PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 199289 SO0092 purine nucleoside phosphorylase (NCBI ptt file) (236 amino acids)

SeqID: 199289 SO0092 purine nucleoside phosphorylase (NCBI ptt file)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 136740: Uridine phosphorylase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>199289 SO0092 purine nucleoside phosphorylase (NCBI ptt file)
MSTPHINANPGDFAKTIIMSGDPLRAKLIAETYLEDVKEVTNVRGILGFTGKYKSKDISI
MGHGMGAPSASIYFHELMATYGVKNFIRVGSCGAISDNIHLKDLIVAMGASTDSKINRIR
FLDHDLAAIANYDLLQACIEVLKTTTVNYKVGNVFSSDLFYRPNENDYTLMAKYGVLGVE
MEVNALYALAAEHQCRALALCTVTDHIVQHEHLTADERRTDLHEMVKVALETAIKI