PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_1637 (205 amino acids)

SeqID: PfGW456L13_1637 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15599624: stringent starvation protein A[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_1637
MGVTNRLACYSDPADHYSHRVRIVLAEKGVSAEIIYVEAGRQPPKLIEVNPYGSLPTLVD
RDLALWESTVVMEYLDERYPHPPLLPVYPVARANSRLLMHRIQRDWCGLVDLILDSRTKE
AARAVARKELRESLTGVSPLFADKPFFLSEEQSLVDCCLLPILWRLPILGIELPRPAKPL
LDYMERQFAREAFQASLSGVERDMR