PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 17511 b3450 ATP-binding component of sn-glycerol 3-phosphate transport system (VIMSS) (356 amino acids)

SeqID: 17511 b3450 ATP-binding component of sn-glycerol 3-phosphate transport system (VIMSS)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 731052: sn-glycerol-3-phosphate transport ATP-binding protein ugpC]
    SCL-BLASTe-       CytoplasmicMembrane           [matched 100% 731052: sn-glycerol-3-phosphate transport ATP-binding protein ugpC]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>17511 b3450 ATP-binding component of sn-glycerol 3-phosphate transport system (VIMSS)
MAGLKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGD
IWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAAR
ILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQL
HRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFIGSPAM
NLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHIALSSQAEGGVPMVMD
TLEILGADNLAHGRWGEQKLVVRLAHQERPTAGSTLWLHLAENQLHLFDGETGQRV