PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 16032 b1918 predicted transporter subunit: membrane component of ABC superfamily (NCBI) (222 amino acids)

SeqID: 16032 b1918 predicted transporter subunit: membrane component of ABC superfamily (NCBI)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [3 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 84027924: Inner membrane amino-acid ABC transporter permease protein yecS]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 84027924: Inner membrane amino-acid ABC transporter permease protein yecS]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>16032 b1918 predicted transporter subunit: membrane component of ABC superfamily (NCBI)
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory