Running PSORTb v3.0 on 17275 (163 amino acids)
SeqID: 17275 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 68630814: Nitrogen regulatory protein] SCL-BLASTe- Cytoplasmic [matched 100% 68630814: Nitrogen regulatory protein] Signal- Unknown [No signal peptide detected] Localization Scores: Cytoplasmic 10.00 CytoplasmicMembrane 0.00 OuterMembrane 0.00 Periplasmic 0.00 Extracellular 0.00 Final Prediction: Cytoplasmic 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>17275 MTNNDTTLQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKM GSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTH LHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTEGTPDEA
Lawrence Berkeley National Laboratory