Running PSORTb v3.0 on Ga0059261_4049 (171 amino acids)
SeqID: Ga0059261_4049 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 15597078: Cytoplasmic protein] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Cytoplasmic 9.26 Periplasmic 0.48 CytoplasmicMembrane 0.24 OuterMembrane 0.01 Extracellular 0.01 Final Prediction: Cytoplasmic 9.26 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>Ga0059261_4049 MTRFTVNNQPVEYKLDARTPLLWALRDASNLTGTKYGCGTGDCGACTVDIDGAAVRSCQV TIGAIEGSFVTTIEGLAENRAHPVQRAFLAANVGQCGYCIPGMVMAASVLLRKNRNPSDE EIAAAITNLCRCGVYPRLIEAVGRAARLARGEDDSSAGEPDDQQTAIEPEA
Lawrence Berkeley National Laboratory