PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS08110 (303 amino acids)

SeqID: BWI76_RS08110 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 2507365: Glutamate/aspartate periplasmic-binding protein precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS08110
MQLRKLAAAMLVMGLTAGAAHAEDAASTAGQSTLDKIAKNGVIVVGHRESSVPFSYYDNK
QQVVGYSQDYSNAIVDAIKKKLNKPDLQIKLIPVTSQNRIPLLQNGTYDFECGSTTNNLE
RQKQAAFSDTIFVVGTRLLVKKGGAIKDFPDLKDKAVVVTSGTTSEILLHKLNDEKKMNM
RIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGTAQSQEAYGCMLR
KDDPQFKTLVDDTVAHVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKSPNDK
ALN

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory