PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS05355 (271 amino acids)

SeqID: BWI76_RS05355 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 128372: Lipoprotein 28 precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.97
    OuterMembrane          0.01
    Periplasmic            0.01
    Extracellular          0.01
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS05355
MAFNFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQVAEVAQKVAKEKYGLD
VELVTFNDYVLPNEALSKGDIDVNAFQHKPYLDQQIKDRGYKLVSVGNSFVYPIAGYSKK
IKSLDELQPGSQVAIPNDPTNLGRSLLLLQQVGLIKLKEGVGLLPTSLDIVENTKNLKIV
ELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEGKESPYVNLIVAREDNKDA
ENVKKFVQAYQSDEVYEAANKIFNGGAVKGW