PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on AO353_04645 (258 amino acids)

SeqID: AO353_04645 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15599060: probable amino acid binding protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>AO353_04645
MKKLPLIGGLALSLLACSSLFAAEKTLRIGIEAAYPPFASKTSDGKITGFDYDIGNALCA
QMKVKCEWVEGEFDGLIPSLKVKKIDAALSSMTINEDRKKSVDFTHKYYFTSSRLVMKDG
AVVDDQYASLKGKTIGVQRATTTDRYATEVFEPKGIKVARYSNNEEIYMDLAAGRLDAIF
ADTIPLSDFLSMPRGKGYAFVGPELKDPKYVGEGAGIAVRKGNTELVSQLNNAIDGIRAN
GEYQKIEAKYFKSDIYGD