PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 17213 b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI) (263 amino acids)

SeqID: 17213 b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [5 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 1172735: N-acetylgalactosamine permease IID component]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 1172735: N-acetylgalactosamine permease IID component]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>17213 b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI)
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDN
LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG
ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL
GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK
AHPVLLIGVTFVLSIVCSAFGIL