Running PSORTb v3.0 on AO353_04615 (343 amino acids)
SeqID: AO353_04615 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [1 internal helix found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Periplasmic [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Periplasmic [matched 3182887: Periplasmic protein] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: Periplasmic 10.00 Extracellular 0.00 CytoplasmicMembrane 0.00 OuterMembrane 0.00 Cytoplasmic 0.00 Final Prediction: Periplasmic 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>AO353_04615 MKMLKSTLAVVTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVG IDADYCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKF PGFITYYDGVGFLANSKLGVKSAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFD TSDESAKSLESGRCDVLTSDKSQLYAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEW LAIVRWVGYAMLNAEEAGITSKNVEAEAKSTKNPDVARLLGTDGEYGKDLKLPKDWVVKI VKQVGNYGEVFEKNLGKSTPLEIDRGLNALWTNGGIQYAPPVR
Lawrence Berkeley National Laboratory