PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PP_4232 (403 amino acids)

SeqID: PP_4232 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2493995: Diheme cytochrome c-type]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.96
    CytoplasmicMembrane    4.96
    Extracellular          0.07
    OuterMembrane          0.01
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PP_4232
MGFVRSASALALGLAVSSFALAADDAQVKRGEYLARAADCMACHTAEGGAPYAGGLPIHS
PFGTIYGSNITPDKQYGIGNYSADEFFAAVTEGKRKDGANLYPAMPYTSYHLIKREDSDA
ILAYLMTIPPINRPAPQTALRFPFNVRMGLSGWNMLYGKSVQLQPTEGKSPAWQRGQYMV
EVLGHCGECHTPRNPIGALQQDQRLSGGLLGGYLAPSLLAQDLAERGWTQPDLTTFLKHG
ISAQGSMFNEMFPVVHHSTQHLEDADLAAMATYLLGDQPPPAKAIESVALEQMSDSAKRG
HQQYLNVCAGCHGVDGEGKPHIAVAMRGNTVLRQADSRNLVKVVLEGIREQQFTGFERMQ
PMPGFADKLDDQQVIDMVNYLRQAWGGLPGDLNVQQLAELKAE

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory