PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 14505 FitnessBrowser__Keio:14505 (275 amino acids)

SeqID: 14505 FitnessBrowser__Keio:14505
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 34396000: Taurine transport system permease protein tauC]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 34396000: Taurine transport system permease protein tauC]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>14505 FitnessBrowser__Keio:14505
MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVATLQLISPLFLPPPQQVLE
KLLTIAGPQGFMDATLWQHLAASLTRIMLALFAAVLFGIPVGIAMGLSPTVRGILDPIIE
LYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSVQQVRIRAAQSLG
ASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATD
VVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ