PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on 200216 SO1033 iron-compound ABC transporter, ATP-binding protein, putative (NCBI ptt file) (285 amino acids)

SeqID: 200216 SO1033 iron-compound ABC transporter, ATP-binding protein, putative (NCBI ptt file)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 15598108: probable ATP-binding component of ABC transporter[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>200216 SO1033 iron-compound ABC transporter, ATP-binding protein, putative (NCBI ptt file)
MALNVSQLSWTIEGKTILSGVNFALQRGEMLGLIGPNGAGKSSLLRCLYRFIRPTQGQIS
LFSQDISQLSPKAFACKVAVVQQDTPHYFDMTTEQLVAMGLTPHKGMFDSHSSGDSDKII
KALEKVGLSHKLHQQYERLSGGEKQRALIARAIVQQPLLLILDEPTNHLDVRYQIQILEL
VRSLGISVIASIHDLNLASALCDSLLLLDNGQVSAMGTPTEVLTEERIAQVFGVCAQVMP
HPQHANPLINYFYGYQKSYGYQKSKTDEEGAIHPPHIINGVKTPS

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory