PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 16578 FitnessBrowser__Keio:16578 (190 amino acids)

SeqID: 16578 FitnessBrowser__Keio:16578
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 71159368: Glycine cleavage system transcriptional repressor]
    SCL-BLASTe-       Cytoplasmic                   [matched 100% 71159368: Glycine cleavage system transcriptional repressor]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            10.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    Cytoplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>16578 FitnessBrowser__Keio:16578
MTLSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNA
ITLIESTLPLKGAELDLLIVMKRTTARPRPPMPASVWVQVDVADSPHLIERFTALFDAHH
MNIAELVSRTQPAENERAAQLHIQITAHSPASADAANIEQAFKALCTELNAQGSINVVNY
SQHDEQDGVK