PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ga0059261_1048 (255 amino acids)

SeqID: Ga0059261_1048 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 20455028: Imidazole glycerol phosphate synthase subunit hisF]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Periplasmic            6.00
    Cytoplasmic            4.00
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ga0059261_1048
MTVRARVIPCLDVANGRVVKGVNFVNLRDAGDPVEQARAYDAAGADELCFLDITASHEAR
GTIIDVVRRTAEVCFMPLTVGGGVRSAEDARALLLAGADKVAVNSAAVTRPEVVSEIAER
FGSQCIVASVDARRVADGRWEVFTHGGRKPTGIDAVEHALHLAKLGAGELLLTSMDRDGT
RDGYDLDLIRTIADRVRVPVVASGGVGNLDHLVAGIRDGHASAVLAASIFHFGEASIVGA
HAALAAAGIPVRSVG

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory