PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 17496 b3434 predicted antibiotic transporter (NCBI) (197 amino acids)

SeqID: 17496 b3434 predicted antibiotic transporter (NCBI)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 54042636: UPF0056 inner membrane protein yhgN]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 54042636: UPF0056 inner membrane protein yhgN]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>17496 b3434 predicted antibiotic transporter (NCBI)
MNEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMVRELLIALLVMLVFLFAGEK
ILAFLSLRAETVSISGGIILFLIAIKMIFPSASGNSSGLPAGEEPFIVPLAIPLVAGPTI
LATLMLLSHQYPNQMGHLVIALLLAWGGTFVILLQSSLFLRLLGEKGVNALERLMGLILV
MMATQMFLDGIRMWMKG