Running PSORTb v3.0 on AZOBR_RS25115 (256 amino acids)
SeqID: AZOBR_RS25115 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Periplasmic [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 71159382: Anaerobic glycerol-3-phosphate dehydrogenase subunit C] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 5.60 Periplasmic 2.86 Cytoplasmic 1.50 Extracellular 0.04 OuterMembrane 0.00 Final Prediction: Unknown (This protein may have multiple localization sites.) -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>AZOBR_RS25115 MSHDGTTNRPDIERPESVYFFGTCLVDLFYPEAGMAGMELLKAQGVRVVFPQGQSCCGQP AYNSGYREEALKVARAQLDYFPGDWPIVVPSGSCAGMMSKHWPDLFKGEPDEARARQVAS RVWELTQFLVQVLKVKFEDQGPPVKITWHASCHAQREMGVTDEPKALLRQLANVELVELQ REKECCGFGGTFAVRHPEISAAMVGDKVADIENTGAKAVVSGDCGCLMNISGALEGGKKP VRGVHIAQFLKERTHG
Lawrence Berkeley National Laboratory