PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 16236 FitnessBrowser__Keio:16236 (243 amino acids)

SeqID: 16236 FitnessBrowser__Keio:16236
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 465590: Inner membrane ABC transporter permease protein yehW]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 465590: Inner membrane ABC transporter permease protein yehW]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Extracellular          0.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>16236 FitnessBrowser__Keio:16236
MKMLRDPLFWLIALFVALIFWLPYSQPLFAALFPQLPRPVYQQESFAALALAHFWLVGIS
SLFAVIIGTGAGIAVTRPWGAEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIA
LILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVRKVELPLAAPVILAGVRTSVI
INIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQALSQ
HAK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory