PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 7026812 (470 amino acids)

SeqID: 7026812 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [2 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.50
    OuterMembrane          2.50
    Periplasmic            2.50
    Extracellular          2.50
    Cytoplasmic            0.00
  Final Prediction:
    Unknown

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>7026812
MTVSSVSRALSTSSVATSFVPYVSSLGVSPSRFTKSLIASALTLSLLGAGLSSANAAQPD
AAKLAAGVEQKVIDWRRDLHQHPELSNREFRTSKIIEKHLKSLGLEVQTGIAHTGVVAIL
KGGKLKGGKPGPLIAIRADMDALPVTEVVDVPFASKATDTYRGKTVGVMHACGHDTHVAM
LMGVAENLVKVKDSLAGDVMFIFQPAEEGAPDGEEGGAELMLKQGLFAKRKPDQVFGMHV
TSSMPSGMIGVRSGPAMASGDSFTIKVKGRQTHGSRPWNGVDPIVAAAQIITNVQTIVSR
QVDITKAPAVVSFGAVNGGIRSNIIPDEVELIGTIRTFDQPMRADIKVRLAEIAELSAKT
LGATATTEIHQGYPVVVNNPELVASMRPVLASVVGDKMLIEPGLITGAEDFSFYALESPG
MFFFLGVTPKGTDPETAASNHSPAFYVDESALKVGVEAMTKVALTALKAQ

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory