BLAST against PDB

Comparing PDB to 64 a.a. (MASRNKLVVP...) (64 a.a., MASRNKLVVP...)

Show query sequence

>64 a.a. (MASRNKLVVP...)
MASRNKLVVPGVEQALDQFKLEVAQEFGVNLGSDTVARANGSVGGEMTKRLVQQAQSQLN
GTTK

1 hits were found against non-redundant PDB (which was clustered at 80% identity)

2z3x A Structure of a protein-DNA complex essential for DNA protection in spore of bacillus species
59% identity, 88% coverage of query, 71.6 bits, E = 1e-13

To find additional similar structures, try the "Find Similar Assemblies" links at RCSB.

Or try another search