PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf6N2E2_3917 (667 amino acids)

SeqID: Pf6N2E2_3917 
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [12 internal helices found]
    Motif-            CytoplasmicMembrane           [matched PS01303: BCCT Pattern - Cytoplasmic Membrane]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 114921: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf6N2E2_3917
MSASSLPPSGLVRMNPPVFYFAATFILLFGLVVIAMPAQAGAWLLAAQNWAANTVGWYYM
LAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAAGISITLFFFCVSEPLT
HMVQPPQGEAGGTAEAARQAMQILFLHWGLHGWGVFAFVGMALAYFAYRHNLPLALRSAL
YPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGLDYLFGIAHTQWIQVGLI
VLMMGAAIIVAVAGVDKGVRVMSDINMLLACALLLFVLFAGPTQHLLNTLIQNIGDYLGA
LPMKSFDLYAYDKPSDWLGGWTVFYWAWWIAWSPFVGLFIARISRGRTIREFVFGVLLIP
LGFTLAWMSIFGNSAIDQVLNHGMSALGMSALENPSMSLYLLLETYPWSKTVIAVTVFIS
FVFFVTSADSGTVVLSTLSAKGGNPDEDGPKWLRVFWGAMTALVTSALLFSGSIDALKSA
VVLTSLPFSLILLLMMWGLHKAFYLESQKQIAQLHSLAPVSGSRRGTGGWRQRLSQAVHF
PSRDEVYRFLDTTVRPAIEEVTAVFVEKGLTVVTQPDPANDNVSLEIGHGEQHPFIYQVQ
MRGYFTPSFARGGMGSKELNNRRYYRAEVHLSEGSQDYDLVGYTKEQVINDILDQYERHL
QFLHLVR

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory