PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 15019 FitnessBrowser__Keio:15019 (205 amino acids)

SeqID: 15019 FitnessBrowser__Keio:15019
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 38604702: Chlorate reductase subunit beta]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            5.41
    Periplasmic            4.48
    CytoplasmicMembrane    0.06
    Extracellular          0.05
    OuterMembrane          0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>15019 FitnessBrowser__Keio:15019
MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETK
GHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPKEV