PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf6N2E2_383 (255 amino acids)

SeqID: Pf6N2E2_383 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597025: probable short-chain dehydrogenase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            6.49
    CytoplasmicMembrane    3.24
    OuterMembrane          0.14
    Extracellular          0.14
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf6N2E2_383
MTLANKKVAVITGGAMGIGAEAASALASDGHHVIICDINTTEAERFAQQLRDQGFCADAF
QIDVGTPASVSAAFEWVEAKFGRCDVLVNSAGIAKTMPFLEFDADVFNRTMLINVTGTFL
CCQLAARIMRKHEFGRIINIASVAGMRAVGKGRTAYGTSKGAVIALTRQMAVELSEYGIT
ANAIAPGPVDTPMTKELHSDEFRKAYSNAIPAKRYGTTREIAGAVSYLASDVSAYVNGIV
LPVDGGFLAWGAGDI

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory