Running PSORTb v3.0 on AZOBR_RS20990 (233 amino acids)
SeqID: AZOBR_RS20990 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic, CytoplasmicMembrane[matched 71164840: Cytoplasmic membrane associated cytoplasmic protein] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Cytoplasmic 9.12 CytoplasmicMembrane 0.88 Periplasmic 0.00 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: Cytoplasmic (This protein may have multiple localization sites.) 9.12 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>AZOBR_RS20990 VLTVRKLDAFYGEIQTLHGIDLDVLEGEVVSVVGANAAGKTTLLNAISGTVERYGRVSFF DQDIGTLPPHAIARHGLVQVPEGRRLFPFMTVRENLELGAFAPHARAHRAESLEKVFDLM PRLRERSGQLAGSMSGGEQQMCAIGRALMAKPRAIMFDEPTLGLAPIMVDVVFKLVRSIK ETGITILLVEQNVKHSLAMSDRGYVLENGHIVLSGPAADLLTDPRLKEAYLGG
Lawrence Berkeley National Laboratory