PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Synpcc7942_0638 (137 amino acids)

SeqID: Synpcc7942_0638 
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15595907: lactoylglutathione lyase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Synpcc7942_0638
MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN
WGKEQYELGDAYGHIAIGVDDIYATCEAIRARGGKISREPGPMKHGSTVIAFVEDPDGYK
VELIQTGTSGASAQPAA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory