PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 18116 FitnessBrowser__Keio:18116 (311 amino acids)

SeqID: 18116 FitnessBrowser__Keio:18116
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 731982: D-allose-binding periplasmic protein precursor]
    SCL-BLASTe-       Periplasmic                   [matched 100% 731982: D-allose-binding periplasmic protein precursor]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    CytoplasmicMembrane    0.00
    Cytoplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>18116 FitnessBrowser__Keio:18116
MNKYLKYFSGTLVGLMLSTSAFAAAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIF
ASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLDEKIDMD
NLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATE
AFKKASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGK
TGKVLVVGTDGIPEARKMVEAGQMTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPE
FKLVDSILVTQ

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory