Running PSORTb v3.0 on H281DRAFT_03996 (198 amino acids)
SeqID: H281DRAFT_03996 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [1 internal helix found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Unknown [No matches against database] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: CytoplasmicMembrane 2.50 OuterMembrane 2.50 Periplasmic 2.50 Extracellular 2.50 Cytoplasmic 0.00 Final Prediction: Unknown -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>H281DRAFT_03996 MNRLFRFAAPCALALLASLLAAPGSALADGDDTALTNLIALASQRLALAEPVARWKWANH QAITDTPREQALLADVEKRAAAANVDPAFARAFFQDQIDASKDVQNALFASWRATQPPQE PAPDLATSTRPQLDRLTQSLVAGLARVQPLRAAPDCPSRVAQSLASWKSMTRYDSARSTA LNRALAHVCESGGVGATG
Lawrence Berkeley National Laboratory