PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on CA265_RS19260 (255 amino acids)

SeqID: CA265_RS19260 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 61225725: Imidazole glycerol phosphate synthase subunit hisF]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>CA265_RS19260
MLKHRVIPALLLNQHGGLVKTTKFAAPKYIGDPLNAMRIFNTKEVDELMVLDIDASKLKR
EPNYGLIEQFAGECFMPLCYGGGIKTIDQAYKIFKLGVEKICLQTAVLEDLDLVRDLVAR
FGSSAIVVSVDVKKDWLQRPKLFKSSEGKNANENWISYIKQAVDAGAGEILLNAVDKDGT
LQGSDLTLIKQASGEISAPLIALGGIGSLKDIKDAVDAGASAVAAGAFFVFHGPHRAVLI
TYPQYQELLTLFNTK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory