PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS17370 (262 amino acids)

SeqID: BWI76_RS17370 
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 130990: Glycine betaine/L-proline transport ATP-binding protein proV]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS17370
MKPLIQVQGVSQRFSTASGEFLALQNVSFDIYEGETISLIGHSGCGKSTLLNLIAGIALP
TEGGLLCDNREIAGPGPERAVVFQNHSLLPWLTCFDNVALAVDQVFRRSMSKGERKEWIE
HNLERVQMGHALHKRPGEISGGMKQRVGIARALAMKPKVLLLDEPFGALDALTRAHLQDA
VMQIQQSLNTTIVMITHDVDEAVLLSDRVLMMTNGPAATVGEILDVNLPRPRNRVQLADD
SRYHHLRQQILHFLYEKQPKAA