PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PP_2569 (558 amino acids)

SeqID: PP_2569 
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [11 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          CytoplasmicMembrane           [matched PS50850: MFS Profile - Cytoplasmic Membrane ]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2500934: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PP_2569
MAVLDSTSTGSAPQRGITKEERKVIFASSLGTVFEWYDFYLYGSLAAIIARHFFAGVNET
TSFIFALLAFAAGFAVRPFGAIVFGRLGDMIGRKYTFLITIVIMGLSTAVVGLLPGYATI
GVAAPIILITLRLLQGLALGGEYGGAATYVAEHAPKGRRGFFTAWIQTTATLGLFLSLLV
IMACRTAMGTEAFEAWGWRIPFLLSILLLAISVYIRLQLNESPVFMKMKAEGKASKAPLT
ESFARWDNLKVVIMSLLGGTAGQAVVWYTGQFYALFFLLQTLKIEAQTANLLIAGSLLIG
TPFFIFFGSLSDRIGRKKIIMAGCIIAALTYFPIFKALTEYGNPDVFVAQEQNPVVVVAD
PGQCAFQFDPVGKAKFTSSCDIAKSLLAKRAIPYTNEAAEPGSVAQIRIGERVLPSFDGS
SLAAADFKVQSEAFTATLSGALKEAGYPEKADQAKIHYPMVLLLLTILVIYVTMVYGPIA
AWLVELFPARIRYTSMSLPYHIGNGWFGGFLPTVAFAMVAATGDIYYGLWYPIVIAVMTA
VLGIFFLPETKDRDITHT

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory