Running PSORTb v3.0 on GFF2454 (345 amino acids)
SeqID: GFF2454 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Periplasmic [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 15596449: probable L-malate dehydrogenase[Pseudomonas aeruginosa PAO1]] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Periplasmic 9.80 Cytoplasmic 0.19 CytoplasmicMembrane 0.00 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: Periplasmic 9.80 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>GFF2454 MSASPLDHAPSTTHLSYEALTLLLQRIFIRQGTSESVAQVLAENCASAERDGAHSHGVFR VPGYVSTLNSGWVDGKAVPIVEDVASGFVRVDAVNGFAQPALAAARSLLVDKARSAGIAL LAIHNSHHFAALWPDVEPFAEEGLVALSVVNSMTCVVPHGADRPLFGTNPIAFAAPRADG PPIVFDLATSAIAHGDVQIAARKGERLPPGMGVDSLGQPTQDPKAILEGGALLPFGGHKG SALSMMVELLAAALTGGNFSFEFNWSDHPGARTPWTGQLVILIDPSKTTGQNFAERSQEL VRQMHAAGLRRLPGDRRHRSRAKSQEIGIEINAQDLKQLQELAED
Lawrence Berkeley National Laboratory