PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 14753 FitnessBrowser__Keio:14753 (302 amino acids)

SeqID: 14753 FitnessBrowser__Keio:14753
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 71152736: Citrate lyase beta chain]
    SCL-BLASTe-       Cytoplasmic                   [matched 100% 71152736: Citrate lyase beta chain]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            10.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    Cytoplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>14753 FitnessBrowser__Keio:14753
MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDTARRMVY
HALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPKTDTAQDVLDIEKEILR
IEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGT
ELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIDLL
HNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDGPVIDRARLVLSRAELSGIR
EE

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory