Running PSORTb v3.0 on GFF1782 (253 amino acids)
SeqID: GFF1782 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [2 internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 15597025: probable short-chain dehydrogenase[Pseudomonas aeruginosa PAO1]] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: Periplasmic 6.49 CytoplasmicMembrane 3.24 OuterMembrane 0.14 Extracellular 0.14 Cytoplasmic 0.00 Final Prediction: Unknown (This protein may have multiple localization sites.) -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>GFF1782 MSMTFSGQVALVTGAAAGIGRATALAFAAEGLKVVVADLDATGGENTVALIHQAGGEALF VRCNVTLEADVQQLMAQTLAAYGRLDYAFNNAGIEIEKGKLADGSLDEFDAIMGVNVKGV WLCMKHQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI RVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTT GQALAVDGGATAI
Lawrence Berkeley National Laboratory