Running PSORTb v3.0 on 17601 (334 amino acids)
SeqID: 17601 Analysis Report: CMSVM- CytoplasmicMembrane [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 1168476: Oligopeptide transport ATP-binding protein appF] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 9.99 Cytoplasmic 0.01 Periplasmic 0.00 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: CytoplasmicMembrane 9.99 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>17601 MSTQEATLQQPLLQAIDLKKHYPVKKGMFAPERLVKALDGVSFNLERGKTLAVVGESGCG KSTLGRLLTMIEMPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQ ILEEPLLINTSLSKEQRREKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDP DVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADEVMVMYLGRC VEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRERIKLSGELPSPLNPPPGCAFNARCR RRFGPCTQLQPQLKDYGGQLVACFAVDQDENPQR
Lawrence Berkeley National Laboratory