PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 15854 b1736 N,N'-diacetylchitobiose-specific enzyme IIA component of PTS (NCBI) (116 amino acids)

SeqID: 15854 b1736 N,N'-diacetylchitobiose-specific enzyme IIA component of PTS (NCBI)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 66774159: N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component]
    SCL-BLASTe-       Cytoplasmic                   [matched 100% 66774159: N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            10.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    Cytoplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>15854 b1736 N,N'-diacetylchitobiose-specific enzyme IIA component of PTS (NCBI)
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory