PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on HSERO_RS16435 (198 amino acids)

SeqID: HSERO_RS16435 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.00
    Cytoplasmic            2.00
    OuterMembrane          2.00
    Periplasmic            2.00
    Extracellular          2.00
  Final Prediction:
    Unknown

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>HSERO_RS16435
MKSICVYCGSSPGASPAYAEAARKLAREMVNNNIALVYGGGNVGLMGIIASEVMQLGGEA
TGVIPKALLDKELGHDGLTRLHIVKDMHERKAMMAELSDGFVAMPGGMGTLEELFEVLTW
AQLGFHYKPICLYNVNGFYDNLIAFVDHLVSQRFVSSDQSGLMMHEADPARLIQRFQTFT
PTYKTKWADREAVANLLP