.0069 F1SNW4 MYL3 1.58 0.2596 3.41 0.0042 K9IW80 NNT 1.37 0.0036 3.95 0.0004 D0G0B3 ACAA2 1.68 0.1300 5.00 0.0053 Q9N251...”
- Prediction of FAD binding sites in electron transport proteins according to efficient radial basis function networks and significant amino acid pairs.
Le, BMC bioinformatics 2016 - “...Q96329 Q9YHT1 P07342 P38038 Q0QLF4 Q709F0 Q9AL95 P55931 O53355 P39662 Q28943 Q7SID9 C6ELC9 A3KEZ1 O54050 P41367 P97275 Q7WZ62 D0VWY5 O60341 P45954 Q2GBV9 Q7X2H8 O52582 P0A6U3 P47989 Q389T8 Q7ZA32 Q9RSY7 P15651 P49748 Q47PU3 Q8DMN3 Q9UBK8 P19920 P55789 Q52437 Q8X1D8 Q9UKU7 P07872 P09622 Q9HJI4 Q9HKS9 Q9HTK9 Sequence information...”
- Genetic basis for correction of very-long-chain acyl-coenzyme A dehydrogenase deficiency by bezafibrate in patient fibroblasts: toward a genotype-based therapy.
Gobin-Limballe, American journal of human genetics 2007
H2KZG6 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Caenorhabditis elegans
38% identity, 87% coverage
G8E09_11790 acyl-CoA dehydrogenase family protein from Acinetobacter pittii
41% identity, 97% coverage
- Phenotypic Variation and Carbapenem Resistance Potential in OXA-499-Producing Acinetobacter pittii
Zhang, Frontiers in microbiology 2020 - “...0.0001 0.0061 G8E09_08620 Acyl-CoA dehydrogenase 2.39 0.0004 0.0138 G8E09_08600 OprD family porin 2.37 0.0000 0.0000 G8E09_11790 Acyl-CoA dehydrogenase 2.35 0.0000 0.0013 G8E09_14960 Trehalose-6-phosphate synthase 2.33 0.0012 0.0314 G8E09_12910 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylatedehydrogenase 2.25 0.0000 0.0009 G8E09_10090 2-oxo acid dehydrogenase subunit E2 2.24 0.0000 0.0012 G8E09_07160 Type 1 glutamine amidotransferase...”
dcaA / AAL09094.1 DcaA from Acinetobacter baylyi (see 11 papers)
ACIAD1693 acyl-CoA dehydrogenase from Acinetobacter sp. ADP1
40% identity, 96% coverage
Afu1g14850 acyl-CoA dehydrogenase, putative from Aspergillus fumigatus Af293
40% identity, 85% coverage
Q65Y10 short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) from Butyrivibrio fibrisolvens (see paper)
40% identity, 94% coverage
RSP_2506 Isovaleryl-CoA dehydrogenase from Rhodobacter sphaeroides 2.4.1
40% identity, 96% coverage
- An integrated approach to reconstructing genome-scale transcriptional regulatory networks
Imam, PLoS computational biology 2015 - “...family transporter), RSP_2401 (putative 6-aminohexanoate-cyclic-dimer hydrolase), RSP_2508 (Methylcrotonyl-CoA carboxylase beta chain), RSP_1883 (ABC polyamine/opine transporter), RSP_2506 (Isovaleryl-CoA dehydrogenase), RSP_3168 (ABC transporter), RSP_3169 (FAA-hydrolase-family protein). (B) Direct binding of RSP_0489 to the uxaC , RSP_0490, uxuA , RSP_3372 and RSP_2667 promoters identified by ChIP-seq. (C) RSP_0489 binding...”
SO1897 isovaleryl-CoA dehydrogenase from Shewanella oneidensis MR-1
39% identity, 95% coverage
NP_999204 medium-chain specific acyl-CoA dehydrogenase, mitochondrial precursor from Sus scrofa
39% identity, 88% coverage
AbA118F_0711 acyl-CoA dehydrogenase family protein from Acinetobacter baumannii
40% identity, 97% coverage
- Cerebrospinal fluid (CSF) augments metabolism and virulence expression factors in Acinetobacter baumannii
Martinez, Scientific reports 2021 - “...protein TatC AbA118F_2820 -1.86 3.9 E-02 Allantoin racemase AbA118F_2477 -1.87 4.6 E-10 Mg(2+)-transport-ATPase-associated protein MgtC AbA118F_0711 -1.89 5.4 E-16 Acyl-CoA dehydrogenase AbA118F_0704 -1.99 1.4 E-02 2-aminoethylphosphonate ABC transporter substrate-binding protein AbA118F_2199 -2.06 2.4 E-04 Protein co-occuring with molybdenum cofactor biosynthesis protein B AbA118F_0907 -2.14 5.2 E-20...”
- “...transporters (e.g. Mg2+transporters, AbA118F_2476 and AbA118F_2477) and catabolic proteins (such as AbA118F_1645 Alkaline Phosphatase and AbA118F_0711 Acyl-CoA dehydrogenase) (Table 1 and Supplementary Table S1 ). Gene ontology (GO) analysis was next undertaken to identify molecular functions and biological pathways associated to A . baumannii s adaptive...”
H16_B0356 Acyl-CoA dehydrogenase from Ralstonia eutropha H16
41% identity, 96% coverage
GAH_01601 acyl-CoA dehydrogenase family protein from Geoglobus ahangari
40% identity, 98% coverage
- The complete genome sequence and emendation of the hyperthermophilic, obligate iron-reducing archaeon "Geoglobus ahangari" strain 234(T)
Manzella, Standards in genomic sciences 2015 - “...in G. ahangari are putatively encoded by 11 genes (GAH_00179, GAH_00421, GAH_00484, GAH_00591, GAH_01331, GAH_01442, GAH_01601, GAH_01810, and GAH_02050). A water molecule is then added to trans-2-enoyl-CoA to form (3S)-3-hydroxyacyl-CoA in a reaction catalyzed by an enoyl-CoA hydratase, which in G. ahangari could be encoded by...”
FNP_2146 acyl-CoA dehydrogenase family protein from Fusobacterium polymorphum ATCC 10953
39% identity, 99% coverage
- Genome sequence of Fusobacterium nucleatum subspecies polymorphum - a genetically tractable fusobacterium
Karpathy, PloS one 2007 - “...2226995 2228584 von Willebrand factor domain protein FNP_1921 2263322 2265424 vacB ribonuclease R Butyrate fermentation FNP_2146 62092 60956 butyryl-CoA dehydrogenase FNP_0790 1158356 1159132 3-hydroxybutyryl-CoA dehydratase FNP_0791 1159148 1159987 fadB 3-hydroxybutyryl-CoA dehydrogenase FNP_0969 1326816 1326151 atoA butyrate-acetoacetate CoA-transferase, beta subunit FNP_0970 1327487 1326834 atoD butyrateacetoacetate CoA-transferase, alpha...”
G1SW97 Isovaleryl-CoA dehydrogenase, mitochondrial from Oryctolagus cuniculus
39% identity, 87% coverage
NP_062800 isovaleryl-CoA dehydrogenase, mitochondrial isoform 1 precursor from Mus musculus
Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial from Mus musculus
39% identity, 87% coverage
- Comparative proteomics of skeletal muscle mitochondria from myostatin-null mice
Puddick, Cell biology international reports 2011 - “...2 M. musculus 27.4 9.6 NP_058043 N/C 26 Isovaleryl CoA dehydrogenase M. musculus 46.7 9.3 NP_062800 N/C 32, 33 Pyruvate dehydrogenase, subunit M. musculus 35.2 5.6 AAH02188 N/C 46 Unnamed protein M. musculus 29.1 6.6 BAB23853 2.4 P <0.005 Miscellaneous 57 Adenylate kinase 1 M. musculus...”
- Prenylcysteine Oxidase 1 Is a Key Regulator of Adipogenesis
Banfi, Antioxidants (Basel, Switzerland) 2023 - “...3 0.001 1.48 NEG Methylmalonate-semialdehyde dehydrogenase [acylating]_ mitochondrial OS = Mus musculus GN = Aldh6a1 Q9JHI5 2 0.007 1.48 NEG Isovaleryl-CoA dehydrogenase_ mitochondrial OS = Mus musculus GN = Ivd Q9CZ13 3 0.009 1.47 NEG Cytochrome b-c1 complex subunit 1_ mitochondrial OS = Mus musculus GN...”
- ISG15 Is a Novel Regulator of Lipid Metabolism during Vaccinia Virus Infection.
Albert, Microbiology spectrum 2022 - “...3 8.62 Q8QZT1 Acat1 Acetyl-CoA acetyltransferase, mitochondrial 7.71 Q9Z2Z6 Slc25a20 Mitochondrial carnitine/acylcarnitine carrier protein 6.67 Q9JHI5 Ivd Isovaleryl-CoA dehydrogenase, mitochondrial 6.39 Q8BH95 Echs1 Enoyl-CoA hydratase, mitochondrial 5.58 Q8JZN5 Acad9 Complex I assembly factor ACAD9, mitochondrial 5.39 Q99JY0 Hadhb Trifunctional enzyme subunit beta, mitochondrial 5.11 Q9CQ62 Decr1...”
- The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...0.001059691 Q99KB8 Hydroxyacylglutathione hydrolase, mitochondrial Hagh 0.001154019 Q60930 Voltage-dependent anion-selective channel protein 2 Vdac2 0.003519833 Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial Ivd 0.003828896 Q61941 NAD(P) transhydrogenase, mitochondrial Nnt 0.004299233 P70404 Isocitrate dehydrogenase [NAD] subunit gamma 1 Idh3g 0.005805916 O35143 ATPase inhibitor, mitochondrial Atp5if1 0.006163506 Q5NCE8 Magnesium transporter MRS2...”
- “...Mitochondrial function P26443 Glutamate dehydrogenase 1, mitochondrial Glud1 0.0011715 Q8BWT1 3-ketoacyl-CoA thiolase, mitochondrial Acaa2 0.0012530 Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial Ivd 0.0013191 Q9Z2I9 Succinate--CoA ligase [ADP-forming] subunit beta Sucla2 0.0016019 Q9D0K2 Succinyl-CoA:3-ketoacid coenzyme A transferase 1 Oxct1 0.0056800 Q9CQJ8 NADH dehydrogenase [ubiquinone] 1 beta subunit 9 Ndufb9...”
- Functional, proteomic and bioinformatic analyses of Nrf2- and Keap1- null skeletal muscle
Gao, The Journal of physiology 2020 - “...2.75 Ndufa Q99LC3 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial 0.05 3.13 Ivd Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial 0.05 2.71 Smyd1 P97443 Histone-lysine N-methyltransferase Smyd1 0.05 1.64 Ywhae P62259 14-3-3 protein epsilon 0.05 2.31 Phb P67778 Prohibitin 0.05 1.75 Selenbp1 P17563 Methanethiol oxidase 0.05 1.81...”
- Suppression of the Peripheral Immune System Limits the Central Immune Response Following Cuprizone-Feeding: Relevance to Modelling Multiple Sclerosis
Sen, Cells 2019 - “...529/36 13 39.4/6.35 27.8/7 0.69(0.1PT) 0.33(0.1PT) M - [ 93 ] [ 93 ] 5C1/SP Q9JHI5 Isovaleryl-CoA dehydrogenase Ivd 650/39 17 46.3/8.5 79.4/6.2 0.42(0.2PT) 1.80(PT) S [ 49 ] - - 5G5/SP Q91WQ3 Tyrosine-tRNA ligase Yars 333/28 17 59/6.57 124.9/6.4 0.32(0.2PT) 1.97(PT) S - - -...”
- Label-free quantitative mass spectrometry analysis of differential protein expression in the developing cochlear sensory epithelium
Darville, Proteome science 2018 - “...component subunit beta 3.852.63 15.69.89 4.1 2.91E-02 Q61245 Collagen alpha-1(XI) chain 14.65.7 58.633.6 4.0 1.29E-02 Q9JHI5 Isovaleryl-CoA dehydrogenase 4.083.84 16.511.3 4.0 4.24E-02 Table 2 The 25 selected proteins with upregulated expression on P30 relative to P3. These differentially expressed proteins exhibited the largest fold change Access....”
- 2D DIGE proteomic analysis reveals fasting-induced protein remodeling through organ-specific transcription factor(s) in mice
Kamata, FEBS open bio 2018 - “...1 Q9WVK4 Ehd1 Mm.30169 60 21% 10/26 60622 6.35 32 1.12 0.034 IsovalerylCoA dehydrogenase, mitochondrial Q9JHI5 Ivd Mm.6635 106 38% 13/27 46695 8.53 John Wiley & Sons, Ltd Protein expression changes in the thymus and spleen Twoday fasting induced marked weight loss in both the thymus...”
- Advanced aging causes diaphragm functional abnormalities, global proteome remodeling, and loss of mitochondrial cysteine redox flexibility in mice.
Kelley, Experimental gerontology 2018 - “...only in young diaphragm. Accession Protein P70404 Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial (Idh3g) Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial (Ivd) P99029 Peroxiredoxin-5, mitochondrial (Prdx5) P99028 Cytochrome b-c1 complex subunit 6, mitochondrial (Uqcrh) Q9D051 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial (Pdhb) Q01768 Nucleoside diphosphate kinase B...”
- “...9.15 P70404 Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial (Idh3g) 235/36 25.03 18.14 1.00:0.79 11.21 Q9JHI5 Isovaleryl-CoA dehydrogenase, mitochondrial (Ivd) 252 8.62 6.53 1.00:1.20 5.66 P06151 L-lactate dehydrogenase A chain (Ldha) 84 16.84 15.84 1.00:0.73 20.17 P16125 & LDHB 163 11.73 11.83 1.00:0.92 3.58 P51174 Long-chain...”
- More
8sgrA / P26440 Human liver mitochondrial isovaleryl-coa dehydrogenase (see paper)
38% identity, 94% coverage
- Ligand: flavin-adenine dinucleotide (8sgrA)
CNAG_02562 acyl-CoA dehydrogenase from Cryptococcus neoformans var. grubii H99
39% identity, 83% coverage
Elgi_47060 acyl-CoA dehydrogenase family protein from Paenibacillus elgii
41% identity, 96% coverage
- Data on annotation and analysis of genome sequence of Paenibacillus elgii YSY-1.2, a promising chitinase-producing, plant-growth-promoting, and biocontrol agent
Tran, Data in brief 2024 - “...Nitrate/nitrite transporter Elgi_17100 Nitrate transporter NarK Elgi_46520 ACC biosynthesis Acyl-CoA dehydrogenase FadE Elgi_23140 Acyl-CoA dehydrogenase Elgi_47060, Elgi_54500, Elgi_67150 Acyl-CoA dehydrogenase family protein Elgi_51250 Acyl-CoA dehydrogenase AcdA Elgi_54520 Iron uptake Iron ABC transporter permease Elgi_01060, Elgi_13560, Elgi_13570, Elgi_14480, Elgi_14540, Elgi_15350, Elgi_16730, Elgi_25990, Elgi_26000, Elgi_27700, Elgi_29320, Elgi_29330, Elgi_33950,...”
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory