PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on RR42_RS28800 (745 amino acids)

SeqID: RR42_RS28800 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 1708408: Isocitrate dehydrogenase [NADP]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>RR42_RS28800
MSTQQPTIIYTLTDEAPLLATSAFLPIIRTFTAPAGINVTTSDISVAGRILGEFPEFLTE
AQRVPDNLAELGRLTLQPDTNIIKLPNISASVHQLVSAIKELQAKGYKVPDFPEDPKTDA
EKAIRQRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKNPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCDFYEE
QMEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYDKLESLPSSKREEIIRDMHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPVTMGTVPNVGLMAQQAE
EYGSHDKTFEVPEAGEARIVDIATGEVLLVQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHEAEMIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEELGIKTSNEKAKVLAKTLDAATGKLLDNNKNPSPKTGQLDNR
GSQFYLAMYWAQELAAQTDDAALAAQFAPLAKQLTDNEQVIVGELSAVQGKQADIGGYYK
PDFAKLDIVMRPSKTLNAALAAVKA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory