PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF3964 (221 amino acids)

SeqID: GFF3964 
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 401471: D-methionine transport system permease protein metI]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF3964
MEDLLSNVDWTEIGWASWDTLVMVGMSLLFSVLIGLPIGVLLFLFGKRQLLEQPVAYAVL
SFVVNVLRSVPFIILLIVMIPFTVMLIGTSLGVAGAIPPLVAGGAPFFARLVETSLREVD
RGIIEATQAMGASVKQIIFGALLPEALPGIIAGITVTAITLVSYAAMSGVIGGGGLGDLA
IRFGYQRFQTDVMVITVALLVIFVQVLQMVGDRLVLYFSRK