PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Dsui_1689 (319 amino acids)

SeqID: Dsui_1689 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 71164789: Thioredoxin reductase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.99
    CytoplasmicMembrane    4.90
    Extracellular          0.10
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Dsui_1689
MTTQRHSRLLILGSGPAGYTAAVYAARANLKPVLITGLAQGGQLMTTTEVDNWPADAAGV
QGPELMQRFEEHARRFETEIIFDHIHTAKLQEKPFRLIGDAGEYTCDALIIATGASAQYL
GLPSEEKFAGRGVSACATCDGFFYRNQAVAVVGGGNTAVEEALYLANIASHVTVIHRRNK
FKSEKILQDKLMKKVEEGKVTVLWDSTLEEVLGDDSGVTGLKVKNVNTGATQEVPVMGVF
IAIGHKPNTELFEGQLELENGYIVTQSGRAGNATQTSITGVFAAGDVQDHIYRQACTSAG
TGCMAALDAERYLDGLEQA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory