BLAST against PDB

Comparing PDB to 74 a.a. (KRNRIPLGCT...) (74 a.a., KRNRIPLGCT...)

Show query sequence

>74 a.a. (KRNRIPLGCT...)
KRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELK
KLRERVKSLEKTLS

3 hits were found against non-redundant PDB (which was clustered at 80% identity)

1hwt C Structure of a hap1/DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein
99% identity, 100% coverage of query, 147.0 bits, E = 2e-36

6p7v B Structure of the k. Lactis cbf3 core
53% identity, 43% coverage of query, 45.1 bits, E = 1e-05

6k15 C Rsc substrate-recruitment module
48% identity, 42% coverage of query, 42.4 bits, E = 8e-05

To find additional similar structures, try the "Find Similar Assemblies" links at RCSB.

Or try another search