Running PSORTb v3.0 on 15367 FitnessBrowser__Keio:15367 (334 amino acids)
SeqID: 15367 FitnessBrowser__Keio:15367 Analysis Report: CMSVM- CytoplasmicMembrane [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic, CytoplasmicMembrane[matched 2492549: Oligopeptide transport ATP-binding protein oppF] SCL-BLASTe- Cytoplasmic, CytoplasmicMembrane[matched 100% 2492549: Oligopeptide transport ATP-binding protein oppF] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 10.00 Cytoplasmic 10.00 OuterMembrane 0.00 Periplasmic 0.00 Extracellular 0.00 Final Prediction: CytoplasmicMembrane (This protein may have multiple localization sites.) 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>15367 FitnessBrowser__Keio:15367 MNAVTEGRKVLLEIADLKVHFEIKDGKQWFWQPPKTLKAVDGVTLRLYEGETLGVVGESG CGKSTFARAIIGLVKATDGHVAWLGKELLGMKPDEWRAVRSDIQMIFQDPLASLNPRMTI GEIIAEPLRTYHPKMSRQEVRERVKAMMLKVGLLPNLINRYPHEFSGGQCQRIGIARALI LEPKLIICDEPVSALDVSIQAQVVNLLQQLQREMGLSLIFIAHDLAVVKHISDRVLVMYL GHAVELGTYDEVYHNPLHPYTRALMSAVPIPDPDLEKNKTIQLLEGELPSPINPPSGCVF RTRCPIAGPECAKTRPVLEGSFRHSVSCLKVDPL
Lawrence Berkeley National Laboratory